==== Front Sci Adv Sci Adv sciadv advances Science Advances 2375-2548 American Association for the Advancement of Science 37390217 adf6254 10.1126/sciadv.adf6254 Research Article Biomedicine and Life Sciences SciAdv r-articles Developmental Biology Evolutionary Biology Developmental Biology Integrating lipid metabolism, pheromone production and perception by Fruitless and Hepatocyte Nuclear Factor 4 Fru couples pheromone perception and production https://orcid.org/0000-0001-5210-6673 Sun Jie Conceptualization Formal analysis Investigation Methodology Project administration Supervision Validation Visualization Writing - original draft Writing - review & editing 1 2 https://orcid.org/0009-0008-1000-4255 Liu Wen-Kan Data curation Formal analysis Investigation Methodology Software Validation Visualization 1 2 https://orcid.org/0000-0001-7111-525X Ellsworth Calder Investigation Validation 1 https://orcid.org/0000-0001-6341-6036 Sun Qian Investigation Resources Writing - review & editing 3 https://orcid.org/0000-0002-1535-9716 Pan Yufeng Supervision Writing - review & editing 4 https://orcid.org/0000-0001-6409-485X Huang Yi-Chun Investigation Resources 1 2 https://orcid.org/0000-0002-9098-9769 Deng Wu-Min Conceptualization Data curation Funding acquisition Methodology Project administration Supervision Visualization Writing - original draft Writing - review & editing 1 2 * 1 Department of Biochemistry and Molecular Biology, Tulane University School of Medicine, New Orleans, LA 70112, USA. 2 Tulane Cancer Center, Tulane University School of Medicine, New Orleans, LA 70112, USA. 3 Department of Entomology, Louisiana State University, Baton Rouge, LA 70803, USA. 4 The Key Laboratory of Developmental Genes and Human Disease, School of Life Science and Technology, Southeast University, Nanjing 210096, China. * Corresponding author. Email: wdeng7@tulane.edu 6 2023 30 6 2023 9 26 eadf625402 11 2022 30 5 2023 Copyright © 2023 The Authors, some rights reserved; exclusive licensee American Association for the Advancement of Science. No claim to original U.S. Government Works. Distributed under a Creative Commons Attribution License 4.0 (CC BY). 2023 The Authors https://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution license, which permits which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Sexual attraction and perception are crucial for mating and reproductive success. In Drosophila melanogaster, the male-specific isoform of Fruitless (Fru), FruM, is a known master neuro-regulator of innate courtship behavior to control the perception of sex pheromones in sensory neurons. Here, we show that the non–sex-specific Fru isoform (FruCOM) is necessary for pheromone biosynthesis in hepatocyte-like oenocytes for sexual attraction. Loss of FruCOM in oenocytes resulted in adults with reduced levels of cuticular hydrocarbons (CHCs), including sex pheromones, and show altered sexual attraction and reduced cuticular hydrophobicity. We further identify Hepatocyte nuclear factor 4 (Hnf4) as a key target of FruCOM in directing fatty acid conversion to hydrocarbons. Fru or Hnf4 depletion in oenocytes disrupts lipid homeostasis, resulting in a sex-dimorphic CHC profile that differs from doublesex- and transformer-dependent CHC dimorphism. Thus, Fru couples pheromone perception and production in separate organs to regulate chemosensory communications and ensure efficient mating behavior. Fruitless and lipid metabolism regulator HNF4 integrate pheromone production and perception to ensure robust courtship behavior. http://dx.doi.org/10.13039/100000002 National Institutes of Health GM072562 http://dx.doi.org/10.13039/100000002 National Institutes of Health CA224381 http://dx.doi.org/10.13039/100000002 National Institutes of Health CA227789 http://dx.doi.org/10.13039/100007875 Tulane University start-up fund CopyeditorMjoy Azul ==== Body pmcINTRODUCTION Chemical sensing, regarded from an evolutionary perspective as the oldest one, is common to all organisms, which are surrounded by a world full of odors emitted from conspecific or heterospecific individuals and the environment (1). Chemical communication is fundamental to social behaviors such as conspecific recognition, courtship, aggression, aggregation, and avoidance. Many animals, including insects, rely on chemical cues to locate and select appropriate mating partners for reproductive success. Insect chemical communication involves the emission and perception of chemical cues (pheromones) and requires the coordination of different organs that are involved in pheromone biosynthesis and sensing, respectively (2). Drosophila, with its long tradition in behavioral studies, is an ideal model to explore the evolution and diversity of pheromones associated with the diverse array of social behaviors, and the ethological context connecting chemical communication to behavioral and systemic processes. Although substantial progress has been made in the Drosophila model during the past decades in unraveling the receptors and neural circuits for pheromone detection that give rise to innate behaviors, whether and how pheromone emission and perception are regulated in a coordinated manner remain to be explored. Insect cuticular hydrocarbons (CHCs), derived from long-chain fatty acids (LCFAs), are important for desiccation resistance (3–5) and starvation resistance (6). Some CHCs function as sex pheromones for mate recognition (7–11). As in other insects, specialized hepatocyte-like oenocytes, located in the inner surface of the abdominal cuticle, are the primary site for the biosynthesis of very LCFAs (VLCFAs) and VLCFA-derived hydrocarbons in Drosophila melanogaster (10, 12–14). Oenocytes are also the major site for reactive oxygen species metabolism, proteasome-mediated protein catabolism, xenobiotic metabolism, ketogenesis, and peroxisomal β-oxidation (15–21). Although the biosynthetic pathway for CHCs is active in both male and female oenocytes, the CHC profile shows sexual dimorphism (22). In most populations of D. melanogaster, sexually dimorphic expression of enzymes such as elongase F (eloF) and desaturase F (desatF) leads to female-biased enrichment of several CHCs including 7,11-HD and 7,11-ND (23, 24). Further proof that the CHC composition could be affected by sex-determination genes has been shown by ectopic expression of transformer (tra) in male oenocytes, which up-regulates eloF and feminizes the CHC profile (24, 25). However, the upstream molecular regulation mechanism of how these enzymes are associated with the sexual dimorphism of CHC biosynthesis remains elusive. Pheromone perception in Drosophila requires the neuronal function of fruitless (fru), a master regulator of the sexually dimorphic neural circuits that underlie sexual dimorphic patterns of courtship (26–29), aggression (30–32), sleep (33), and other behaviors. The fru gene spans more than 150 kb of the genome and harbors P1 to P4 promoters (34, 35). The distal P1 promoter is dedicated to the expression of male-specific Fru proteins (FruM), whereas P2 to P4 promoters are involved in the production of non–sex-specific Fru proteins (FruCOM) (fig. S1) (35–37). Compared with the well-characterized involvement of FruM in neuronal behavior, the precise function of FruCOM in development and behavior is less clear (38, 39). In this study, we report that FruCOM is required for CHC biosynthesis in adult oenocytes of both sexes for chemical communication and desiccation resistance. Silencing of fru in oenocytes resulted in desiccation-sensitive adults with accompanying social behavioral changes. We further identify evolutionarily conserved hepatocyte nuclear factor 4 (HNF4) as a key target of FruCOM to inhibit steatosis and to direct fatty acid conversion to hydrocarbons in oenocytes. Thus, fru is involved in both pheromone biosynthesis and perception by distinct splicing isoforms in separate organs, bringing sexual attraction and perception under the control of a single gene. RESULTS Fru is required in both the nervous system and oenocytes for innate courtship behavior To understand the function of FruCOM isoforms, we generated mosaic flies with whole-body clonal mutation of fru using a recently developed mosaic analysis by guide (g)RNA-induced crossing-over (MAGIC) technique, which generates mosaic animals containing genetically distinct populations of cells, based on DNA double-strand breaks produced by CRISPR-Cas9 (40). The double gRNA design allowed us to eliminate all Fru isoforms in mutant clones randomly induced by a heat-shock inducible Cas9 (fig. S1). Male flies bearing fru MAGIC clones, which were induced during the early third larval instar, exhibited male-male courtship and male chaining behavior (Fig. 1, A to D, and movie S1). This behavior is similar to FruM mutant flies reported previously (41, 42). The male-male courtship phenotype was reproduced when we used the Gal4/UAS system (43) to knock down fru expression with a pan-neuronal driver elav-Gal4 and a double-stranded (ds) RNA targeting exon C3, which is present in all Fru isoforms (Fig. 1, A to D, fig. S1, and movie S2). Fig. 1. Loss of fru function in the nervous system or oenocytes alters male courtship behavior. (A) Representative movie screenshots of fly groups with indicated genotypes showing male-male following and chaining behaviors in experimental groups. Thirteen male adults of the same genotype were collected and placed in one chamber. (B) Event maps generated from representative movies of indicated genotypes (1.5-min movie per map). (C) Polarized bar plots illustrating the ratio of each detected behavior. Each bar plot was generated from eight independent biological replicates (10-min movie per replicate). (D) Rug plots showing the chaining events detected from 10-min movies. The x axis refers to the time of the movie. Each vertical line with different color stands for the number of chaining events detected in a single frame. The corresponding color to the number of events is illustrated in the legend. The box plots of the chaining index are quantitative statistics of eight independent biological replicates. (E) Representative movie screenshots of pair-housed flies with indicated genotypes (black: active party; red: passive beheaded party; control: oeno-Gal4/+). The trajectory and behavioral classification of the active party are shown in (F). The arrow indicates the head orientation of the active party flies. The color of the arrow indicates different behavior statuses (gray: resting/walking; blue: following; salmon: singing) (1.5-min movie per map). Bar plots with error bars are the quantitative statistics of 10-min movies of eight independent biological replicates in (G). Data are represented as means ± SEM. P values are calculated using one-way analysis of variance (ANOVA) (D) and two-tailed unpaired t test (G) followed by Holm-Sidak multiple comparisons. ns, not significant; *P < 0.01 and ****P < 0.0001. To better assay the composite behavior phenotype of different fru loss-of-function (LOF) flies, we developed a machine learning–based automatic fly-behavioral detection and annotation (MAFDA) system to track flies and identify multiple classes of behavior such as chasing, singing, and copulating (fig. S2, A to E). The MAFDA platform facilitates the visualization of complex behavioral phenotypes under a temporal and spatial overlay, and quantitative comparison of behavioral indexes among different genetic backgrounds. When compared with idtracker.ai, a widely used animal trajectory tracking platform (44, 45), MAFDA ran and processed the same 10-min video (n = 13 flies) markedly faster (6 hours on idtracker versus 20 min on MAFDA). The MAFDA platform also has the function of real-time shooting and tracking recognition. In addition, the trajectories identified by idtracker tended to have long straight lines, while the same trajectories identified using MAFDA were continuous and smooth, even when the fly objects changed directions (fig. S2, F and H). By checking back at the video, we found that most of the long straight lines were caused by object loss or ID switch during tracking of fast-moving and overlapping objects and were much less frequent in MAFDA than idtracker (fig. S2, J and I). Using the MAFDA platform, we found that the male-male following, singing, and chaining behaviors exhibited in flies with MAGIC-induced fru mutant clones were comparable to or more pronounced than neuronal fru knockdown (Fig. 1D and fig. S3C). The severity of the behavior defects displayed by MAGIC fru mosaic flies is puzzling, as chances of random mutant clones hitting specific neurons are relatively small. We wondered whether the regulation of courtship behavior by Fru is not limited to the nervous system, as biosynthesis and release of pheromones in peripheral tissues play an important role as well. We therefore decided to test whether loss of fru may also interfere with pheromone production and release. Oenocytes, which perform certain lipid processing functions, are the principal site for the synthesis of VLCFA-derived CHCs, including sex pheromones, that are associated with a variety of social behaviors in D. melanogaster (10, 12, 13). Using two reported oenocyte-Gal4 drivers (promE-Gal4 and OK72-Gal4) (46, 47) to knock down fru expression, respectively, we found that male adult flies displayed extensive male-male following and chaining behaviors (hereafter, we refer promE-Gal4 as oeno-Gal4; Fig. 1, A to D, fig. S3C, and movie S3). MAFDA analysis revealed that the male-male courtship behavior exhibited by oeno > fruIR flies was highly pronounced (45% following, 25% chaining, and 8% singing; Fig. 1D and fig. S3C) and could be alleviated by FruCOM overexpression (UAS-fruCOMB) in oenocytes (Fig. 1D and fig. S3, C and E), indicating that the defect was caused by fru silencing. To avoid possible off-target effects of the dsRNA, additional independent fru RNA interference (RNAi) lines were used and showed similar male-male courtship phenotypes (Fig. 1D and fig. S3F). As revealed by MAFDA analysis, the degree of male-male courtship behavior by distinct RNAi lines was consistent with their respective knockdown efficiency (Fig. 1D and figs. S3C and S6D). In addition, we applied the gene switch (GS), a modified Gal4/UAS system that allows temporal and spatial control of transgene expression by adding the drug RU486 to food (48, 49). RU486 was added to induce fru knockdown after pupal eclosion to avoid a possible role of fru on oenocyte development from its larval progenitors. The behavioral phenotypes were similar between fru knockdown flies with or without GS in oenocytes (fig. S3G). Together, these findings suggest that fru is also required in oenocytes to maintain male-male repulsion. To verify that the male-male courtship behavior in oeno > fruIR flies was caused by changes in sexual signaling, such as pheromone production, rather than pheromone perception, we performed the single-pair mating experiment by placing a male fly with a headless target in the same chamber. The wild-type male was attracted to the headless male with fru depletion in oenocytes (oeno > fruIR), but not the headless male lacking Fru in pan-neurons (elav > fruIR) (Fig. 1, E to G). By contrast, the male fly with oenocyte-specific fru knockdown (oeno > fruIR) selected the decapitated wild-type female to initiate courtship but averted the wild-type male (Fig. 1, E to G). These results indicate that, while males lacking Fru in oenocytes maintain the ability in mate choice, they are attractive to wild-type males. Furthermore, to determine whether females with oenocyte depletion of Fru (oeno > fruIR) also show altered sexual attraction, we performed the two-choice courtship assay by putting a wild-type male and two headless female targets (oeno > fruIR and control oeno-Gal4/+) in the same chamber. MAFDA analysis revealed that the courtship index (CI) for oeno > fruIR females was ~60% of that of the control group (fig. S3, H and I), suggesting that females with oenocyte fru knockdown show reduced sexual attractiveness to male flies. Together, these results demonstrate that a deficiency of fru in oenocytes modifies sexual attraction in both sexes. Flies with fru depletion in oenocytes exhibit aberrant social behavior In Drosophila, innate social behaviors driven by pheromones include aggregation, male courtship, and female postmating behaviors (50). To test whether fru knockdown affects social aggregation, we measured the distance between individual male flies and their nearest neighbors: their “social space” (51), within a social group. Oeno > fruIR flies, on average, showed reduced social space and had more nearby neighbors when compared with the control (Fig. 2, A and B), suggesting that fru expression in oenocytes is necessary for flies to maintain their social distance. When we mixed male flies with two genotypes (six males of each genotype), the controls (oeno-Gal4/+) were attracted to oeno > fruIR flies, consistent with the paired experiment (Fig. 1, E and F), leading to a decrease in the overall social distance within the mixed population (Fig. 2, A and B). In addition, oeno > fruIR male flies showed reduced foraging behavior in a fixed time window (1 hour) (Fig. 2C). MAFDA analysis revealed that the foraging index of the oeno > fruIR males was ~60% of the control group, while there was no notable difference in the foraging behavior between the single-housing flies of these two genotypes (Fig. 2D). When the two genotypes were mixed in the same chamber, the foraging behavior of both genotypes decreased markedly (Fig. 2E). Measurement of solid food intake in adults via a dye tracer further revealed that flies with fru depletion ingested less food than wild-type flies over the same time period (2 hours). The food-intake difference was greater in the group setting than the single-house setting, suggesting that fru is required in oenocytes for social foraging behavior (Fig. 2F). To rule out that the observed social behavior changes are caused by impaired motor ability, we further examined their locomotion activity during the daytime. Compared with the control group, oeno > fruIR flies were more active, showing a 10% reduction in resting, a 35% increase in walking, and a 55% increase in leaping by MAFDA analysis (Fig. 2G), suggesting that the observed social behavior changes are not caused by impaired motor ability. Together, these data provide evidence that fru is required in oenocytes for innate social behavior. Fig. 2. Social behavior changes in male flies with fru depletion in oenocytes. (A) Male social space behavior analysis. Representative screenshots of an open-field assay indicate that flies in experimental groups tend to stay close together (black circles). (B) Quantification of the distance of each fly to its nearest neighbor and the number of surrounding neighbors of each fly for both control (oeno-Gal4/+) and oeno > fruIR males (n = 8 groups of 13 male flies for each genotype) (10-min movie per replicate). (C) Control (oeno-Gal4/+) and oeno > fruIR males were analyzed for the total number of social interactions in a “competition-for-food” assay. The heatmap on the right shows the degree to which flies gather in the food area. (D) Quantification of the total number of feeding times of the flies for control (oeno-Gal4/+) and oeno > fruIR males under group and single housing conditions (n = 10 groups of 13 flies for each group, n = 16 single-housing fly) (1-hour video per replicate). (E) Quantification of the total number of feeding times of the flies for control (oeno-Gal4/+) and oeno > fruIR males under group and mix housing conditions (n = 10 groups of 13 flies for each group, n = 8 mix-housing flies) (1-hour video per replicate). (F) Measurement of solid food intake in adults using a dye tracer (2 hours). Scale bars, 500 μm. (G) Locomotion activity of control (oeno-Gal4/+) and oeno > fruIR males was monitored. From left to right, bar plots show resting events, walking events, running events, and jumping events of flies, respectively (n = 8 independent experiments with 13 flies per genotype). For all paradigms, data are represented as means ± SEM. P values are calculated using one-way ANOVA (B), Wilcoxon rank sum test (D) and (E), and two-tailed unpaired t test (G) followed by Holm-Sidak multiple comparisons. Asterisks illustrate statistically significant differences between conditions. *P < 0.05, **P < 0.01, ***P < 0.001, and ****P < 0.0001. Fru function is necessary for CHC production In Drosophila, CHCs act primarily as pheromones and play fundamental roles in sexual attraction or repulsion (10, 52). Using gas chromatography–mass spectrometry (GC-MS) analysis, we identified 46 distinct chromatogram peaks from the cuticle extracts of wild-type adults and determined the chemical identities of their corresponding hydrocarbons (Fig. 3A and fig. S4, A and B). Subsequent analysis of CHC profiles by GC-MS and comparison of the main cuticular extracts of elav > fruIR and oeno > fruIR males revealed that the levels of total hydrocarbons were reduced by 90% when fru was knocked down in oenocytes, while fru-loss in the nervous system showed a CHC profile largely resembled the wild-type control (Fig. 3B and fig. S5A). Comparison of the CHC content in oeno > fruIR male flies revealed that 7-tricosene (7-T), the principal nonvolatile male pheromone (10), was reduced by 97% (Fig. 3C). Because 7-T mediates repulsion to other males and prevent male-male interactions (46, 53), the drastic reduction of 7-T explains why wild-type males show a strong preference of males with fru knockdown in the oenocyte (Fig. 1, A to D). In addition, oeno > fruIR males showed a 87% decrease of n-tricosane (nC23), which has been shown to negatively regulate courtship and mating in sexually mature Drosophila suzukii (54), though its behavioral implication in D. melanogaster is not clear. Fig. 3. Fru is required in the oenocytes for the biosynthesis of cuticular hydrocarbons. (A) Schematic of cuticular hydrocarbon extraction and GC-MS analysis. (B) CHCs from adult male flies of each genotype were analyzed using GC-MS. Compared with the control (oeno-Gal4/+) and elav > fruIR males, oeno > fruIR males exhibit noticeably lower levels of CHCs. (C) The absolute contents of total hydrocarbons, male key pheromones (7-T and nC23) carried by a single male were calculated by the loading of internal standards. (D) CHCs from females of each genotype were analyzed using GC-MS. Compared to controls and elav > fruIR females, oeno > fruIR females exhibit lower levels of CHCs. (E) The absolute contents of total hydrocarbons, female key pheromones (7,11-HD and 7,11-ND) carried by a single female were calculated by the loading of internal standards. Data are represented as means ± SEM. P values are calculated using one-way ANOVA followed by Holm-Sidak multiple comparisons. Asterisks illustrate statistically significant differences between conditions. *P < 0.05, **P < 0.01, ***P < 0.001, and ****P < 0.0001. CHCs are highly sexually dimorphic in D. melanogaster, with many of the compounds present in one sex but absent in the other, while shared compounds often differ between sexes (55). To determine whether fru knockdown also alters the CHC profile in female flies, we performed the GS-MS analysis and found that the total CHCs were reduced by 40% in oeno > fruIR females when compared with the control (Fig. 3E). Different from the male flies, the changes in the CHC profile fall mainly into the CHCs with the chain length beyond C26, which include the female pheromones 7,11-HD and 7,11-ND (Fig. 3D) (46). These results explain why wild-type females are more sexually attractive than females with fru knockdown in oenocytes (fig. S3I). The hydrophobic properties of CHCs protect insects from transpirational water loss through insect epicuticles and play a major role in desiccation resistance (13, 56). In oeno > fruIR flies, we found a substantial reduction of multiple long-chain n-alkanes, including n-heptacosane (nC27) and n-nonacosane (nC29) (Fig. 3, B to E, and fig. S5A). To test the hydrophobicity of these flies, both male and female adults were dehydrated and incubated in water to assess defects in the hydrophobic coating of the cuticle. While control carcasses remained at the surface of the liquid following a 4-hour incubation, oeno > fruIR carcasses sank below the surface (fig. S5, B and C). Together, these results suggest that fru is required in both male and female oenocytes for CHC and sex pheromone production. FruCOM, not FruM, is expressed in the oenocytes fru is a complex locus with sophisticated precise spatiotemporal control of transcription through four distinct promoters (fig. S1) (34, 35, 39). Translation of P1 transcripts in males produces the male-specific FruM proteins that have an amino-terminal extension of 101 amino acids preceding the BTB domain, whereas transcripts from the P2 to P4 promoters encode a set of non–sex-specific FruCOM proteins that have essential functions in the development of both sexes (fig. S1) (36). All Fru proteins are putative transcription factors containing a common BTB N-terminal domain and five alternatively spliced C terminus varying in the number and sequence of Zn-finger DNA binding domains (A, B, C, D, or E) (fig. S1) (34, 35, 57). To determine which Fru isoforms are expressed in oenocytes, we generated a polyclonal antibody recognizing an epitope in exon C3, which is present in both FruCOM and FruM isoforms (fig. S1). Similar to the two reported FruCOM antibodies (39, 58), this new anti-FruCOM antibody labeled a large number of cells in the central nervous system (CNS) of mature third instar larvae at the peak of Fru expression in both sexes (fig. S6A), and the signal was noticeably reduced when fru was knocked down in the CNS with two independent RNAi lines (BDSC#31593 and VDRC330035; fig. S6, A and B). Staining adult oenocytes with the new anti-FruCOM showed a strong signal in the nuclei of both male and female flies, whereas the FruM-specific antibody (59) detected no signal (fig. S6, C and D). FruCOM staining was lost in oenocytes with fru-RNAi knockdown or with MAGIC-induced fru depletion (fig. S6, D and E). Analysis of anti-FruCOM signals in oenocytes showed that the two fru-RNAi lines induced different knockdown efficiencies, which were confirmed by reverse transcription quantitative polymerase chain reaction (RT-qPCR) analysis with actin5c-Gal4 for whole-body fru knockdown (fig. S6G). The difference in knockdown efficiency is probably responsible for the difference in the severity of the male-male courtship behavior phenotypes (Fig. 1, A to D, and fig. S6F). Together, these results suggest that FruCOM, not FruM, is expressed in oenocytes in both sexes. FruCOM is required for proper expression of genes involved in hydrocarbon biosynthesis in oenocytes LCFA biosynthesis is predominantly derived from palmitate, which is synthesized by acetyl-CoA carboxylase (ACC) and fatty acid synthase 2 (FASN2) (60). After that, they are elongated by the successive action of elongases, desaturases, and decarbonylate enzymes, before being converted to hydrocarbons (13, 56, 61) (fig. S7). The enzymes involved in the hydrocarbon biosynthetic pathway are highly conserved in insects (22). To determine how FruCOM affects hydrocarbon biosynthesis, we generated multiple RNA sequencing (RNA-seq) datasets from adult male oenocytes with fru knockdown by three independent fru-RNAi lines with corresponding control samples and a FruCOM overexpression line, which were then subjected to principal components analysis (PCA). On the PCA plot, the three independent fru-RNAi datasets clustered together and separated from the control and FruCOM overexpression samples (Fig. 4A). Hierarchical cluster analysis of significantly different genes (P ≤ 0.001 and ≥4-fold change) revealed that the control, fru knockdown, and FruCOM overexpression groups formed distinct clusters with clear differences at the whole transcriptome level (Fig. 4B). Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway enrichment analysis revealed that the majority of down-regulated genes in the fru knockdown group were related to metabolic regulation, including fatty acid elongation, xenobiotic, and drug metabolism (Fig. 4C). These genes and pathways show conserved functions in Drosophila oenocytes and the mammalian liver (62). Using clusterProfiler, we performed gene set enrichment analysis (GSEA) (63) and identified subtle but coordinated expression changes of metabolic pathways following fru knockdown, revealing down-regulation of genes in xenobiotic metabolism, drug metabolic, and fatty acid elongation pathways (Fig. 4D and fig. S7). Notably, genes involved in various steps of VLCFA and hydrocarbon biosynthesis, including ACC, Hnf4, FASN2, desaturase1 (desat1), cytochrome P450 4 g1 (Cyp4g1), and multiple elongases (CG16904 and CG30008), all showed substantial down-regulation in the fru knockdown group (Fig. 4E). Decreased transcription of these genes was confirmed by RT-qPCR analysis of RNAs extracted from male oenocytes (Fig. 4, F and G). These findings suggest that Fru is required for the developmental induction of key genes in the VLCFA/hydrocarbon biosynthetic pathway in adulthood. Fig. 4. Bulk RNA-seq analysis to identify genes affected by fru knockdown in oenocytes. (A) PCA plot shows that the biological replicates of each genotype are highly consistent. The datasets from fru knockdown induced by three independent RNAi lines show good clustering. (B) Heatmap of expression of differentially expressed genes identified from bulk RNA-seq. Gene expression is shown in normalized log2 counts per million. Differentially expressed genes were selected on the basis of the threshold of P ≤ 0.001 and ≥4-fold change. (C) Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway enrichment analysis. Pathway enrichment of differentially expressed genes. The y axis indicates the pathway name, and the x axis indicates the fold change. (D) Gene set enrichment analysis for interpreting gene expression data of four metabolic pathways. (E) Down-regulation of VLCFA/hydrocarbon biosynthesis genes in oenocytes with fru knockdown from two independent replicates. Colors in the heatmap correspond to the scaled FPKM which is shown as a number in each cell. (F) The FA synthesis & elongation pathway from KEGG, with green boxes indicating genes down-regulated in this subset, and RT-qPCR analysis of genes in the VLCFA/hydrocarbon metabolic pathway (controls: blue bars; oeno > fruIR: salmon bars) (G). Transcript levels are normalized to Rp49 mRNA and presented relative to the level of controls. Asterisks illustrate statistically significant differences between conditions. **P < 0.01, ***P < 0.001, and ****P < 0.0001. FruCOM controls Hnf4 expression in oenocytes to maintain lipid homeostasis The hepatocyte-like oenocytes accumulate lipid droplets (LDs) as a normal response to fasting and this readout of steatosis also indicates abnormal lipid metabolism in fed flies (16, 46). We noticed LD accumulation in oenocytes in both starved and fed oeno > fruIR flies, suggesting that fru is required for preventing steatosis independent of nutritional status (Fig. 5A). To determine whether fru knockdown interferes with systemic lipid homeostasis, we measured the triacylglycerol (TAG) levels in oeno > fruIR male adults and found that the whole-body TAG level of these flies was 2.4-fold of the control (Fig. 5B). In addition, thin layer chromatography (TLC) of adipose tissue revealed that the TAG content, but not free fatty acids, was noticeably increased when fru was depleted in oenocytes (Fig. 5C). Consistently, flies bearing fru MAGIC clones exhibited similar LDs accumulation, and fru depletion–induced steatosis could be alleviated by FruCOM overexpression in oenocytes (Fig. 5D). These results indicate that Fru functions in oenocytes to prevent steatosis and to maintain systemic lipid homeostasis. Fig. 5. Fru controls HNF4 expression in the oenocytes to inhibit steatosis. (A) Bodipy stains are depicted for oenocytes dissected from control and oeno > fruIR males raised on standard diet (SD) and starved for 7 days after emergence. Oenocytes are outlined with a yellow dotted line. (B) Triglyceride levels were measured in 7-day-old control and oeno > fruIR reared on a SD after emergence. Metabolite levels are normalized to total protein and presented relative to the amount in control animals. Red indicates that a decapitated whole body was used as the sample material, and blue indicates that only adipose tissue [fat body (FB) and oenocytes] was used. CS, control system. (C) Thin layer chromatography analysis shows TAG and free fatty acid (FFA) levels in adipose tissue of control and oeno > fruIR males. DG, diacylglycerol. MG, Monoacylglycerol. (D) Nile red stains are depicted for oenocytes dissected from fru mutant clones and oeno > fruIR + fruOE males cultured on SD. (E) fru knockdown in oenocytes resulted in decreased HNF4 protein levels. Top: Fru (magenta) colocalized with HNF4 (yellow) in control oenocytes. Bottom: The level of HNF4 was noticeably reduced in oenocytes of fru knockdown. (F) Green fluorescent protein (GFP)–tagged HNF4 from the endogenous Hnf4 promoter is highly expressed in oenocytes, but the GFP signal is lost in oenocytes with fru knockdown. (G) Bodipy (green) and anti-HNF4 (magenta) stains are depicted for oenocytes dissected from oeno > Hnf4IR males raised on SD. (H) Bodipy stains are depicted for oenocytes of oeno > fruIR+Hnf4OE males cultured on SD. Scale bars, 10 μm. DAPI, 4′,6-diamidino-2-phenylindole. *P < 0.05 and **P < 0.01. Among the down-regulated genes induced by fru depletion, we focused on Hnf4, which has been reported to be necessary for maintaining lipid homeostasis and promoting fatty acid conversion to VLCFA and hydrophobic hydrocarbons in oenocytes (64). To determine whether HNF4 acts downstream of Fru, we first used an anti-HNF4 antibody (65) and found that the HNF4 protein level was obviously down-regulated in fru-silenced oenocytes (Fig. 5E and fig. S8A). Consistently, a HNF4 protein trap line with green fluorescent protein (GFP)–tagged endogenous HNF4 (66) showed loss of the GFP signal in oenocytes with fru depletion (Fig. 5F), further suggesting that HNF4 expression is regulated by fru in oenocytes. To determine whether Hnf4 is functionally downstream of fru in oenocytes, the dsRNAs of Hnf4 (Hnf4IR) were targeted to oenocytes by oeno-Gal4. As expected, the knockdown of Hnf4 in oenocytes resulted in similar steatosis, as reported previously (64), whereas HNF4 overexpression alleviated lipid accumulation induced by fru depletion (Fig. 5, G and H). Together, these results suggest that FruCOM regulates HNF4 expression in oenocytes to inhibit steatosis and maintain systemic lipid homeostasis. Hnf4 is essential in mediating fru-regulated CHC biosynthesis and courtship behavior To determine whether fru-regulated CHC production is mediated by HNF4, we used GC-MS to measure hydrocarbon levels in flies with HNF4 depletion in oenocytes (oeno > Hnf4IR). Expectedly, these flies also show substantial decreases in total CHCs in both sexes (a 94% decrease in males and a 62% decrease in females), similar to flies with fru knockdown in oenocytes (Fig. 6, A to D). Notably, the knockdown of Hnf4 also resulted in a defective synthesis of sex pheromones in both sexes, including male pheromone 7-T (99% decrease) and nC23 (89% decrease) as well as female pheromone 7,11-HD (66% decrease) and 7,11-ND (80% decrease) (Fig. 6, A to D). In addition, oeno > Hnf4IR flies also showed a marked reduction of multiple long-chain n-alkanes (Fig. 6, A to D), resulting in defects in the hydrophobic coating of cuticles in both male and female adults (fig. S8B). Next, we asked whether reintroducing HNF4 in oenocytes with fru knockdown would restore the CHC profile and found that the total CHC levels were restored to 71 and 79% of the control males and females, respectively. It is noteworthy that the major sex pheromones in both male and female flies, especially 7-T and 7,11-HD, were well recovered and comparable to the levels of the control flies (Fig. 6, A to D). Fig. 6. Fru controls HNF4 expression in the oenocytes to maintain CHC biosynthesis and innate courtship behavior. (A) GC-MS analysis of CHCs from male adults in control (oeno-Gal4/+), oeno > fruIR, oeno > Hnf4IR, and oeno > fruIR + Hnf4OE. (B) The absolute contents of total hydrocarbons, male key pheromones (7-T and nC23) carried by a single male were calculated by the loading of internal standards. (C) GC-MS analysis of CHCs from female adults of controls (oeno-Gal4/+), oeno > fruIR, oeno > Hnf4IR, and oeno > fruIR + Hnf4OE females. (D) The absolute contents of total hydrocarbons, female key pheromones (7,11-HD and 7,11-ND) carried by a single female were calculated by the loading of internal standards. Data are represented as means ± SEM. P values are calculated using one-way ANOVA followed by Holm-Sidak multiple comparisons. Asterisks illustrate statistically significant differences between conditions. *P < 0.05, **P < 0.01, ***P < 0.001, and ****P < 0.0001. (E) Representative movie screenshots of fly groups with indicated genotypes. Thirteen male adults of the same genotype were collected and placed in one chamber. (F) Event maps generated from representative movies of indicated genotypes (1.5-min movie per map). (G) Polarized bar plots illustrating the ratio of each detected behavior. Each bar plot was produced from eight independent biological replicates (10-min movie per replicate). (H) Rug plots showing the chaining events detected from 10-min movies. The x axis refers to the time of the movie. Each vertical line with different colors indicates the number of chaining events detected in a single frame. The corresponding color to the number of events is illustrated in the legend. (I) The box plots of the chaining index are quantitative statistics of eight independent biological replicates. The impairment of CHC biosynthesis suggests that flies with Hnf4 knockdown in oenocytes may also have changed courtship behavior patterns. To test this, we applied the MAFDA platform to analyze the courtship behavior of male flies with oenocyte Hnf4 knockdown using two independent Hnf4-RNAi lines. As expected, these flies exhibited pervasive male-male courtship and chaining behaviors, similar to fru-depleted males (Fig. 6, E to I; fig. S8, C and D; and movie S4). Misexpression of HNF4 in oenocytes with fru knockdown alleviated the male-male courtship and male-chaining phenotypes when compared with fru knockdown alone (Fig. 6, E to I, fig. S8D, and movie S5), highly consistent with their respective CHC profiles (Fig. 6A). Together, these results suggest HNF4 is a key factor downstream of Fru in oenocytes to control pheromone and CHC production and its down-regulation is accountable for the behavior phenotypes displayed by oeno > fruIR flies. dsx and fru depletion induce two distinct sex-dimorphic CHC profiles Although fru or Hnf4 knockdowns in oenocytes induced substantial decreases of total CHCs in both male and female flies, the changes appeared sexually dimorphic. While males showed almost complete loss of CHCs, the reduction of CHCs in females was mostly on those with a chain length beyond C26 (Fig. 3, B to E). In insects, the sexual dimorphism of CHCs could be regulated by sex-determination genes, including tra and dsx (23, 67–69). Consistently, knockdown of dsx in oenocytes caused male-chaining behavior (Fig. 7A). To test whether fru acts downstream of dsx in oenocytes, we first performed immunohistochemistry analyses using anti-HNF4 and anti-FruCOM antibodies and found that the protein levels of HNF4 and FruCOM were not noticeably changed in oenocytes with dsx knockdown (Fig. 7B). RT-qPCR analysis further showed that dsx knockdown did not cause obvious changes in fru transcripts but up-regulated Hnf4 by 41% (Fig. 7C). Further CHC profiling revealed that oenocyte-specific depletion of dsx led to a 26% increase in total CHCs in males but a 19% decrease in females (Fig. 7, D to G). Consistent with these findings, oeno > dsxIR male flies showed better water repellency than controls, whereas females had impaired hydrophobic coating of the cuticle (fig. S9, A and B). And at the pheromone level, dsx-loss in oenocytes caused feminization of the pheromone profile in male flies and masculinization of the pheromone profile in females (Fig. 7, D to G). These findings reveal that, despite the phenotypic similarity in courtship behavior between dsx- and fru-deleted flies, the underlying mechanism of these two genes in regulating CHC and pheromone profiles is different (Fig. 7, D to G). The mechanism underlying the sex differences of CHC profile in fru- and Hnf4-depleted flies is yet to be determined. Nonetheless, our results suggest that fru is not a downstream target of dsx in regulating CHC biosynthesis in oenocytes. Fig. 7. Fru does not act downstream of Dsx in regulating CHC biosynthesis. (A) Silencing of dsx in oenocytes causes male chaining behavior. (B) Immunostaining shows that FruCOM and HNF4 protein levels remain high in oenocytes with dsx knockdown. Scale bar, 10 μm. (C) Transcript levels of fru and Hnf4 were analyzed by RT-qPCR in dsx knockdown oenocytes (control: blue bars; oeno > dsxIR: salmon bars). Transcript levels were normalized to Rp49 mRNA and presented relative to control levels. (D) CHCs from males of each genotype were analyzed using GC-MS. oeno > fruIR males exhibit noticeably lower levels of CHCs in the full spectrum than the control (oeno-Gal4/+). (E) The CHCs of oeno > dsxIR males, in contrast, exhibit a mixture of low levels of characteristic male hydrocarbons (7-T) and high levels of diene hydrocarbons (7,11-HD and 7,11-ND, characteristic of females). (F) GC-MS analysis of CHCs in female adults shows that oenocyte-specific knockdown (oeno > fruIR) resulted in lower levels of CHCs in the full spectrum than control females. (G) Knockdown of dsx in female oenocytes (oeno > dsxIR) resulted in lower female pheromones (diene hydrocarbons 7,11-HD and 7,11-ND) but high levels of male pheromone (7-T). Data are represented as means ± SEM. P values are calculated using two-tailed unpaired t test (C) and one-way ANOVA (E) and (G) followed by Holm-Sidak multiple comparisons. Asterisks illustrate statistically significant differences between conditions. *P < 0.05, **P < 0.01, ***P < 0.001, and ****P < 0.0001. DISCUSSION This study reveals a combined control of pheromone production and perception by a zinc-finger transcription factor gene, fru, which regulates lipid homeostasis through an evolutionarily conserved gene Hnf4, thereby promoting the robustness and efficiency of courtship behavior in D. melanogaster. Such an integrated regulation of sexual attractiveness and sexual perception/execution by a single gene in distinct cells may have a reproductive advantage, as the recruitment of fru in certain insect species (70) could enhance both the emission and perception of sex-related cues simultaneously, which has stronger selective advantage than separate evolvement of each process (Fig. 8). Previously, desat1 has been shown to be involved in both pheromone production and perception (71). A recent study found that the Gr8a gene, which belongs to the gustatory receptor gene family, is expressed specifically in male oenocytes and plays a role in the synthesis of certain male CHCs by regulating the level of Desat1 (72). On the basis of our RNA-seq analysis, desat1 is a likely downstream target of fru in the oenocyte. It will be interesting to find out if desat1 also acts downstream of fru in pheromone production and/or perception. Fig. 8. The model of fruitless regulates pheromone biosynthesis and perception. A schematic drawing to show that Fru regulates both pheromone production and perception through different isoforms (the male-specific FruM and the non–sex-specific FruCOM) expressed in different organs, thereby promoting the robustness and efficiency of courtship behavior. FruCOM expression in oenocytes regulates HNF4 protein levels for the biosynthesis of sex pheromones, along with other cuticle hydrocarbons required for desiccation resistance. The fru gene locus contains a complex transcription unit with multiple promoters and alternative splicing isoforms (Fig. 4A). fru P1 transcripts have only been detected in the nervous system, their sex-specific protein product FruM is expressed in ∼2000 neurons to masculinize their structure and function (73). In contrast, FruCOM is expressed in both neural and nonneural tissues. Its expression has been detected in neuroblasts in both male and female larval CNS (39). FruCOM appears to be also required in the adult female brain to regulate female rejection behavior (74). Outside the nervous system, FruCOM is detected in specific cell types in the reproductive system (58, 73) and is necessary for the maintenance of germline stem cells and cyst stem cells in male gonads (38). Our study shows that, in pheromone-producing oenocytes, FruCOM, rather than FruM, is expressed in both sexes and plays a key role in CHC biosynthesis (fig. S6, C and D). Although how the sex- and tissue-dynamic expression of FruM and FruCOM is orchestrated remains to be resolved, the utilization of different transcriptional/splicing products of the same gene in pheromone production and perception may provide a potential advantage in coordinating these two related biological processes during development. In insects, pheromone synthesis has coevolved with chemosensory perception. Numerous examples of correlated evolutionary changes between pheromone production and perception have been reported, with evolutionary pros and cons of sex-specific pheromones mirroring their sensory responses (75, 76). The genetic mechanisms that control pheromone perception are best understood in Drosophila with >150 chemoreceptor proteins identified (10). The odorant receptor neurons (ORNs) that express ORs are specialized to detect the most volatile chemicals, including low-volatility pheromones (77). In Or47b ORNs, fru has been shown to regulate sensory plasticity and act as a downstream genomic coincidence detector (78–81). Although it is unclear whether Hnf4 is regulated by fru in the nervous system, the neuronal function of Hnf4 has been reported during neural stem cell differentiation and in the aging brain for β-oxidation of fatty acids (82, 83). Impaired lipid homeostasis has been shown to be associated with disrupted neuronal integrity in human neurodegenerative diseases (84). It will be interesting to find out whether lipid homeostasis regulated by Hnf4 is an integral part of the fru-regulated neural network in pheromone detection. Many insect CHCs and pheromones undergo rapid evolution and show sexual dimorphism. Genetic manipulations of sex-determination genes such as sxl, dsx, or tra in D. melanogaster have been shown to alter the CHC profile (47, 85–88). Gain of function or LOF dsx or tra induces either masculinization or feminization of CHCs, with major changes at sex-specific pheromones (Fig. 7, D to G) (47, 85). The sexually dimorphic CHC patterns regulated by dsx or tra appear to stem from their regulation of DesatF and EloF expression, respectively (23), which promotes female long-chain hydrocarbon biosynthesis (Fig. 7, D and E) (24, 25). Our study revealed an unusual sex-dimorphic CHC profile resulting from fru or Hnf4 depletion in oenocytes (Figs. 3, B to E, and 6, A to D), which differs substantially from sxl-, dsx- or tra-dependent sexual dimorphism of the CHC profile (Fig. 7, D to G) (69). In contrast, male flies with fru or Hnf4 knockdown have substantially reduced pheromones, and their behavioral phenotype is consistent with a previous report that wild-type males exhibit a higher preference for males without CHCs (similar to the oeno > fruIR generated in this study) over wild-type females (46). The regulatory hierarchy between dsx and fru may be different between tissues. In the CNS, transcripts of both fru and dsx undergo sex-specific splicing regulated by upstream genes in the Drosophila sex-determination hierarchy (89, 90). In male gonads, expression of FruCOM is regulated by dsx and independent of tra (38). However, in oenoctyes, we found that neither protein nor transcript levels of fru were noticeably changed when dsx was knocked down. Note that the transcript level of Hnf4 was slightly up-regulated in oeno > dsxIR, which may contribute to the synthesis of long-chain feminizing pheromones in males (Fig. 7, B and C). Although our studies did not reveal whether Hnf4 is a transcription target of Fru or Dsx in the oenocyte, previous studies have shown the existence of direct binding sites for Fru/Dsx on the Hnf4 locus (91, 92). The evolutionary variation of CHCs among different Drosophila species is necessary for the maintenance of reproductive isolation. A class of dienes that serve as sex pheromones exhibit particularly diverse patterns between species with sexually monomorphic or dimorphic CHCs. Drosophila species with sexually dimorphic CHCs, such as D. melanogaster, Drosophila sechellia, and Drosophila erecta, produce long-chain dienes in females specifically (8, 55, 87). Species with sexually monomorphic CHCs can be divided into two categories: the one that produces long-chain dienes in both sexes, such as Drosophila serrata, Drosophila pseudoobscura, and Drosophila persimilis (93–95), and the other that does not produce dienes, such as Drosophila simulans, Drosophila mauritiana, Drosophila yakuba, Drosophila teissieri, Drosophila orena, and Drosophila santomea (23, 96–98). The acquisition of a binding site for Dsx at the DesatF regulatory region is suggested to be responsible for the evolutionary transition from monomorphism to dimorphism (23). In D. melanogaster, the induction of masculinized females by dsx-loss is caused by down-regulation of DesatF expression in oenocytes, which leads to decreased synthesis of dienes and increased monoenes (such as 7-T and 7-P; Fig. 7, F and G) (24, 25). Consistently, the knockdown of desatF in oenocytes also results in a decrease in dienes and an increase in monoenes (99), as insect CHCs are synthesized from a common pathway that uses acetyl-CoA as the substrate for chain elongation, the changes in dienes would have an indirect effect on monoenes (100). Although the dsx locus is highly conserved, desatF and its expression evolve rapidly. In species with monomorphic CHCs that do not express DesatF, such as D. simulans, genetic ablation of dsx will probably not affect 7-T significantly since this species does not synthesize diene CHCs. Fru and HNF4, revealed from our studies, may play a broad role in connecting multiple steps of VLCFC metabolism and CHC biosynthesis, including fatty acid elongation, desaturation, decarbonylation, etc. (Fig. 4, E to G). A crucial downstream gene of Fru in oenocytes is probably Cyp4g1, which encodes a functionally conserved P450 enzyme involved in the terminal oxidation decarbonylation of CHCs (64). Oenocyte-specific knockdown of Cyp4g1 causes an almost complete loss of all CHCs (56), a phenotype similar to the knockdown of fru. Depletion of fru in oenocytes markedly reduced the transcript level of Cyp4g1 (Fig. 4, E to G). fru and dsx may contribute to the evolution of CHCs and interspecies reproductive isolation through different mechanisms. The highly conserved Dsx isoforms mainly generate a small number of sexually dimorphic CHCs. Different from dsx, fru knockdown affects a wide range of alkanes, monoenes, and dienes (Figs. 3, B to E, and 6, A to D). Thus, the evolution of fru in insects may generate diverse amounts of CHCs across species, contributing to reproductive isolation to some extent. Note that only FruCOM, but not FruM, is expressed in some insect species, such as Hawaiian flies (101), suggesting that the P1 promoter–derived FruM may be evolved later in males to couple pheromone perception with pheromone production, a process that may further enhance mating efficiency. MATERIALS AND METHODS Fly strains and genetics Flies were maintained at 25°C, 60% relative humidity, and a 12-hour light/dark cycle. Adults and larvae were reared on a standard cornmeal and yeast-based diet unless otherwise noted. The Gal4/UAS–driven RNAi crosses were cultured at 25°C until eclosion, and then incubated at 29°C for 7 days, and the same culture conditions were also used for the control group. promE-Gal4 and promE-GS-Gal4 (oeno-specific GAL4) were obtained from H. Bai (102). To evaluate the influence of fru knockdown on the efficiency of the promE-GS-Gal4 line, we examined the fluorescent intensity of GFP in the oenocyte of promE-GS > UAS-mCD8-GFP and found that fru knockdown reduced GFP fluorescent intensity by ~58% (fig. S3A). UAS-fruMA and UAS-fruCOMB were from M. Arbeitman. elav-Gal4 (BDSC#458), UAS-fruRNAi (BDSC#31593), UAS-GFP (BDSC#5413), OK72-Gal4 (BDSC#6486), Hnf4::GFP.FLAG (BDSC#38649), UAS-Hnf4RNAi (BDSC#29375), UAS-Hnf4RNAi (BDSC#64988), UAS-dsxRNAi (BDSC#55646), Act5C-GAL4 (BDSC#4414), and W1118 (BDSC#5905) were obtained from the Bloomington Drosophila Stock Center. UAS-fru-gRNA (VDRC#342548), UAS-fruRNAi (VDRC#330035), and UAS-fruRNAi (VDRC#105005) were obtained from the Vienna Drosophila Resource Center. UAS-Hnf4::HA (F000144) was obtained from FlyORF (Zurich ORFeome Project). RU486 (mifepristone, Thermo Fisher Scientific) was dissolved in 95% ethanol, and then added to standard food at a final concentration of 100 μM for all the experiments. For activation of the GS Gal4 driver, flies were fed on RU486 food for seven consecutive days, unless otherwise noted. To temporally induce fru MAGIC clones, the early third instar larvae of w; UAS-fru-gRNA/Act5C-Gal4; HS-Cas9/+ were heat-shocked for 30 min at 37°C and examined on day 7 after eclosion. The HS-Cas9 stock was provided by C. Han (40). Behavioral assays For the single-pair courtship assay, a tester male and a target fly (both on day 7 after eclosion) were gently aspirated into a round two-layer chamber (diameter: 1 cm; height: 3 mm per layer) to allow the courtship test. The CI, the percentage of observed time a fly performed any courtship step, was used to measure courtship between the tester male and the target fly. Each test was performed for 1 hour. For the male chaining assay, the tester males were loaded into large round chambers (diameter: 4 cm; height: 3 mm) by cold anesthesia. The chaining index, which is the percentage of observed time during which at least three flies engaged in courtship, was used to measure the courtship behavior in groups of 13 males. For the two-choice courtship assay, a standard courtship assay was used to test male preference (i.e., female attractiveness) between fru knockdown (oeno > fruIR) and the control (oeno-Gal4/+) females. Assays were performed under both normal and dark conditions. For each measurement, two subject females for comparison were decapitated and placed on the opposite sides of a single well in a standard 12-well cell culture plate containing standard fly medium, and a 5- to 7-day-old w1118 virgin male was subsequently aspirated into the cell. The video recording lasted for 1 hour to record the courtship behaviors (including orientation, wing vibration, and attempted copulation) of the male fly directed toward each female. The assays were conducted at 25°C at night. To control for individual variability, male preference was shown as the percentage of time the w1118 male was courting the fru knockdown female divided by the total courtship time. For the social space assay, the tester males were loaded into large round chambers (diameter: 4 cm; height: 3 mm) by cold anesthesia. Flies were allowed to acclimate for 10 min, and then, digital videos were collected after the flies reached a stable position (up to 20 min). Digital images were imported in YOLOv5 and an automated measure of the nearest neighbor to each fly was determined using our own MAFDA system. For the foraging assay, the tester males were analyzed using horizontal circular chambers: for group-housing testing (diameter: 4 cm; height: 3 mm); for single-housing testing (diameter: 1 cm; height 3 mm). Flies were allowed to acclimate for 1 hour; digital video images were then collected after the flies reached a stable position (up to 20 min). Digital images were imported in YOLOv5, and the location of food was given manually, using our own MAFDA system to determine the number of foraging for each fly through its distribution and dwell time. Development of MAFDA system The present study used YOLOv5 (https://ultralytics.com/yolov5), a state-of-the-art object detection algorithm, as the platform for training a dataset consisting of 800 well-annotated pictures. The dataset was subjected to augmentation techniques, including flipping, merging, rotating, brightening, and random-salt masking, which resulted in the generation of approximately 140,000 labeled flies, 130,000 labeled heads, and the collection of around 40,000 chasing events, 8700 wing-expansion events, and 1600 mountings. The training process was conducted on the LONI server using the default hyperparameters and the YOLOv5x.pt. file as the initial weight. The model was trained with a batch size of 80, using 500 epochs, and an image size of 640 × 640 pixels, running on Tesla V100 hardware for over a day. The trained model achieved exceptional accuracy in detecting and categorizing the various events of interest, as evidenced by the results obtained in this study. To identify chaining events, we used a criterion based on two or more independent chase events targeting the same object. A tracking algorithm was developed for monitoring the movement of flies between adjacent frames, which is based on “distance-sort.” Each fly is identified and assigned a specific ID by the system in the first frame. In subsequent frames, the position of each fly is paired with its nearest neighbor in the previous frame, and the fly inherits its ID. If a target fly becomes lost, its ID remains associated with the position of the previous frame until the target reappears. In cases where an ID switch occurs, the switch is identified and corrected manually. To facilitate the correction of ID switches, we developed a graphical user interface (GUI) software based on Python 3.8 and Kivy 2.00. The software allows users to easily and accurately correct ID-switch errors, ensuring that the tracking algorithm remains robust and reliable. We compared the tracking performance of the MAFDA platform with idtracker.ai (45). The installation of idtracker.ai was carried out in accordance with the instructions provided on the GitHub platform. The GUI was used to initiate tracking on four separate videos, each containing 13 flies, while the same four videos were also tracked using the MAFDA platform. Both idtracker and MAFDA platforms were run on the same computer equipped with a single NVIDIA GeForce RTX 2080 GPU. idtracker.ai required approximately 6 hours per video to complete tracking, in contrast to the MAFDA platform, which required only 20 min per video. Furthermore, idtracker.ai was observed to have more frequent ID switching during the tracking of fast-moving and overlapping objects. To generate a real-time event map of fly behaviors in real-time using the MAFDA system, each fly in each frame of the video (captured at a rate of 30 frames per second) is marked as a dot, and the frames are subsequently overlaid. To distinguish between different behavioral events, we use a color-coding scheme where each event is represented by a unique colored dot. To avoid over-representation, we generated event maps using 1.5-min video segments, which effectively exhibit the trajectories and behavioral classifications of flies in a given group. The behavior indexes (including the chasing index, singing index, and chaining index) were calculated with the detected behavior events divided by the maximum possible value for that particular event to occur. The formula for calculating the behavior index is as follows: Index = B(d)/B(max) × 100%, where B(d) is the number of detected behavior events and B(max) is the maximum possible value for that event to occur. Chasing and singing B(max) equate to the total number of fly number (N) in the group, and chaining B(max) equates to N−1. For example, 10 flies in a group could have max chasing events of 10 when they form a ring and the index is 100%. If only five chasing pairs are detected in a 10-fly group, the index is 50%. All the pipeline codes and relevant algorithms for building the MAFDA platform were uploaded to the Zenodo platform at https://zenodo.org/record/7752914#.ZBkxBuzMLdo. Raw experiment data were uploaded to https://zenodo.org/record/7752914#.ZBkxBuzMLdo. Cuticular hydrocarbon analysis Virgin male and female flies were collected at emergence and cultured at 29°C for 7 days. Each sample (including 10 flies) was frozen at −20°C for 15 min, and then introduced to a 2-ml vial containing 100 μl of hexane (Thermo Fisher Scientific, H303) with n-C19 alkanes (10 ng/μl; MilliporeSigma, N28906) as an internal standard. After extraction for 5 min, a 1-μl solution was injected into a GC (Trace 1310, Thermo Fisher Scientific) in splitless mode equipped with a TG-5MS capillary column (30 m by 0.25 mm by 0.25 μm; Thermo Fisher Scientific), using helium as carrier gas (1.0 ml/min). The column temperature was programmed to increase from 90° to 150°C at 20°C/min and then to 300°C at 3°C/min. The GC was coupled with a MS (ISQ 7000, Thermo Fisher Scientific). The injection temperature was 280°C, the MS source temperature was 310°C, and the transfer line was 300°C. The MS was set to scan a mass range from 40 to 550. A standard mixture of n-alkanes (C7 to C40, MilliporeSigma) was injected following the same temperature program. The identity of 7(Z)-tricosene, 11-cis vaccenyl acetate, and 7(Z),11(Z)-heptacosadiene was confirmed by comparison of retention times and mass spectra with synthetic standards (Cayman Chemical, catalog nos. 9000313, 10010101, and 10012567, respectively). Other compounds were tentatively identified on the basis of electron ionization mass spectra and Kovats indices, as well as previously published data in Drosophila (103, 104). The quantities of CHCs were calculated on the basis of peak areas in comparison with the internal standard. For each analysis, five biological replicates and two technical replicates were conducted. RNA-seq and data analysis Adult oenocytes were carefully dissected in 1× phosphate-buffered saline (PBS) before RNA extraction. Total RNAs were extracted from 7-day-old adult oenocytes using the Zymo RNA preparation kit. Two replicates were collected for each genotype. NEBNext Poly(A) mRNA Magnetic Isolation Module and NEBNext Ultra II RNA Library Prep Kit for Illumina were used for library preparation. The libraries were sequenced using an Illumina HiSeq 2500 system, obtaining 40 million reads for each sample. Following the sequencing of samples, we used the fastp 0.22.0 tool with its default parameters to automatically trim the reads (105). This resulted in the retention of a vast majority of the bases and reads, with minimal differences among all libraries. Subsequently, we used bowtie2—an intron-aware short-read aligner—to map all reads to the dme6 reference genome (106). To quantify gene expression levels, we used RNA-Seq by Expectation-Maximization (RSEM) 1.2.31 and performed pairwise group comparisons using edger 3.36.0 on the output generated by RSEM (107). Significantly differentially expressed genes (DEGs) were selected on the basis of the threshold of P ≤ 0.001 and ≥4-fold change. The alignment of reads and the generation of the DEG matrix were carried out using the scripts provided by trinityrnaseq (108). After generating the expression matrix, we performed sample clustering using PCA from the R package (109) and used the “pheatmap” function to generate heatmaps. We then used further downstream analyses, such as KEGG and GSEA (63), using clusterProfiler 4.2 (110). The KEGG pathway maps were visualized using pathview (111). The RNA-seq data reported here have been deposited in National Center for Biotechnology Information’s Gene Expression Omnibus (GEO) and are accessible through GEO series accession number GSE227895. cDNA synthesis and RT-qPCR Adult oenocytes were dissected in 1× PBS and stored at −80°C until all time points were collected. The tissue was homogenized with TRIzol (Thermo Fisher Scientific) using standard protocols on ice. Following phase separation, the aqueous phase was transferred into a new tube, mixed with an equal volume of 70% ethanol, and loaded directly onto the mini kit columns (Zymo RNA preparation kit). The remaining steps of the RNA isolation were performed in accordance with the manufacturer’s protocol, including on-column deoxyribonuclease digestion (Qiagen) for 15 min at room temperature. Reverse transcription was performed on 0.25 to 1 μg of total RNA using the SuperScript Reverse Transcriptase II from Thermo Fisher Scientific (catalog no. 18064022) and oligo(dT) primers. cDNA was used as a template for qPCR. RT-qPCR was performed with a QuantStudio 3 Real-Time PCR System and PowerUp SYBR Green Master Mix (Thermo Fisher Scientific). Three independent biological replicates were performed with three technical replicates each. The mRNA abundance of each candidate gene was normalized to the expression of Rp49 by the comparative cycle threshold methods. Primer sequences are listed in table S5. Generation of anti-FruCOM antibody (anti-FruALL) The rabbit polyclonal antibody against FruCOM was generated by ABclonal (Wuhan, China). Briefly, the fragment of the fru gene encoding 89 amino acids from the common part of the polypeptide, RERERERERERDRDRELSTTPVEQLSSSKRRRKNSSSNCDNSLSSSHQDR HYPQDSQANFKSSPVPKTGGSTSESEDAGGRHDSPLSMT, was cloned into the expression vector pET-28a (Sigma-Aldrich, #69864). A small ubiquitin-like modifier (SUMO) tagged FruCOM fusion antigen was synthesized from bacteria, purified, and used to immunize the rabbit. The anti-FruCOM antibody was affinity-purified. This polyclonal antibody recognizes an epitope in exon C3 of fru, which is present in both FruCOM and FruM isoforms. Immunostaining and confocal imaging Tissue samples were dissected in PBS, and then fixed in 4% formaldehyde in PBS for 20 min. After washing with PBS with 0.2% Triton X-100 (PBST), the samples were incubated in PBT with primary antibodies at 4°C overnight with shaking, and then washed in PBT three times for 15 min each. The following antibodies were used in immunostaining: anti-GFP (1:200; Cell Signaling Technology, #2956S), anti-hemagglutinin (HA) (1:500; Cell Signaling Technology, #3724S), anti-HNF4 guinea pig polyclonal antibody (1:100; a gift from G. Storelli) (65), anti-FruCOM rabbit polyclonal antibody (1:500), and rabbit anti-FruM polyclonal antibody (1:250) (59). The secondary antibodies conjugated with Alexa Fluor 546 or 633 (Invitrogen) were diluted 1:200 and incubated at room temperature for 2 hours. Nuclei were labeled with 4′,6-diamidino-2-phenylindole (DAPI) (1:1000; Invitrogen, #D1306). After washing, samples were mounted and imaged with Zeiss LSM 800 or Zeiss LSM 980 Confocal Microscopes. Image analysis was performed in ImageJ. TAG assays For TAG assays, 8 whole adult or 20 adipose tissues were homogenized in 100 μl of PBS, 0.5% Tween 20, and immediately incubated at 70°C for 5 min. Heat-treated homogenate (20 μl) was incubated with either 20 μl of PBS or Triglyceride Reagent (Sigma-Aldrich, T2449-10ML) for 30 min at 37°C, after which the samples were centrifuged at maximum speed for 3 min. Then, 30 μl was transferred to a 96-well plate and incubated with 100 μl of Free Glycerol Reagent (Sigma-Aldrich, F6428-40ML) for 5 min at 37°C. Samples were assayed using a BioTek Synergy HT microplate spectrophotometer at 540 nm. TAG amounts were determined by subtracting the amount of free glycerol in the PBS-treated sample from the total glycerol present in the sample treated with Triglyceride Reagent. TAG levels were normalized to protein amounts in each homogenate using a Bradford assay (Bio-Rad), and data were analyzed using a Student’s t test. Independent experiments were performed two to three times. Thin layer chromatography The adipose tissue of 20 adult flies was homogenized in a 2:1:0.8 ratio of methanol:chloroform:water using 1.4-mm ceramic beads by vigorous vortexing for 10 min at 4°C. The samples were incubated in a water bath at 37°C for 1 hour. Next, chloroform and 1 M KCl were added to the sample in a 1:1 ratio, centrifuged at 3000 rpm for 2 min, and the bottom layer containing lipids was aspirated using a syringe. Lipids were dried using argon gas and resuspended in chloroform (100 μl of chloroform/7 mg of fly weight). Extracted lipids alongside serially diluted standard neutral lipids of known concentrations were separated on TLC plates using hexane:diethyl ether:acetic acid solvent (80:20:1). TLC plate was air-dried for 10 min, spray-stained with 3% copper(II) acetate in 8% phosphoric acid, and incubated at 180°C in the oven for 10 min to allow bands to develop for scanning and imaging. Starvation Water was added to polystyrene vials (Genesee Scientific, catalog no. 32-110) until they were half full. A dense weave cellulose acetate stopper (Genesee Scientific, catalog no. 49-101) was then inserted into the bottom of the vial, allowing the artificial substrate to become saturated with water. Any excess water was discarded and newly emerged flies were transferred to these vials at a density of 5 to 10 males per vial. To reduce water evaporation, a second dense weave cellulose acetate stopper was used to seal the vials. Starvation experiments were conducted at 29°C. In this case, animals were transferred daily to fresh starvation vials and collected at 6 to 7 days after emergence for lipid stains. Lipid stains Oenocytes dissected from adult flies were fixed in 4% paraformaldehyde for 30 min at room temperature, rinsed in PBS, and incubated in Bodipy 493/503 (1:1000; Thermo Fisher Scientific, catalog no. D3922) or Nile red (1:2000; TCI America, 7385-67-3) for 1 hour at room temperature, in the dark, to stain the neutral LDs. Next, the oenocytes tissues were rinsed in PBS and mounted in antifade reagent with DAPI (1:1000; Invitrogen, #D1306). Quantification and statistical analysis Data analyses were conducted in GraphPad Prism and the R package. Unpaired t test was used for two-sample comparisons; one-way analysis of variance (ANOVA) followed by Dunnett's multiple comparison test and one-way ANOVA with Tukey’s multiple comparison test were used for multiple-sample comparisons. Specific statistical approaches for each figure are indicated in the figure legend. Nonnormally distributed data, the foraging index, for instance, were analyzed using the Wilcoxon rank sum test to determine the significant difference between groups. The statistical test used for each figure is clarified in the figure legend. The raw mean, SEM, and P value are presented in supplementary tables. Acknowledgments We thank M. Arbeitman, H. Bai, C.-Y. Lee, C. Han, Bloomington Drosophila Stock Center (BDSC, USA), and the Vienna Drosophila RNAi Center (VDRC, Austria) for providing fly stocks; G. Storelli and the Developmental Studies Hybridoma Bank (DSHB, USA) for providing antibodies. We also thank X.-M. Yu and S. Lenhert for critical reading and helpful comments on the manuscript and members of the Deng laboratory for feedback and suggestions. Special thanks to A. Brown from the FSU Department of Biological Science for help with bulk RNA-seq library preparation. Funding: W.-M.D. received funding (CA224381, and CA227789) for this work from the NIH (www.nih.gov/) and the start-up fund from Tulane University. The funders had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript. Author contributions: Conception and design: J.S. and W.-M.D. Development of methodology: J.S. and W.-M.D. Acquisition of data: J.S., C.E., Q.S., and Y.-C.H. Analysis and interpretation of data: J.S. and W.K.L. Study supervision: J.S. and W.-M.D. Writing—original draft: J.S. and W.-M.D. Writing—review and editing: J.S., W.-M.D., Q.S., Y.P., W.K.L. Acquisition of funding: W.-M.D. All authors read and approved the final manuscript. Competing interests: The authors declare that they have no competing interests. Data and materials availability: All data needed to evaluate the conclusions in the paper are present in the paper and/or the Supplementary Materials. The Gene Expression Omnibus accession number for all bulk RNA-seq data is www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc=GSE227895. All the pipeline codes and relevant algorithms used for building the MAFDA platform presented can be found at https://zenodo.org/record/7752914#.ZBkxBuzMLdo. Raw behavior data were uploaded to https://zenodo.org/record/7752914#.ZBkxBuzMLdo. Supplementary Materials This PDF file includes: Figs. S1 to S9 Legends for tables S1 to S7 Legends for movies S1 to S5 Click here for additional data file. Other Supplementary Material for this manuscript includes the following: Tables S1 to S7 Click here for additional data file. Movies S1 to S5 Click here for additional data file. View/request a protocol for this paper from Bio-protocol. ==== Refs REFERENCES AND NOTES 1 M. A. Khallaf, R. Cui, J. Weißflog, M. Erdogmus, A. Svatoš, H. K. M. Dweck, D. R. Valenzano, B. S. Hansson, M. Knaden, Large-scale characterization of sex pheromone communication systems in Drosophila. Nat. Commun. 12 , 4165 (2021).34230464 2 T. D. Wyatt, Pheromones and signature mixtures: Defining species-wide signals and variable cues for identity in both invertebrates and vertebrates. J. Comp. Physiol. A 196 , 685–700 (2010). 3 E. C. Toolson, Effects of rearing temperature on cuticle permeability and epicuticular lipid composition in Drosophila pseudoobscura. J. Exp. Zool. 222 , 249–253 (1982). 4 K. H. Lockey, Lipids of the insect cuticle: Origin, composition and function. Comp. Biochem. Physiol. Part B Comp. Biochem. 89 , 595–645 (1988). 5 J.-D. Rouault, C. Marican, C. Wicker-Thomas, J.-M. Jallon, in Drosophila Melanogaster, Drosophila Simulans: So Similar, So Different (Springer, 2004), pp. 195–212. 6 A. A. Hoffmann, R. Hallas, C. Sinclair, P. Mitrovski, Levels of variation in stress resistance in Drosophila among strains, local populations, and geographic regions: Patterns for desiccation, starvation, cold resistance, and associated traits. Evolution 55 , 1621–1630 (2001).11580021 7 M. Cobb, J.-M. Jallon, Pheromones, mate recognition and courtship stimulation in the Drosophila melanogaster species sub-group. Anim. Behav. 39 , 1058–1067 (1990). 8 J. A. Coyne, A. P. Crittenden, K. Mah, Genetics of a pheromonal difference contributing to reproductive isolation in Drosophila. Science 265 , 1461–1464 (1994).8073292 9 W. J. Etges, M. A. Ahrens, Premating isolation is determined by larval-rearing substrates in cactophilic Drosophila mojavensis. V. Deep geographic variation in epicuticular hydrocarbons among isolated populations. Am. Nat. 158 , 585–598 (2001).18707353 10 J.-F. Ferveur, Cuticular hydrocarbons: Their evolution and roles in Drosophila pheromonal communication. Behav. Genet. 35 , 279–295 (2005).15864443 11 T. D. Wyatt, Pheromones and Animal Behaviour (Cambridge Univ. Press, 2009), vol. 626. 12 R. Makki, E. Cinnamon, A. P. Gould, The development and functions of oenocytes. Annu. Rev. Entomol. 59 , 405–425 (2014).24397521 13 C. Wicker-Thomas, D. Garrido, G. Bontonou, L. Napal, N. Mazuras, B. Denis, T. Rubin, J. P. Parvy, J. Montagne, Flexible origin of hydrocarbon/pheromone precursors in Drosophila melanogaster. J. Lipid Res. 56 , 2094–2101 (2015).26353752 14 Y. Fan, L. Zurek, M. J. Dykstra, C. Schal, Hydrocarbon synthesis by enzymatically dissociated oenocytes of the abdominal integument of the German Cockroach, Blattella germanica. Naturwissenschaften 90 , 121–126 (2003).12649753 15 H. Chung, T. Sztal, S. Pasricha, M. Sridhar, P. Batterham, P. J. Daborn, Characterization of Drosophila melanogaster cytochrome P450 genes. Proc. Natl. Acad. Sci. U.S.A. 106 , 5731–5736 (2009).19289821 16 E. Gutierrez, D. Wiggins, B. Fielding, A. P. Gould, Specialized hepatocyte-like cells regulate Drosophila lipid metabolism. Nature 445 , 275–280 (2007).17136098 17 A. S. Kunte, K. A. Matthews, R. B. Rawson, Fatty acid auxotrophy in Drosophila larvae lacking SREBP. Cell Metab. 3 , 439–448 (2006).16753579 18 G. J. Lycett, L. A. McLaughlin, H. Ranson, J. Hemingway, F. C. Kafatos, T. G. Loukeris, M. J. I. Paine, Anopheles gambiae P450 reductase is highly expressed in oenocytes and in vivo knockdown increases permethrin susceptibility. Insect Mol. Biol. 15 , 321–327 (2006).16756551 19 G. F. Martins, J. M. Ramalho-Ortigão, N. F. Lobo, D. W. Severson, M. A. McDowell, P. F. P. Pimenta, Insights into the transcriptome of oenocytes from Aedes aegypti pupae. Mem. Inst. Oswaldo Cruz 106 , 308–315 (2011).21655818 20 J.-P. Parvy, L. Napal, T. Rubin, M. Poidevin, L. Perrin, C. Wicker-Thomas, J. Montagne, Drosophila melanogaster acetyl-CoA-carboxylase sustains a fatty acid—Dependent remote signal to waterproof the respiratory system. PLOS Genet. 8 , e1002925 (2012).22956916 21 K. Huang, W. Chen, F. Zhu, P. W. L. Li, P. Kapahi, H. Bai, RiboTag translatomic profiling of Drosophila oenocytes under aging and induced oxidative stress. BMC Genomics 20 , 50 (2019).30651069 22 R. W. Howard, G. J. Blomquist, Ecological, behavioral, and biochemical aspects of insect hydrocarbons. Annual Rev. Entomology 50 , 371–393 (2005). 23 T. R. Shirangi, H. D. Dufour, T. M. Williams, S. B. Carroll, Rapid evolution of sex pheromone-producing enzyme expression in Drosophila. PLOS Biol. 7 , e1000168 (2009).19652700 24 T. Chertemps, L. Duportets, C. Labeur, R. Ueda, K. Takahashi, K. Saigo, C. Wicker-Thomas, A female-biased expressed elongase involved in long-chain hydrocarbon biosynthesis and courtship behavior in Drosophila melanogaster. Proc. Natl. Acad. Sci. U.S.A. 104 , 4273–4278 (2007).17360514 25 T. Chertemps, L. Duportets, C. Labeur, M. Ueyama, C. Wicker-Thomas, A female-specific desaturase gene responsible for diene hydrocarbon biosynthesis and courtship behaviour in Drosophila melanogaster. Insect Mol. Biol. 15 , 465–473 (2006).16907833 26 K.-I. Kimura, T. Hachiya, M. Koganezawa, T. Tazawa, D. Yamamoto, Fruitless and doublesex coordinate to generate male-specific neurons that can initiate courtship. Neuron 59 , 759–769 (2008).18786359 27 S. Kohatsu, M. Koganezawa, D. Yamamoto, Female contact activates male-specific interneurons that trigger stereotypic courtship behavior in Drosophila. Neuron 69 , 498–508 (2011).21315260 28 E. J. Rideout, J.-C. Billeter, S. F. Goodwin, The sex-determination genes fruitless and doublesex specify a neural substrate required for courtship song. Curr. Biol. 17 , 1473–1478 (2007).17716899 29 A. C. Von Philipsborn, T. Liu, J. Y. Yu, C. Masser, S. S. Bidaye, B. J. Dickson, Neuronal control of Drosophila courtship song. Neuron 69 , 509–522 (2011).21315261 30 K. Asahina, K. Watanabe, B. J. Duistermars, E. Hoopfer, C. R. González, E. A. Eyjólfsdóttir, P. Perona, D. J. Anderson, Tachykinin-expressing neurons control male-specific aggressive arousal in Drosophila. Cell 156 , 221–235 (2014).24439378 31 K. Ishii, M. Wohl, A. DeSouza, K. Asahina, Sex-determining genes distinctly regulate courtship capability and target preference via sexually dimorphic neurons. eLife 9 , e52701 (2020).32314964 32 M. Koganezawa, K.-I. Kimura, D. Yamamoto, The neural circuitry that functions as a switch for courtship versus aggression in Drosophila males. Curr. Biol. 26 , 1395–1403 (2016).27185554 33 D. Chen, D. Sitaraman, N. Chen, X. Jin, C. Han, J. Chen, M. Sun, B. S. Baker, M. N. Nitabach, Y. Pan, Genetic and neuronal mechanisms governing the sex-specific interaction between sleep and sexual behaviors in Drosophila. Nat. Commun. 8 , 1–14 (2017).28232747 34 K. Usui-Aoki, H. Ito, K. Ui-Tei, K. Takahashi, T. Lukacsovich, W. Awano, H. Nakata, Z. F. Piao, E. E. Nilsson, J. Y. Tomida, D. Yamamoto, Formation of the male-specific muscle in female Drosophila by ectopic fruitless expression. Nat. Cell Biol. 2 , 500–506 (2000).10934470 35 L. C. Ryner, S. F. Goodwin, D. H. Castrillon, A. Anand, A. Villella, B. S. Baker, J. C. Hall, B. J. Taylor, S. A. Wasserman, Control of male sexual behavior and sexual orientation in Drosophila by the fruitless gene. Cell 87 , 1079–1089 (1996).8978612 36 A. Anand, A. Villella, L. C. Ryner, T. Carlo, S. F. Goodwin, H. J. Song, D. A. Gailey, A. Morales, J. C. Hall, B. S. Baker, B. J. Taylor, Molecular genetic dissection of the sex-specific and vital functions of the Drosophila melanogaster sex determination gene fruitless. Genetics 158 , 1569–1595 (2001).11514448 37 H.-J. Song, J. C. Billeter, E. Reynaud, T. Carlo, E. P. Spana, N. Perrimon, S. F. Goodwin, B. S. Baker, B. J. Taylor, The fruitless gene is required for the proper formation of axonal tracts in the embryonic central nervous system of Drosophila. Genetics 162 , 1703–1724 (2002).12524343 38 H. Zhou, C. Whitworth, C. Pozmanter, M. C. Neville, M. Van Doren, Doublesex regulates fruitless expression to promote sexual dimorphism of the gonad stem cell niche. PLOS Genet. 17 , e1009468 (2021).33788836 39 K. Sato, D. Yamamoto, Mutually exclusive expression of sex-specific and non-sex-specific fruitless gene products in the Drosophila central nervous system. Gene Expr. Patterns 43 , 119232 (2022).35124238 40 S. E. Allen, G. T. Koreman, A. Sarkar, B. Wang, M. F. Wolfner, C. Han, Versatile CRISPR/Cas9-mediated mosaic analysis by gRNA-induced crossing-over for unmodified genomes. PLOS Biol. 19 , e3001061 (2021).33444322 41 K. S. Gill, A mutation causing abnormal courtship and mating behavior in males of Drosophila melanogaster. Am. Zool. 3 , 507 (1963). 42 A. Villella, D. A. Gailey, B. Berwald, S. Ohshima, P. T. Barnes, J. C. Hall, Extended reproductive roles of the fruitless gene in Drosophila melanogaster revealed by behavioral analysis of new fru mutants. Genetics 147 , 1107–1130 (1997).9383056 43 A. H. Brand, N. Perrimon, Targeted gene expression as a means of altering cell fates and generating dominant phenotypes. Development 118 , 401–415 (1993).8223268 44 A. Pérez-Escudero, J. Vicente-Page, R. C. Hinz, S. Arganda, G. G. de Polavieja, idTracker: Tracking individuals in a group by automatic identification of unmarked animals. Nat. Methods 11 , 743–748 (2014).24880877 45 F. Romero-Ferrero, M. G. Bergomi, R. C. Hinz, F. J. H. Heras, G. G. de Polavieja, idtracker.ai: Tracking all individuals in small or large collectives of unmarked animals. Nat. Methods 16 , 179–182 (2019).30643215 46 J.-C. Billeter, J. Atallah, J. J. Krupp, J. G. Millar, J. D. Levine, Specialized cells tag sexual and species identity in Drosophila melanogaster. Nature 461 , 987–991 (2009).19829381 47 J. F. Ferveur, F. Savarit, C. J. O’Kane, G. Sureau, R. J. Greenspan, J. M. Jallon, Genetic feminization of pheromones and its behavioral consequences in Drosophila males. Science 276 , 1555–1558 (1997).9171057 48 T. Osterwalder, K. S. Yoon, B. H. White, H. Keshishian, A conditional tissue-specific transgene expression system using inducible GAL4. Proc. Natl. Acad. Sci. U.S.A. 98 , 12596–12601 (2001).11675495 49 G. Roman, K. Endo, L. Zong, R. L. Davis, P[Switch], a system for spatial and temporal control of gene expression in Drosophila melanogaster. Proc. Natl. Acad. Sci. U.S.A. 98 , 12602–12607 (2001).11675496 50 H. Amrein, Pheromone perception and behavior in Drosophila. Curr. Opin. Neurobiol. 14 , 435–442 (2004).15321064 51 A. Mogilner, L. Edelstein-Keshet, L. Bent, A. Spiros, Mutual interactions, potentials, and individual distance in a social aggregation. J. Math. Biol. 47 , 353–389 (2003).14523578 52 R. J. Greenspan, J.-F. Ferveur, Courtship in Drosophila. Annu. Rev. Genet. 34 , 205–232 (2000).11092827 53 F. Lacaille, M. Hiroi, R. Twele, T. Inoshita, D. Umemoto, G. Manière, F. Marion-Poll, M. Ozaki, W. Francke, M. Cobb, C. Everaerts, T. Tanimura, J. F. Ferveur, An inhibitory sex pheromone tastes bitter for Drosophila males. PLOS ONE 2 , e661 (2007).17710124 54 Y. Snellings, B. Herrera, B. Wildemann, M. Beelen, L. Zwarts, T. Wenseleers, P. Callaerts, The role of cuticular hydrocarbons in mate recognition in Drosophila suzukii. Sci. Rep. 8 , 4996 (2018).29567945 55 J. M. Jallon, J. R. David, Variations in cuticular hydrocarbons among the eight species of the Drosophila melanogaster subgroup. Evolution 41 , 294–302 (1987).28568760 56 Y. Qiu, C. Tittiger, C. Wicker-Thomas, G. le Goff, S. Young, E. Wajnberg, T. Fricaux, N. Taquet, G. J. Blomquist, R. Feyereisen, An insect-specific P450 oxidative decarbonylase for cuticular hydrocarbon biosynthesis. Proc. Natl. Acad. Sci. U.S.A. 109 , 14858–14863 (2012).22927409 57 J.-C. Billeter, A. Villella, J. B. Allendorfer, A. J. Dornan, M. Richardson, D. A. Gailey, S. F. Goodwin, Isoform-specific control of male neuronal differentiation and behavior in Drosophila by the fruitless gene. Curr. Biol. 16 , 1063–1076 (2006).16753560 58 G. Lee, M. Foss, S. F. Goodwin, T. Carlo, B. J. Taylor, J. C. Hall, Spatial, temporal, and sexually dimorphic expression patterns of the fruitless gene in the Drosophila central nervous system. J. Neurobiol. 43 , 404–426 (2000).10861565 59 J. Chen, S. Jin, D. Chen, J. Cao, X. Ji, Q. Peng, Y. Pan, fruitless tunes functional flexibility of courtship circuitry during development. eLife 10 , e59224 (2021).33463521 60 G. J. Blomquist, A.-G. Bagnères, Insect Hydrocarbons: Biology, Biochemistry, and Chemical Ecology (Cambridge Univ. Press, 2010). 61 E. Cinnamon, R. Makki, A. Sawala, L. P. Wickenberg, G. J. Blomquist, C. Tittiger, Z. Paroush, A. P. Gould, Drosophila Spidey/Kar regulates oenocyte growth via PI3-kinase signaling. PLOS Genet. 12 , e1006154 (2016).27500738 62 K. Huang, Y. Liu, N. Perrimon, Roles of insect oenocytes in physiology and their relevance to human metabolic diseases. Front. Insect Sci. 2 , 7 (2022). 63 A. Subramanian, P. Tamayo, V. K. Mootha, S. Mukherjee, B. L. Ebert, M. A. Gillette, A. Paulovich, S. L. Pomeroy, T. R. Golub, E. S. Lander, J. P. Mesirov, Gene set enrichment analysis: A knowledge-based approach for interpreting genome-wide expression profiles. Proc. Natl. Acad. Sci. U.S.A. 102 , 15545–15550 (2005).16199517 64 G. Storelli, H.-J. Nam, J. Simcox, C. J. Villanueva, C. S. Thummel, Drosophila HNF4 directs a switch in lipid metabolism that supports the transition to adulthood. Dev. Cell 48 , 200–214.e6 (2019).30554999 65 L. Palanker, J. M. Tennessen, G. Lam, C. S. Thummel, Drosophila HNF4 regulates lipid mobilization and β-oxidation. Cell Metab. 9 , 228–239 (2009).19254568 66 R. A. Palu, C. S. Thummel, Sir2 Acts through hepatocyte nuclear factor 4 to maintain insulin signaling and metabolic homeostasis in Drosophila. PLOS Genet. 12 , e1005978 (2016).27058248 67 X.-J. Pei, Y. L. Fan, Y. Bai, T. T. Bai, C. Schal, Z. F. Zhang, N. Chen, S. Li, T. X. Liu, Modulation of fatty acid elongation in cockroaches sustains sexually dimorphic hydrocarbons and female attractiveness. PLoS Biol. 19 , e3001330 (2021).34314414 68 N. Chen, Y. J. Liu, Y. L. Fan, X. J. Pei, Y. Yang, M. T. Liao, J. Zhong, N. Li, T. X. Liu, G. Wang, Y. Pan, C. Schal, S. Li, A single gene integrates sex and hormone regulators into sexual attractiveness. Nat. Ecol. Evol. 6 , 1180–1190 (2022).35788705 69 M. de la Paz Fernández, Y.-B. Chan, J. Y. Yew, J.-C. Billeter, K. Dreisewerd, J. D. Levine, E. A. Kravitz, Pheromonal and behavioral cues trigger male-to-female aggression in Drosophila. PLOS Biol. 8 , e1000541 (2010).21124886 70 D. J. Parker, A. Gardiner, M. C. Neville, M. G. Ritchie, S. F. Goodwin, The evolution of novelty in conserved genes; evidence of positive selection in the Drosophila fruitless gene is localised to alternatively spliced exons. Heredity 112 , 300–306 (2014).24149653 71 F. Bousquet, T. Nojima, B. Houot, I. Chauvel, S. Chaudy, S. Dupas, D. Yamamoto, J. F. Ferveur, Expression of a desaturase gene, desat1, in neural and nonneural tissues separately affects perception and emission of sex pheromones in Drosophila. Proc. Natl. Acad. Sci. U.S.A. 109 , 249–254 (2012).22114190 72 C. L. Vernier, N. Leitner, K. M. Zelle, M. Foltz, S. Dutton, X. Liang, S. Halloran, J. G. Millar, Y. Ben-Shahar, A pleiotropic chemoreceptor facilitates the production and perception of mating pheromones. iScience 26 , 105882 (2023).36691619 73 A. J. Dornan, D. A. Gailey, S. F. Goodwin, GAL4 enhancer trap targeting of the Drosophila sex determination gene fruitless. Genesis 42 , 236–246 (2005).16028231 74 T. Chowdhury, R. M. Calhoun, K. Bruch, A. J. Moehring, The fruitless gene affects female receptivity and species isolation. Proc. R. Soc. B 287 , 20192765 (2020). 75 S. H. Ng, S. Shankar, Y. Shikichi, K. Akasaka, K. Mori, J. Y. Yew, Pheromone evolution and sexual behavior in Drosophila are shaped by male sensory exploitation of other males. Proc. Natl. Acad. Sci. U.S.A. 111 , 3056–3061 (2014).24516141 76 T. Dekker, S. Revadi, S. Mansourian, S. Ramasamy, S. Lebreton, P. G. Becher, S. Angeli, O. Rota-Stabelli, G. Anfora, Loss of Drosophila pheromone reverses its role in sexual communication in Drosophila suzukii. Proc. R. Soc. B Biol. Sci. 282 , 20143018 (2015). 77 R. M. Joseph, J. R. Carlson, Drosophila chemoreceptors: A molecular interface between the chemical world and the brain. Trends Genet. 31 , 683–695 (2015).26477743 78 D. S. Manoli, M. Foss, A. Villella, B. J. Taylor, J. C. Hall, B. S. Baker, Male-specific fruitless specifies the neural substrates of Drosophila courtship behaviour. Nature 436 , 395–400 (2005).15959468 79 V. Rodrigues, T. Hummel, Development of the Drosophila olfactory system. Adv. Exp. Med. Biol. 628 , 82–101 (2008).18683640 80 S. Sethi, H. H. Lin, A. K. Shepherd, P. C. Volkan, C. Y. Su, J. W. Wang, Social context enhances hormonal modulation of pheromone detection in Drosophila. Curr. Biol. 29 , 3887–3898.e4 (2019).31679932 81 Y. Zhang, R. Ng, M. C. Neville, S. F. Goodwin, C.-Y. Su, Distinct roles and synergistic function of frum isoforms in Drosophila olfactory receptor neurons. Cell Rep. 33 , 108516 (2020).33326795 82 J. Wang, H. Cheng, X. Li, W. Lu, K. Wang, T. Wen, Regulation of neural stem cell differentiation by transcription factors HNF4-1 and MAZ-1. Mol. Neurobiol. 47 , 228–240 (2013).22944911 83 A. Laranjeira, J. Schulz, C. G. Dotti, Genes related to fatty acid β-oxidation play a role in the functional decline of the Drosophila brain with age. PLOS ONE 11 , e0161143 (2016).27518101 84 D. Lessing, N. M. Bonini, Maintaining the brain: Insight into human neurodegeneration from Drosophila melanogaster mutants. Nat. Rev. Genet. 10 , 359–370 (2009).19434080 85 J.-M. Jallon, G. Lauge, L. Orssaud, C. Antony, Female pheromones in Drosophila melanogaster are controlled by the doublesex locus. Genet. Res. 51 , 17–22 (1988). 86 L. Tompkins, S. P. McRobert, Behavioral and pheromonal phenotypes associated with expression of loss-of-function mutations in the sex-lethal gene of Drosophila melanogaster. J. Neurogenet. 9 , 219–226 (1995).7760212 87 L. Tompkins, S. McRobert, Regulation of behavioral and pheromonal aspects of sex determination in Drosophila melanogaster by the Sex-lethal gene. Genetics 123 , 535–541 (1989).2513254 88 J. A. Waterbury, L. L. Jackson, P. Schedl, Analysis of the doublesex female protein in Drosophila melanogaster: Role in sexual differentiation and behavior and dependence on intersex. Genetics 152 , 1653–1667 (1999).10430590 89 K. C. Burtis, The regulation of sex determination and sexually dimorphic differentiation in Drosophila. Curr. Opin. Cell Biol. 5 , 1006–1014 (1993).8129938 90 T. W. Cline, B. J. Meyer, Vive la différence: Males vs females in flies vs worms. Annu. Rev. Genet. 30 , 637–702 (1996).8982468 91 J. E. Dalton, J. M. Fear, S. Knott, B. S. Baker, L. M. McIntyre, M. N. Arbeitman, Male-specific Fruitless isoforms have different regulatory roles conferred by distinct zinc finger DNA binding domains. BMC Genomics 14 , 659 (2013).24074028 92 E. Clough, E. Jimenez, Y. A. Kim, C. Whitworth, M. C. Neville, L. U. Hempel, H. J. Pavlou, Z. X. Chen, D. Sturgill, R. K. Dale, H. E. Smith, T. M. Przytycka, S. F. Goodwin, M. van Doren, B. Oliver, Sex- and tissue-specific functions of Drosophila doublesex transcription factor target genes. Dev. Cell 31 , 761–773 (2014).25535918 93 R. W. Howard, L. L. Jackson, H. Banse, M. W. Blows, Cuticular hydrocarbons of Drosophila birchii and D. serrata: Identification and role in mate choice in D. serrata. J. Chem. Ecol. 29 , 961–976 (2003).12775155 94 E. C. Toolson, R. Kuper-Simbron, Laboratory evolution of epicuticular hydrocarbon composition and cuticular permeability in Drosophila pseudoobscura: Effects on sexual dimorphism and thermal-acclimation ability. Evolution 43 , 468–473 (1989).28568563 95 M. A. Noor, J. A. Coyne, Genetics of a difference in cuticular hydrocarbons between Drosophila pseudoobscura and D. persimilis. Genet. Res. 68 , 117–123 (1996).8940900 96 F. Mas, J.-M. Jallon, Sexual isolation and cuticular hydrocarbon differences between Drosophila santomea and Drosophila yakuba. J. Chem. Ecol. 31 , 2747–2752 (2005).16132336 97 J. A. Coyne, Genetics of differences in pheromonal hydrocarbons between Drosophila melanogaster and D. simulans. Genetics 143 , 353–364 (1996).8722787 98 J.-M. Jallon, A few chemical words exchanged by Drosophila during courtship and mating. Behav. Genet. 14 , 441–478 (1984).6441563 99 C. Wicker-Thomas, I. Guenachi, Y. F. Keita, Contribution of oenocytes and pheromones to courtship behaviour in Drosophila. BMC Biochem. 10 , 1–8 (2009).19121228 100 H. Chung, S. B. Carroll, Wax, sex and the origin of species: Dual roles of insect cuticular hydrocarbons in adaptation and mating. Bioessays 37 , 822–830 (2015).25988392 101 T. Davis, J. Kurihara, D. Yamamoto, Genomic organisation and characterisation of the neural sex-determination gene fruitless (fru) in the Hawaiian species Drosophila heteroneura. Gene 246 , 143–149 (2000).10767535 102 K. Huang, T. Miao, K. Chang, J. Kim, P. Kang, Q. Jiang, A. J. Simmonds, F. di Cara, H. Bai, Impaired peroxisomal import in Drosophila oenocytes causes cardiac dysfunction by inducing upd3 as a peroxikine. Nat. Commun. 11 , 2943 (2020).32523050 103 H. K. M. Dweck, S. A. M. Ebrahim, M. Thoma, A. A. M. Mohamed, I. W. Keesey, F. Trona, S. Lavista-Llanos, A. Svatoš, S. Sachse, M. Knaden, B. S. Hansson, Pheromones mediating copulation and attraction in Drosophila. Proc. Natl. Acad. Sci. U.S.A. 112 , E2829–E2835 (2015).25964351 104 C. Everaerts, J.-P. Farine, M. Cobb, J.-F. Ferveur, Drosophila cuticular hydrocarbons revisited: Mating status alters cuticular profiles. PLOS ONE 5 , e9607 (2010).20231905 105 S. Chen, Y. Zhou, Y. Chen, J. Gu, fastp: An ultra-fast all-in-one FASTQ preprocessor. Bioinformatics 34 , i884–i890 (2018).30423086 106 G. dos Santos, A. J. Schroeder, J. L. Goodman, V. B. Strelets, M. A. Crosby, J. Thurmond, D. B. Emmert, W. M. Gelbart; FlyBase Consortium, FlyBase: Introduction of the Drosophila melanogaster Release 6 reference genome assembly and large-scale migration of genome annotations. Nucleic Acids Res. 43 , D690–D697 (2015).25398896 107 B. Li, C. N. Dewey, RSEM: Accurate transcript quantification from RNA-Seq data with or without a reference genome. BMC Bioinform. 12 , 323 (2011). 108 B. J. Haas, A. Papanicolaou, M. Yassour, M. Grabherr, P. D. Blood, J. Bowden, M. B. Couger, D. Eccles, B. Li, M. Lieber, M. D. MacManes, M. Ott, J. Orvis, N. Pochet, F. Strozzi, N. Weeks, R. Westerman, T. William, C. N. Dewey, R. Henschel, R. D. LeDuc, N. Friedman, A. Regev, De novo transcript sequence reconstruction from RNA-seq using the Trinity platform for reference generation and analysis. Nat. Protoc. 8 , 1494–1512 (2013).23845962 109 M. D. Robinson, D. J. McCarthy, G. K. Smyth, edgeR: A bioconductor package for differential expression analysis of digital gene expression data. Bioinformatics 26 , 139–140 (2010).19910308 110 G. Yu, L. G. Wang, Y. Han, Q. Y. He, clusterProfiler: An R package for comparing biological themes among gene clusters. Omics 16 , 284–287 (2012).22455463 111 W. Luo, C. Brouwer, Pathview: An R/Bioconductor package for pathway-based data integration and visualization. Bioinformatics 29 , 1830–1831 (2013).23740750