==== Front Front Med (Lausanne) Front Med (Lausanne) Front. Med. Frontiers in Medicine 2296-858X Frontiers Media S.A. 10.3389/fmed.2023.1164656 Medicine Review The recent progress of peptide regulators for the Wnt/β-catenin signaling pathway Zhang Nan 1 † Shen Huaxing 1 † Chen Baobao 1 Hu Honggang 1 Liu Chao 1 Chen Yan 2 * Cong Wei 1 * 1School of Medicine or Institute of Translational Medicine, Shanghai University, Shanghai, China 2Department of Pharmacy, Medical Supplies Center of People's Liberation Army (PLA) General Hospital, Beijing, China Edited by: Ian James Martins, University of Western Australia, Australia Reviewed by: Ashish Ranjan Sharma, Hallym University, Republic of Korea; Yun-Kun Qi, Qingdao University, China; Zigang Li, Peking University, China *Correspondence: Yan Chen doctercy@163.com Wei Cong viviencong@shu.edu.cn †These authors have contributed equally to this work 16 6 2023 2023 10 116465613 2 2023 16 5 2023 Copyright © 2023 Zhang, Shen, Chen, Hu, Liu, Chen and Cong. 2023 Zhang, Shen, Chen, Hu, Liu, Chen and Cong https://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. Wnt signaling plays an important role in many biological processes such as stem cell self-renewal, cell proliferation, migration, and differentiation. The β-catenin-dependent signaling pathway mainly regulates cell proliferation, differentiation, and migration. In the Wnt/β-catenin signaling pathway, the Wnt family ligands transduce signals through LRP5/6 and Frizzled receptors to the Wnt/β-catenin signaling cascades. Wnt-targeted therapy has garnered extensive attention. The most commonly used approach in targeted therapy is small-molecule regulators. However, it is difficult for small-molecule regulators to make great progress due to their inherent defects. Therapeutic peptide regulators targeting the Wnt signaling pathway have become an alternative therapy, promising to fill the gaps in the clinical application of small-molecule regulators. In this review, we describe recent advances in peptide regulators for Wnt/β-catenin signaling. peptide regulators small molecular drugs biologics Wnt/β-catenin signaling pathway peptide regulators for Wnt/β-catenin recent progress National Key Research and Development Program of China 10.13039/501100012166 National Natural Science Foundation of China 10.13039/501100001809 Science and Technology Commission of Shanghai Municipality 10.13039/501100003399 This research was funded by the National Key R&D Program of China (No. 2021YFC2100201), the National Nature Science Foundation of China (No. 22077078), and the Shanghai Committee of Science and Technology of China (Nos. 221409003002, 2140900302, and 22140900303). section-at-acceptanceGene and Cell Therapy ==== Body pmc1. Introduction Wnt was initially discovered ~40 years ago (1), and the interest in Wnt signaling has increasingly risen. Wnt signaling plays an important role in many biological processes such as stem cell self-renewal, cell proliferation, migration, and differentiation (2). The Wnt signaling pathway is generally divided into canonical and non-canonical signaling pathways, i.e., β-catenin-dependent and β-catenin-independent signaling pathways, respectively (3). The β-catenin-dependent signaling pathway mainly regulates cell proliferation, differentiation, and migration (4). In the canonical signaling pathway, the Wnt family ligands transduce signals through LRP5/6 and Frizzled (FZD) receptors to the Wnt/β-catenin signaling cascades (5). The Porcupine (Porc) enzyme, a multiple-pass transmembrane O-acyltransferase in the endoplasmic reticulum, lipid-modifies the Wnt proteins. Through the Evi/Wntless multiple-pass transmembrane protein, the Wnt proteins are transported and secreted (6). The secreted Wnt ligands that are generally considered to stimulate the Wnt/β-catenin signaling pathway include Wnt1, Wnt2, Wnt3, Wnt8, and Wnt10 (7). Moreover, Wnt signals play a role by binding to the receptors during acute disease (8). The Wnt proteins commonly bind to the FZD receptor family, which are seven-transmembrane receptors, including 10 members. FZD has an intracellular C-terminal domain transducing downstream signals and an N-terminal cysteine-rich domain binding to Wnt ligands (7). In addition, LRP5/6 are co-receptors for FZD. LRP5/6 receptors lead to FZD receptor phosphorylation by forming a complex with the FZD receptor and Wnt proteins (9). R-spondin, a kind of Wnt agonist, potently enhances Wnt/β-catenin signals in Xenopus (10). After Wnt ligands bind to FZD/LRP receptors, the destruction complex residing in the cytoplasm regulates the stability of cytoplasmic β-catenin by binding and phosphorylating β-catenin (11). Axin, a type of tumor suppressor protein, acts as the scaffold of the destruction complex, interacting with the adenomatous polyposis coli (APC; a type of tumor suppressor protein) and casein kinase 1 (CK1) and glycogen synthase kinase 3 (GSK-3) (two types of the serine–threonine complex) (12). The cytoplasmic part of FZD interacts with Disheveled, a critical signal transducer in the Wnt/β-catenin signaling pathway, to promote interaction between Axin and LRP (13). The phosphorylated β-catenin then leaves the complex to be ubiquitinated by β-TrCP and then degraded by the proteasome. Subsequently, the destruction complex falls apart, and the β-catenin is stabilized and stimulates nuclear translocation (14). Upon Wnt signaling, β-catenin replaces Groucho from TCF/LEF and recruits histone and transcriptional coactivators for driving target gene expression (15). Tissue homeostasis was controlled by the coordination of reprogramming, regeneration, and self-renewal of stem cells, in which the Wnt/β-catenin signaling pathway was tightly controlled in spatiotemporal patterns, and disruption of the pathway was found in many types of diseases (16): (1) Chronic obstructive pulmonary disease: a previous study indicated that the Wnt/β-catenin signaling pathway was involved in lung development, epithelial injury, and the repair process (17); (2) Neurodegenerative diseases: the Wnt signaling pathway was activated to enhance the formation, stabilization, and recycling of synapses and helped promote neurogenesis (18); (3) Bone disease: inactivation of the Wnt/β-catenin signaling pathway was inhibited to inactivate osteoblasts and bone resorption (19); (4) Pathological wound healing: activation of the Wnt/β-catenin signaling pathway enhanced wound closure by regulating follicle regeneration, differentiation and migration of keratinocytes, and proliferation of epidermal stem cells (20); and (5) Cancer: the Wnt/β-catenin signaling pathway plays an important role in maintaining stem cells in different tissues. Therefore, changes in its components may induce cancer such as colorectal cancer (21) and lung adenocarcinoma (22). Small-molecule regulators are commonly used in targeted therapy. IWP and SB-216763 can exert effects on upstream and downstream components for inhibiting and activating the Wnt/β-catenin signaling pathway (23). The compound IWP may inhibit Porc with high selectivity, especially inhibiting Wnt secretion (24). SB-216763 can inhibit the GSK-3 enzyme and promote Wnt target gene expression (25). In addition, biologics are also commonly used in targeted therapy. Advancements have been made in the development of biologics such as vantictumab (human anti-FZD antibody) (26) and ipafricept (a recombinant fusion protein that can compete for binding to Wnt ligands) (27). However, although several Wnt signaling pathway drugs have been used in clinical trials, no apparent advancement has been made. Most small molecular drugs interact with known, unintended, biological targets. These off-target interactions may lead to both preclinical and clinical toxic events (28). Moreover, biologics are expensive to prepare and have difficulty entering cells, and can only act on a few types of targets (29). Interestingly, many of the properties of peptide drugs are intermediate between those of small molecular drugs and biologics. Peptide drugs have many advantages such as high specificity, good efficacy, good safety, low immunogenicity, membrane permeability, and low cost. They are widely used in clinical practice and have broad prospects (30, 31). Therefore, therapeutic peptide regulators targeting the Wnt signaling pathway have become an alternative therapy, promising to fill the gaps left by small-molecule drugs and biologics. In this review, we describe recent advances in peptide regulators for the Wnt/β-catenin signaling pathway, aiming to use them better for the clinical treatment of diseases (Figure 1; Table 1). Figure 1 TPpeptide regulators for the Wnt/β-catenin signaling pathway. Table 1 Therapeutics peptide regulators targeting the Wnt/β-catenin pathway components. Peptide Target and associated human disease(s) Key references KP6 Wnt Diabetic Kidney Disease (32) LMP2 Wnt Ischemia/Hypoxia-Induced BBB Injury (33) Aβ42 LRP5/6 Metabolic bone diseases (34) ACBP LRP5/6 Colorectal Cancer (35) ANP Frizzled TNBC (36) rhFzd7 Frizzled Tumors such as hepatoma (37) Fz7-21 Frizzled Cancer (38) The short peptide P182−195 Axin Cancer (39) COG1410 GSK-3β Early brain injury (40) APNp GSK-3β Cerebral Ischemia-Reperfusion Injury (41) MPAPO GSK-3β Corneal Wound (42) PIISVYWK GSK-3β Bone-related Diseases (43) FSVVPSPK GSK-3β Bone-related Diseases (43) IAGIP GSK-3β Parkinson's Disease (44) Exendin-4 GSK-3β rtPA-induced hemorrhagic transformation after ischemic stroke (45) C-peptide GSK-3β Decidualization in Human Endometrial Stromal Cells (46) APTBP Destruction complex Hypoxia-Induced Cardiomyocyte Injury (47) BmK AGAP β-catenin Breast Cancer (48) SAH-Bcl9B β-catenin Osteoarthritis (49) xStAx-VHLL β-catenin Intestinal Cancer (50) PTHrP (1-34) β-catenin Bone resorption and osteogenesis of Dental follicle cells (51) S9pep β-catenin Colon Cancer (52) PEP8 β-catenin Pancreatic Cancer (53) Apelin β-catenin Fracture (54) EIF6-224a β-catenin TNBC (55) GRP β-catenin Fibrotic lung diseases (56) C-peptide β-catenin Infertility (57) MAGE-3 β-catenin Melanoma (58) Melan-A β-catenin Melanoma (58) gp100 β-catenin Melanoma (58) NA-17 β-catenin Melanoma (58) OA-GL17d SMAD3 Skin Wound (59) APNp SMAD3 Diabetes (60) PAP-3.2KD SMAD4 Adriamycin-Induced Myocardial Injury (61) LYENRL SMAD4 Hypertrophic scar (62) SBD peptide SMAD4 Osteoporosis, arthritis, and periodontal diseases (63) CEMP1-p4 TCF/LEF Bone related diseases (64) VGN50 C-myc Leukemia and Lymphoma (65) 2. Peptide regulators for Wnt ligands Wnt signaling is important to many physiological, developmental, and disease processes (66). The Wnt signaling pathway is initiated by Wnt ligands. Wnt proteins are secreted proteins. They are synthesized and then lipid-modified by the Porc enzyme. Wnt proteins are further transported and secreted via the Evi/Wntless multiple-pass transmembrane (66, 67). There are 19 Wnt genes, which are divided into 20 conserved Wnt subfamilies (68). Wnt1, Wnt2, Wnt3, Wnt8, and Wnt19 ligands are frequently considered to activate the canonical (also named Wnt/β-catenin) signaling pathway (69, 70). Wnt4, Wnt5a, Wnt7, and Wnt11 are commonly considered to stimulate the non-canonical signaling pathway (71). In the absence of Wnt, β-catenin is not stabilized, and the Wnt/β-catenin signaling pathway is not activated. Therefore, the peptide regulators can inhibit the Wnt/β-catenin signaling pathway by inhibiting or binding to Wnt ligands (11). The Klotho protein is an anti-aging protein abundantly expressed in normal kidneys. Klotho, a single-pass transmembrane protein, includes a short cytoplasmic tail (KL2) and a transmembrane segment (KL1). Based on the KL1 domain sequence of human Klotho, KP6 (sequence: QPVVTLYHWDLPQRLQDAYGGWANRALADH) was designed and synthesized by Chen et al. KP6 is 30 amino acids in length and contains a Wnt-binding motif ranging from Gln186 to His215 within the KL1 domain. KP6 can mimic Klotho's function. KP6 blocks the Wnt/β-catenin signaling pathway by binding to Wnt, which sequesters its ability to interact with LRP6. Furthermore, KP6 promotes survival and ameliorates kidney injury in diabetic mice (32). A study indicated that the expression level of Wnt3a is high in myocardial hypertrophy mice and is positively related to cardiomyocyte apoptosis (72). The low-molecular-mass peptide 2 (LMP2, sequence: TYGPVFMCL) is a major catalytic subunit of the immunoproteasome. Dysregulation of the immunoproteasome has been linked with a variety of diseases (73). LMP2 can activate the Wnt/β-catenin signaling pathway by improving the expression levels of Wnt3a and β-catenin. The expression of tight junction proteins (occludin, claudin-1, and ZO-1) is downregulated to decrease blood–brain barrier (BBB) permeability after activating the pathway (33) (Figure 2; Table 2). Figure 2 Schematic representation of Wnt protein. Table 2 Peptide regulators targeting Wnt. Name Biological effect Sequence Function mechanism KP6 Inhibitor QPVVTLYHWDLPQRL QDAYGGWANRALADH Blocking the Wnt/β-catenin signaling pathway by binding to Wnts LMP2 Inhibitor TYGPVFMCL Improving the expression level of wnt-3a and β-catenin 3. Peptide regulators for Frizzled/LRP receptors When binding to target cells, Wnt proteins bind a receptor complex harboring FZD and LRP5/6 proteins (74). FZDs are a subset of seven-transmembrane proteins. They are the principal receptors of the Wnt/β-catenin signaling pathway (75). The N-terminal CRD domain of FZDs binds to Wnt ligands and LRP5/6 co-receptors. The C-terminus of FZDs is located in the cytoplasm, where it recruits and binds to Dsh for triggering subsequent signal cascades (76, 77). A previous study indicated that the knockdown of FZD7 decreases cell proliferation, invasion, and viability (78). FZD7 plays an important role in cell development, progression, and stem cell biology (79). Several approaches, such as adenoviral therapy (80) and monoclonal antibodies (81), have been applied to inhibit the Wnt/β-catenin pathway by targeting FZD. 3.1. Peptide regulators for Frizzled receptors The recombinant extracellular peptide fragment (rhFzd7), including the CRD sequence, was synthesized from Escherichia coli. rhFzd7 may antagonize Fzd7 by competitively binding with Wnt ligands to inhibit Wnt/β-catenin signaling. Interestingly, rhFzd7 exhibited a high affinity with Wnt3a (Kd = 3.41 × 10−8 mM). Moreover, rhFzd7 may effectively repress angiogenesis, proliferation, and invasion and induce apoptosis of triple-negative breast cancer cells (37). Ligands from a linear peptide library that bound to the Fc-tagged hFzd7 CRD were identified. Subsequently, five peptides were synthesized. Among them, Fz7-21 (sequence: LPSDDLEFWCHVMY) was the most potent peptide. A 5-carboxyfluorescein-labeled version of Fz7-21 (5FMA-Fz7-21) exhibited subtype-selective binding to Fc-tagged FZD1, FZD2, and FZD7 CRDs with half-maximal effective concentration values (19-58 nM). dFz7-21 exhibited an ~40-fold improvement in inhibiting Wnt3a signaling in HER293 cells as compared with monomeric Fz7-21. The crystal structure indicated that the dimeric form of Fz7-21 (dfz7-21) exhibits improved activity. dFz7-21 exhibited tight binding to the hFzd7 CRD (Kd = 3 nM). The dFz7-21 may inhibit Wnt signaling by perturbing the formation of the Wnt–FZD–LRP ternary complex to further impair stem cell function (38). Atrial natriuretic peptide (ANP, sequence: SLRRSSCFGGRMDRIGAQSGL GCNSFRY) was synthesized as an inactive precursor (pro-ANP) that was converted to a mature active peptide after proteolytic cleavage by the membrane-related serine protease Corin, in which the extracellular region included Fzd1 and Fzd2 (receptors for Wnt signaling) (82). ANP may induce β-catenin stabilization and nuclear translation possibly by direct interaction with the Frizzled receptors. The Wnt/β-catenin signaling cascade was activated, thereby exerting a neuroprotective effect in cellular systems mimicking the neurodegeneration in Parkinson's disease (36) (Figure 3; Table 3). Figure 3 Schematic representation of Frizzled protein. The Frizzled possesses two functional domains, including Frizzled (FRI) and Frizzled/Smoothened family membrane region (Frizzled). Table 3 Peptide regulators targeting frizzled. Name Biological effect Sequence Function mechanism ANP Activator SLRRSSCFGGRMD RIGAQSGLGCNSFRY Inducing β-catenin stabilization and nuclear translation via interacting with the Frizzled rhFzd7 Activator Antagonizing Fzd7 by competitively binding with Wnt ligand Fz7-21 Activator LPSDDLEFWCHVMY Perturbing the formation of the Wnt-FZD-LRP ternary complex 3.2. Peptide regulators for LRP receptor ACBP is a polypeptide that was identified from goat spleen extract after immunization with gastric cancer lysates (83). ACBP can inhibit phosphor-LRP6 and stimulate β-catenin, further leading to active β-catenin in the cytoplasm. Subsequently, the Wnt/β-catenin signaling pathway was inhibited to suppress the invasion, migration, and proliferation of colorectal cancer (35). Amyloid β peptide (Aβ) is a small proteolytic fragment (40 to 42 amino acids) consisting of a glycosylated transmembrane protein and amyloid precursor protein (84). Aβ42 (sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA) can bind to LRP5/6 and consequently upregulate the Wnt/β-catenin signaling pathway. TCF1, the downstream target of Wnt signaling, is activated to further enhance the expression of matrix mineralization and osteogenic markers (Runx2 and osteocalcin) (34) (Figure 4; Table 4). Figure 4 Schematic representation of LRP5/6 protein. LRP5/6 possesses 27 functional domains, including low-density lipoprotein receptor YWTD domain (LY), epidermal growth factor-like domain (EGF), and low-density lipoprotein receptor domain class A (LDLa). Table 4 Peptide regulators targeting LRP5/6. Name Biological effect Sequence Function mechanism ACBP Activator Inhibiting phosphor-LRP6 and further upregulating active β-catenin Aβ42 Activator DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Binding to LRP5/6 and further activating TCF1 4. Peptide regulators for the cytoplasmic Axin2/GSK-3β destruction complex The destruction complex may be a dynamic multiprotein assembly. Its core components include the serine-threonine kinase GSK-3, APC protein, scaffolding protein Axin, CK1, and E3-ubiquitin ligase β-TrCP (11). Peptide regulators may control the production of stable β-catenin by regulating whether the destruction complex falls apart. 4.1. Peptide regulators for Axin Axin is a largely unstructured, flexible protein that contains β-catenin, GSK-3, and CK1-binding sites. Axin is a key control point for catenin destruction because of its ability to promote the phosphorylation of β-catenin (12). A previous study indicated that Axin mutations lead to inappropriate β-catenin–mediated transcription (85). In addition, overexpression of Axin in colon cancer cells can reduce the accumulation of β-catenin (86). Conductin, also named Axin2, is an Axin paralog exhibiting similar domain architecture (39). In contrast to Axin, there are no indications for Axin2 polymerization. Axin2 appears to be diffusely distributed in the cytoplasm. In the lower polymerization of Axin2, it is less active in degrading β-catenin than Axin (87). The regulators of the G protein signaling (RGS) domain of Axin2 may prevent Axin2 polymerization, because of the considerable molecular structure of the RGS domain. A short peptide P182−195 (sequence: MEENAYQVFLTSDI) is designed and synthesized, which is centered on aggregation preventing polymerization and consists of Axin amino acids182−185. The short peptide can induce the polymerization of Axin and further block Wnt signaling and colorectal cancer growth (39) (Figure 5; Tables 5, 6). Figure 5 Schematic representation of Axin2 protein. Axin2 possesses two functional domains, including regulators of the G protein signaling domain (RGS) and the domain present in Disheveled and Axin (DAX). Table 5 Peptide regulator targeting Axin2. Name Biological effect Sequence Function mechanism The short peptide P182−195 Activator MEENAYQVFLTSDI Inducing polymerization of axin and further blocking Wnt signaling Table 6 Peptide regulator targeting the destruction complex. Name Biological effect Sequence Function mechanism APTBP Activator VKAGFAWTANQQLS Disrupting the formation of the destruction complex 4.2. Peptide regulators for GSK-3β GSK-3β is an evolutionarily conserved serine/threonine kinase functioning in numerous cellular processes such as cell cycle, DNA repair, cell proliferation, and metabolic and signaling pathways (88). GSK-3β can phosphorylate the serine of the PPPSP motif found in many Wnt signaling components (86). When its function is inhibited, the Wnt/β-catenin signaling pathway can be activated (86). Peptides can regulate Wnt/β-catenin by activating or inhibiting GSK-3β. 4.2.1. Activators The C-peptide (sequence: EVEDPQVPQLELGGGPEAGDLQTLALEVARQ) was initially identified in 1970 (89). It is cleaved from proinsulin during proteolytic processing. It can activate protein–protein interaction protein phosphatase 1 activity using a GSK-3β-dependent mechanism, which dephosphorylates GSK-3β at Ser9. The cross-activation between GSK-3β and protein phosphatase 1 decreases apoptosis and increases cellular senescence, leading to the inhibition of decidualization (46). 4.2.2. Inhibitors Exendin-4 (EX-4, sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS) is an agonist of the glucagon-like peptide-1 receptor. EX-4 can reduce the degradation of β-catenin by inhibiting the expression of GSK-3β. The Wnt/β-catenin signaling pathway was activated to further protect the integrity of the BBB (45). Three antioxidant peptides, namely, PIIVYWK (1004.57 Da, P1), TTANIEDRR (1074.54 Da, P2), and FSVVPSPK (860.09 Da, P3), were identified from a peptide fraction of 1–5 kDa obtained from blue mussels by peptic hydrolysis. It was found that the P1, P2, and P3 antioxidant peptides had a higher 2,2-diphenyl-1-picrylhydrazyl (DPPH) radical scavenging activity than previously reported antioxidant peptides from blue mussels (90, 91). In addition, the IC50 value against DPPH of P1 and P3 (0.71 ± 0.01 and 1.09 ± 0.01 mM, respectively) was higher than that of the P2 antioxidant peptide (2.33 ± 0.56 mM). Therefore, P1 and P3 antioxidant peptides warrant further study (92). P1 and P3 antioxidant peptides may enhance protein expression of Wnt1 and Wnt3a and downregulate protein expression of GSK-3β, ultimately stimulating the nuclear translocation of β-catenin. Subsequently, the Wnt/β-catenin signaling pathway was activated to promote human bone marrow-derived mesenchymal stem cell differentiation into osteoblasts (43). Pituitary adenylate cyclase-activating polypeptide (PACAP) is a type of peptide hormone superfamily, including glucagon-like peptides, glucagon, and vasoactive intestinal peptides (93), which exists in the form of PACAP38 and PACAP27 in vivo (94). PACAP has poor stability in vivo, and its half-life is less than 10 min. PACAP27-derived mutant peptide (named MPAPO, MHSDGIFTDSYSRYRKQLAVKKYLA AVKK) (95) was designed and synthesized. MPAPO, compared with PACAP27, has the following improvements: first, the binding and specific agonistic effects of MPAPO to the PAC1 receptor are significantly enhanced. Second, MPAPO has a longer half-life, more stable activity, and better stability. MPAPO can phosphorylate GSK-3β, which, once phosphorylated, loses the ability to phosphorylate β-catenin. β-Catenin enters the nucleus and drives the transcription of target genes to accelerate cell cycle progression and promote cell proliferation (42). IAGIP (sequence: EPVPPPPTPRSSRHDSGLDSMKD) was designed by linking the IKK-recognized (inflammation-responsive) motif to the LRP peptide (the GSK-3β inhibitory motif) (95). IAGIP can directly target the N-terminal region of GSK-3β, which includes Ser9, and can block GSK-3β activity. The inhibition of excessive GSK-3β activity provided a possible approach to controlling neuroinflammation in neurodegenerative diseases (44). Adiponectin (APN) is a 247-amino-acid polypeptide with a molecular weight of 30 kDa. BBB permeability was restricted by APN under physiological conditions. The APN peptide (APNp, sequence: LQVYGDGDHNGLYADNVN) was chemically synthesized based on the functional area in the globular domain of APN (96). APNp could effectively cross the BBB and bind with the intercephalic APN receptors to reliably simulate and maintain the function of endogenous APN. APNp can upregulate the phosphorylation of GSK-3β to improve neurological function and exert antiapoptotic, anti-inflammatory, and antioxidative effects against cerebral ischemia-reperfusion injury (41). p-GSK-3β can be upregulated by exogenous administration of apolipoprotein E (apoE), thereby promoting neuronal survival. However, apoE has difficulty crossing the BBB because of its 34-kDa molecular weight, thereby limiting its translational study (97). COG1410 (sequence: AS(Aib)LRKL(Aib)KRLL, Aib: 2-Aminoisobutyric acid), a modified apoE mimetic peptide, was designed with a composition of apoE residues 138–149 and the modification of two residues. COG1410 could effectively cross the BBB and have a long-lasting effect (98). COG1410 promoted neuronal autophagy by promoting the phosphorylation of GSK-3β (40). A novel peptide purified from the hydrolysates of tuna backbone protein (APTBP, VKAGFAWTANQQLS) was identified to have strong antioxidant activity (99). APTBP had high stability and a significant amphipathic characteristic. APTBP with a cell-penetrating peptide (CPP: GRKKRRQRRRPPQ) was chemically synthesized and derived from HIV-1 Tat (34–39, 80–86) attached to the N-terminus. The expression of APC and Axin2 was decreased by treatment with CPP-APTBP, which indicated that the CPP–APTBP function could be related to the disruption of the destruction complex. Subsequently, the activity of Wnt/β-catenin could be restored by CPP-APTBP. The accumulation of β-catenin can ameliorate hypoxia-induced cardiomyocyte apoptosis (47) (Figure 6; Table 7). Figure 6 Schematic representation of the GSK-3β protein. The GSK-3β includes one functional domain, serine/threonine protein kinases, and a catalytic domain (S_TKc). Table 7 Peptide regulators targeting GSK-3β. Name Biological effect Sequence Function mechanism COG1410 Inhibitor AS(Aib)LRKL(Aib)KRLLa Promoting the phosphorylation of GSK-3β APNp Inhibitor LQVYGDGDHNGLYADNVN Upregulating the phosphorylation of GSK-3β MPAPO Inhibitor MHSDGIFTDSYSRYRKQLAV KKYLAAVKK Phosphorylating GSK3β PIISVYWK Inhibitor PIIVYWK Downregulating the protein expression of GSK3β FSVVPSPK Inhibitor FSVVPSPK Downregulating the protein expression of GSK3β IAGIP Inhibitor EPVPPPPTPRSS RHDSGLDSMKD Targeting the N-terminal region of GSK-3β to block GSK-3β activity Exendin-4 Inhibitor HGEGTFTSDLSKQMEEEAV RLFIEWLKNGGPSSGAPPPS Inhibiting the expression of GSK-3β aAib: 2-Aminoisobutyric acid. 5. Peptide regulators for β-catenin and its target genes β-Catenin is a type of plasma membrane-associated protein, and it plays a dual role in cellular signaling. On the one hand, β-catenin can stabilize cell–cell contact. On the other hand, it plays a role in activating gene transcription after β-catenin translocation to the nucleus (100). β-Catenin plays a crucial role in a multitude of homeostatic and developmental mechanisms and is the key nuclear effector of the Wnt/β-catenin signaling pathway (101). The stability of cytoplasmic β-catenin has a role in the signal output of the Wnt/β-catenin signaling pathway. Some peptide regulators can regulate the Wnt/β-catenin signaling pathway by activating or inhibiting β-catenin. 5.1. Peptide regulators for β-catenin 5.1.1. Activators Apelin is the endogenous ligand for APJ, which is a seven-transmembrane G protein-coupled receptor (102). Apelin consists of numerous isoforms, including Apelin-12, 13, 17, and 36, which are all derived from the C-terminal fragment of the Apelin pre-proprotein with 77 amino acids (103). Among them, Apelin-13 needs further study because it exhibits the most active isoforms binding to the APJ receptor (104). Apelin-13 (sequence: QRPRLSHKGPMPF) could activate the Wnt/β-catenin signaling cascade by increasing the expression levels of total β-catenin and active β-catenin, thereby promoting osteogenic differentiation of human bone marrow-derived mesenchymal stem cells (54). A novel peptide, EIF6-224 amino acid (EIF6-224aa, sequence: PDAGREV AESSLGLR), was encoded by circ-EIF6. EIF6-224aa is responsible for the oncogenic effects of circ-EIF6. EIF6-224aa can interact with the oncogene MYH9 and subsequently decrease MYH9 degradation by upregulating the expression of β-catenin. The overexpression of MYH9 can enhance the metastasis of TNBC cells and promote the progression of TNBC (55). Gastrin-releasing peptide is a neuropeptide that acts through G protein-coupled receptors, which stimulate the proliferation of mesenchymal cells in the fetal monkey lung (105). GRP increased active β-catenin and total β-catenin levels and β-catenin mRNA expression. Myofibroblast differentiation was promoted after the activation of the pathway (56). The C-peptide (sequence: EVEDPQVPQLELGGGPEAGDLQTLALEVARQ) initially identified was cleaved from proinsulin during proteolytic processing in 1970 (89). C-peptide may activate the Wnt/β-catenin signaling pathway by inducing nuclear translocation of β-catenin, except targeting GSK-3β. β-Catenin in the nucleus directly regulates the transcription of MMP9/TIMP1/TIMP3, thereby promoting the migration of human endometrial stromal cells (UnD-ESCs) (57). The peptide vaccine for melanoma includes four peptides: Melan-A (sequence: AAGI GILTV), gp100 (sequence: KTWGQYWQV), MAGE-3 (sequence: FLWGPRALV), and NA-17 (sequence: VLPDVFIRCV). Melan-A has a “bulged” and “stretched” conformation. To identify the MART-1 epitopes for tumor-infiltrating lymphocytes, 23 peptides were selected based on the known peptide-binding motif to HLA-A2.1 and synthesized (>90% purity). Among them, Malan-A could most effectively sensitize T2 cells for lysis. Gp100 is a melanocyte-derived lineage-restricted intracellular glycoprotein that can be presented on the cell surface in association with major histocompatibility complex molecules in T lymphocytes (106). Several peptides generated from gp100 have been isolated and characterized. Among them, gp154-162 (sequence: KTWGQYWQV) necessitated further study because it was the most abundant at the cell surface (107). Six genes of the MAGE family, namely, MAGE-1, 2, 3, 4, 6, and 12, were found to be expressed at a high level in many tumor types of various histological origins (108). A MAGE-3 antigen presented by HLA-A2, which is the most common HLA allele, might therefore be widely used in the immunotherapy of melanoma. Based on the initial screening for binding to HLA-A2, the peptide (MAGE-3, sequence: FLWGPRALV) was synthesized (109). NA17 was designed and synthesized based on N-acetylglucosaminyltransferase-V from the GnT-V gene intron, nt 38–67, which appeared to induce peptide-specific recognition of target cells (110). After the vaccine is injected into patients with metastatic melanoma, the β-catenin protein stabilization is enhanced. In addition, the high-level expression of β-catenin is found in recurrent tumors after developing new treatment-resistant metastases. Therefore, the peptides in the vaccine are considered to be closely related to β-catenin (58). 5.1.2. Inhibitors The first Buthus martensii Karsch (BmK) analgesic peptide was identified from a venom (111). Since then, more BmK analgesic peptides, including BmK AGAP, have been purified (112). BmK AGAP (sequence: VRDGYIADDKNCA YFCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGKCNGG) belongs to a group of long-chain scorpion peptides, and it has a molecular mass of 7,142 Da (113). The rBmK has a molecular scaffold consisting of an α-helix and three-stranded antiparallel β-sheets, resulting in a compact core and several loops and c-turns extending outside (114). It can target PTX3 and further decrease the expression of β-catenin to influence the Wnt/β-catenin signaling pathway. BmK AGAP can effectively inhibit breast cancer cells (IC50 for MCF-7 = 40 μM; IC50 for MDA-MB-231 cells = 50 μM). In addition, the expression of the target gene of β-catenin, E-cadherin, is upregulated, thereby reducing breast cancer cell stemness and epithelial–mesenchymal transition (48). Verdine Lab designed and prepared xStAx, which is a type of stapled peptide, modeled after an Axin-derived peptide motif. Stapled peptides exhibited increased binding affinity, functional and conformational stability, and cell penetration via endocytosis. Based on design criteria, stapled Axin (StAx) CBD StAx-1, 2, and 3 were further designed. Among them, StAx-3 exhibited the greatest α-helicity (51%). Moreover, fStAx-3 exhibited significantly enhanced affinity for β-catenin (Kd = 60 ± 2 nM). The StAx-3 sequence was thus selected for further optimization. In a parallel series of experiments, affinity optimization of the Axin peptide sequence was examined. In addition, 32 new sequences were obtained. Among them, peptide fStAx-35R (sequence: RRWPRSILDSHVRRVWR) with high binding affinity for β-catenin (Kd = 53 ± 9 nM) and positive charge was obtained upon the addition of Arg and Trp at positions 467 and 468 (fStAx-34) and addition of arginine residues. Proteolysis-targeting chimera is a useful technology to degrade proteins in vivo. In this study, a novel proteolysis-targeting chimera β-catenin degrader was designed by coupling xStAx-35R with a von Hippel–Lindau protein (VHL) ligand via an Ahx chemical linker, termed xStAx-VHLL. xStAx-VHLL can sustain the degradation of β-catenin and significantly inhibit the Wnt/β-catenin signaling pathway (50). PTHrP is synthesized and expressed by various cells and tissues. After posttranslational processing, PTPrp could generate a variety of fragments, including PTHrP (1-34, sequence: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA), PTHrP (38-94), and PTHrP (107–139) peptides. Among them, PTHrP (1–34) can bind to the PTHrP receptor (PTH1R), a common G protein-coupled receptor. PTHrP (1–34) warrants further study because of its important role in tooth and bone development (115). PTHrP (1–34) can inactivate the Wnt/β-catenin pathway and further inhibit the expression of osteogenic-related genes (ALP, RUNX2, BSP, and OPN) in dental follicle cells. Ultimately, osteogenesis of dental follicle cells is inhibited (51). SOX9, the most extensively studied SOX family member, was both a downstream target and an inhibitor of the Wnt/β-catenin signaling pathway (116). S9pep (sequence: ADSPHSSSGMSEVHSPGEHSG) was designed and synthesized based on the amino acid sequence located in the SOX9 central region. The peptide has S9pep, which could inhibit the expression of c-Myc (its oncogenic target gene) by interacting with and relocating β-catenin from the chromatin to the cytosol, like SOX9 (52). A deca-peptide library of the DXMXXPQQTE sequence with 6,859 members was produced in MATLAB, where X denotes one of the 19 standard amino acids, except for cysteine. PEP8 (sequence: DEMEEPQQTE) was selected and synthesized after a series of screenings, for example, the calculation of affinity energy values for each amino acid and the root mean square deviation from the reference conformation. Peptide PEP8 expanded the size of the repository of druggable target proteins. PEP8 can inhibit the formation of the β-catenin/LRH-1 complex, thereby inhibiting the Wnt/β-catenin signaling pathway. In addition, PEP8 can inhibit the growth of AsPC-1 cells (IC50 value = 288 μM). To promote entry into the cells, TAT-PEP8 (sequence: GRKKRRQRRRPPQDEMEEPQQTE) was designed and synthesized by attaching the cell-penetrating peptide TAT to PEP8. TAT-PEP8 can inhibit the growth of AsPC-1 cells (IC50 value = 111 μM) (53). B-cell lymphoma 9 (BCL9) is a type of co-activator of β-catenin, which was first discovered in some B-cell malignant tumors (117). Peptide regulators targeted in the β-catenin/BCL9 interaction have garnered extensive attention, such as SAH-BCL9. Hydrocarbon stapling was applied to generate cell-permeable α-helical peptides of the BCL9 HD2 domain for in vivo and in vitro studies (118, 119). Non-natural amino acids with olefinic side chains were substituted at (i, i+4) positions, followed by ruthenium-catalyzed olefin metathesis to yield SAH-BCL9 peptides A through C. Among SAH-BCL9A−C, SAH-BCL9B (sequence: LSQEQLEHRERSLXTRXIQRMLF) was identified as the most effective β-catenin-targeting peptide. In addition, circular dichroism analysis confirmed that hydrocarbon stapling consistently enhanced peptide α-helicity compared with the corresponding unmodified peptide (BCL9HD2). SAH-BCL9 could target β-catenin in cells with a high affinity (IC50 = 135 nM) and selectively disrupt the BCL9/β-catenin complex in a dose-dependent manner. Blockade of these interactions inhibited β-catenin-dependent transcriptional activity and target gene expression and suppressed tumor cell growth, metastasis, and angiogenesis (49) (Figure 7; Table 8). Figure 7 Schematic representation of the β-catenin protein. β-catenin includes 12 functional domains consisting of Armadillo/β-catenin-like repeats (ARM). Table 8 Peptide regulators targeting β-catenin. Name Biological effect Sequence Function mechanism BmK AGAP Inhibitor VRDGYIADDKNCAYFCGRNAYCDDECEKNG AESGYCQWAGVYGNACWCYKLPDKVPIRVPGKCNGG Targeting PTX3 and further decreasing the expression of β-catenin. IC50 for MCF-7 cells: 40 μM; IC50 for MDA-MB-231 cells: 50 μM; demonstrated by MTT assay SAH-Bcl9B Inhibitor LSQEQLEHRERSLS5TLRS5IQRMLFa Targeting β-catenin and selectively disrupting the BCL9/β-catenin complex. IC50 =135 nM (for Colo 320 and MM1S cells, demonstrated by GST-pull-down assay) xStAx-VHLL Inhibitor RRWPRS5ILDS5HVRRVWR-Ahx-ALAPYIPb Sustaining degradation of β-catenin. IC50 =135 nM (for Colo 320 and MM1S cells, demonstrated by GST-pull-down assay) PTHrP(1-34) Inhibitor AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA Inactivating the Wnt/β-catenin pathway S9pep Inhibitor ADSPHSSSGMSEVHSPGEHSG Interacting with and relocating β-catenin PEP8 Inhibitor DEMEEPQQTE Inhibiting the formation of the β-catenin/LRH-1 complex. IC50 =288 μM (for AsPC-1 cells, demonstrated by MTT assay) Apelin Activator QRPRLSHKGPMPF Increasing the expression levels of total β-catenin and active β-catenin EIF6-224a Activator PDAGREVAESSLGLR Upregulating the expression of β-catenin GRP Activator VPLPAGGGTVLTKMYPRGNHWAVGHLM Increasing active β-catenin, total β-catenin levels, and β-catenin mRNA expression C-peptide Activator EVEDPQVPQLELGGGPEAGDLQTLALEVARQ Inducing nuclear translocation of β-catenin MAGE-3 Activator FLWGPRALV Enhancing β-catenin protein stabilization Melan-A Activator AAGIGILTV Enhancing β-catenin protein stabilization gp100 Activator KTWGQYWQV Enhancing β-catenin protein stabilization NA-17 Activator VLPDVFIRCV Enhancing β-catenin protein stabilization aS5: (S)-α-(4-pentenyl) alanine, a pair of S5 was coupled through the ring-closing metathesis reaction. bAhx: 6-aminocaproic acid; S5: (S)-α-(4-pentenyl) alanine, a pair of S5 was coupled through the ring-closing metathesis reaction. 5.2. Peptide regulators for c-Myc c-Myc (a type of target gene of β-catenin) is a type of proto-oncogene. It encodes a phosphoprotein that acts in cellular transformation, apoptosis, and cell cycle progression (120). When Kaposi sarcoma herpesvirus (KSHV) reactivation begins, RNA polymerase II molecules are effectively recruited to viral episomes and form a complex with a viral protein, KSHV replication, and transactivator (K-Rta), for vital gene expression (121). Moreover, KSHV reactivation induced the interaction of coactivators with both RNA polymerase II and K-Rta. A small peptide was designed based on the binding interface of K-Rta and the cellular coactivator complex. The homologous protein sequences were extracted from other gamma-herpesvirus homologs and a bacterial transcription factor. Based on the conserved protein sequence, a series of K-Rta peptides (P1-P5) were synthesized. Among them, P1 (renamed VGN50, sequence: LSSILQGLYQLDT) needs further study because of its major effect on cell viability and viral replication. VGN50 could recruit the SWI/SNF complex by engaging the MYC promoter, resulting in the downregulation of both MYC and MYC-target gene transcription. Ultimately, cell proliferation in leukemia and lymphoma is inhibited (65) (Figure 8; Table 9). Figure 8 Schematic representation of the c-Myc protein. The c-Myc includes 12 functional domains, Helix loop helix domain (HLH). Table 9 Peptide regulator targeting c-Myc. Name Biological effect Sequence Function mechanism VGN50 Inhibitor LSSILQGLYQLDT Recruiting the SWI/SNF complex by engaging the MYC promoter and downregulating MYC 6. Peptide regulators for TCF/LEF Although it is challenging to directly target β-catenin, it is possible to indirectly activate it through transcriptional cofactors and by controlling its stabilization. TCF and LEF are transcription factors mainly involved in the Wnt/β-catenin signaling pathway (122). The mammalian TCF/LEF consists of four nuclear factors, namely, TCF7L1, TCF7L2, LEF1, and TCF7 (also known as TCF3, TCF4, LEF1, and TCF1, respectively) (123). The activation of target genes by the β-catenin/TCF complex has been considered the main mode of the Wnt/β-catenin signaling pathway (124). LEF1 is widely expressed during mouse embryonic development. Moreover, its expression is tissue-specific in adults (125). A full-length LEF isoform that interacts with β-catenin is regulated by β-catenin-TCF complexes (122). Cementum markers, such as cementum protein 1 (CEMP1), were shown to promote the proliferation and differentiation of periodontal ligament cells toward a “mineralizing-like” phenotype (126). The secondary structure analysis of CEMP1 demonstrated that it had a random coil structure. A short peptide (named CEMP1-p4, sequence: QGQGDTEDGRMTLMG) was designed and synthesized based on the C-terminus of CEMP1, activating β-catenin signaling in human oral mucosa stem cells. CEMP1-p4 also had a random coil structure and could mimic the biological capabilities of CEMP1. CEMP1-p4 may activate the Wnt/β-catenin pathway by enhancing the expression of β-catenin, decreasing the expression of GSK-3β, and activating downstream transcriptional factors (TCF1/7 and LEF1). Subsequently, the expression of mineralization-related markers (OSX, RUNX2, IBSP, and OCN) was upregulated in human oral mucosal stem cells at both the mRNA and protein levels, driving the differentiation of HOMSCs to a mineralizing-like phenotype (64) (Figure 9; Table 10). Figure 9 Schematic representation of the TCF/LEF protein. TCF/LEF includes 12 functional domains, a high mobility group (HMG). Table 10 Peptide regulator targeting TCF/LEF. Name Biological effect Sequence Function mechanism CEMP1-p4 Activator QGQGDTEDGR MTLMG Activating downstream transcriptional factors 7. Peptide regulators for SMAD3/4 There is a crosstalk between the TGF-β/SMAD signaling pathway and the Wnt/β-catenin signaling pathway (127). TGF-β in the background of elevated SMAD3 enhances canonical Wnt/β-catenin signaling (128). The impact of increased β-catenin mRNA associated with SMAD4 loss is biologically significant (129). OA-GL17d (sequence: GLFKWHPRCGEEQSMWT), a new natural peptide homodimer, was identified from the skin secretions of Oreochromis andersonii. OA-GL17d was degraded after 10 h, and its half-life was ~1.86 h, much longer than that of some peptides (130). It may act on TGF-β1 through miR-663a to activate the SMAD signaling pathway, thereby promoting skin wound regeneration (59). The pilose antler polypeptide (PAP-3.2KD, sequence: VLSATDKTNVLAAW GKVGGNAPAFGAEALERM) is one of the main components of pilose antler. PAP-3.2KD may decrease the expression of TGF-β1 and further reduce SMADs, which are the target proteins of TGF-β1 signal transduction. Ultimately, the TGF-β/SMAD signaling pathway is inhibited, which thereby ameliorates histopathological damage, myocardial fibrosis, and apoptosis in adriamycin-induced myocardial tissues (61). A total of 1,697 endogenous peptides in hypertrophic scar tissues and matched normal skin were identified using liquid chromatography-mass spectrometry/mass spectrometry. Among these, 78 peptides were highly expressed in normal tissues compared with the corresponding hypertrophic scar tissues. The peptides with fat solubility (aliphatic index > 100) and high stability (instability index < 0) were further screened. Considering that endogenous peptides were derived through hemoglobin reduction in hypertrophic scar tissues, LYENRL and ASGVAVSDGVIKV (ASGVA) were selected for further assessment of biological function. In addition, LYENPL could inhibit the proliferation of human skin fibroblast cells at a lower dose compared with ASGVA. LYENRL could reduce SMAD2/3 phosphorylation and the SMAD2/3/4 complexes to the SMAD Binding element, thereby inhibiting TGF-β1/SMAD signaling. Additionally, LYENRL can inhibit the proliferation, migration, and extracellular matrix production of scar fibroblasts in a concentration-dependent manner (62). A region termed the SMAD4-binding domain (SBD) was identified, which was an amino-terminal region of transactivation 2 of p65 (a main subunit of NF-κB), associated with the mad homology 1 domain of SMAD4 to inhibit bone morphogenetic protein signaling. Based on the SBD, a cell-permeable SBD peptide (sequence: RRRRRRRGGGQAGEGTLSEALLHLQF) was designed and synthesized, which could block the association of p65 with SMAD4. In addition, the SBD peptide enhances BMP2-induced osteoblast differentiation and mineralization (63). APNp could suppress mitochondrial and ATF4-CHOP apoptosis pathways in a SMAD3-dependent manner by targeting GSK-3β. Thus, neural survival was promoted following intracerebral hemorrhage injury in the diabetic setting (60) (Figure 10; Table 11). Figure 10 Schematic representation of the SMAD3/4 protein. SMAD3/4 includes 12 functional domains, with Domain A in dwarfin family proteins (DWA) and Domain B in dwarfin family proteins (DWB). Table 11 Peptide regulators targeting SMAD3/4. Name Biological effect Sequence Function mechanism OA-GL17d Activator GLFKWHPRC GEEQSMWT Acting on TGF-β1 through miR-663a to activate the SMAD signaling pathway APNp Activator LQVYGDGDH NGLYADNVN Suppressing mitochondrial and ATF4-CHOP apoptosis pathways in a SMAD3-dependent manner PAP-3.2KD Inhibitor VLSATDKTNVLAAWGK VGGNAPAFGAEALERM Decreasing the expression of TGF-β1 and further reducing SMADs LYENRL Inhibitor LYENRL Reducing SMAD2/3 phosphorylation and SMAD2/3/4 complex to SMAD Binding Element SBD peptide Inhibitor RRRRRRRGGGQAG EGTLSEALLHLQF Blocking the association of p65 with SMAD4 8. Conclusion and outlook In summary, we have briefly explored the importance of the Wnt/β-catenin signaling pathway in human diseases. This signaling pathway is mainly involved in regulating biological processes such as cell proliferation, differentiation, and migration. In the Wnt/β-catenin signaling pathway, Wnt family ligands transduce signals to the Wnt/β-catenin signaling cascade through LRP5/6 and FZD receptors. Therefore, targeting molecules in the Wnt/β-catenin signaling pathway may modulate human diseases by activating or inhibiting this pathway, thereby affecting biological processes. Given recent research advancements, we summarize the peptide modulators in the Wnt/β-catenin signaling pathway. Studies have indicated that peptide regulators regulate the Wnt/β-catenin signaling pathway by targeting and antagonizing or agonizing molecules in the pathway. Peptide regulators of the Wnt/β-catenin signaling pathway have shown promising results in preclinical studies. They have the potential to treat several diseases such as cancer, osteoporosis, and Alzheimer's disease. A recent study has shown that the interaction of the protein FAM83A with catenin is very important for the regulation of the development process of pancreatic cancer. Multiple blocking short peptide drug precursors targeting FAM83A catenin were screened and obtained. Their effectiveness was verified in animal models such as zebrafish and mice (131). In the future, peptide regulators could be developed into therapeutics that target specific diseases with great efficacy and fewer side effects than current treatments. Additionally, the development of peptide drug delivery systems could improve the bioavailability and pharmacokinetic properties of these agents. Furthermore, combining peptide regulators with other signaling pathway inhibitors could offer synergistic effects in treating diseases such as cancer. More research on the safety and efficacy of these peptide regulators is needed to fully understand their potential therapeutic benefits. However, polypeptide drugs also have some potential challenges, such as unstable physical and chemical properties, a short half-life, a fast clearance rate, and a lack of an effective drug delivery system, which are worthy of further exploration in future studies. Overall, peptide regulators of the Wnt/β-catenin signaling pathway have promising future perspectives as potential therapeutics for a range of diseases. Author contributions NZ and HS: conceptualization. NZ, HS, BC, and HH: writing. CL: supervision. YC and WC: project administration. All authors have read and agreed to the published version of the manuscript. Conflict of interest The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest. Publisher's note All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher. ==== Refs References 1. From From the American Association of Neurological Surgeons ASoNC Interventional Interventional Radiology Society of Europe CIRACoNSESoMINTESoNESOSfCA Interventions SoIRSoNS World Stroke O Sacks D Baxter B . Multisociety consensus quality improvement revised consensus statement for endovascular therapy of acute ischemic stroke. Int J Stroke. (2018) 13 :612–32. 10.1177/1747493018778713 29786478 2. Steinhart Z Angers S . Wnt Signaling in development and tissue homeostasis. Development. (2018) 145 :11. 10.1242/dev.146589 29884654 3. Katoh M . Canonical and non-canonical wnt signaling in cancer stem cells and their niches: cellular heterogeneity, omics reprogramming, targeted therapy and tumor plasticity (Review). Int J Oncol. (2017) 51 :1357–69. 10.3892/ijo.2017.4129 29048660 4. Patel S Alam A Pant R Chattopadhyay S . Wnt signaling and its significance within the tumor microenvironment: novel therapeutic insights. Front Immunol. (2019) 10 :2872. 10.3389/fimmu.2019.02872 31921137 5. Katoh M Katoh M . Molecular genetics and targeted therapy of wnt-related human diseases (Review). Int J Mol Med. (2017) 40 :587–606. 10.3892/ijmm.2017.3071 28731148 6. Taciak B Pruszynska I Kiraga L Bialasek M Krol M . Wnt signaling pathway in development and cancer. J Physiol Pharmacol. (2018) 69 :2. 10.26402/jpp.2018.2.07 29980141 7. Nie X Liu H Liu L Wang YD Chen WD . Emerging roles of wnt ligands in human colorectal cancer. Front Oncol. (2020) 10 :1341. 10.3389/fonc.2020.01341 32923386 8. Takada S Fujimori S Shinozuka T Takada R Mii Y . Differences in the secretion and transport of wnt proteins. J Biochem. (2017) 161 :1–7. 10.1093/jb/mvw071 28053142 9. Frenquelli M Tonon G . Wnt signaling in hematological malignancies. Front Oncol. (2020) 10 :615190. 10.3389/fonc.2020.615190 33409156 10. Cruciat CM Niehrs C . Secreted and transmembrane wnt inhibitors and activators. Cold Spring Harb Perspect Biol. (2013) 5 :a015081. 10.1101/cshperspect.a015081 23085770 11. Stamos JL Weis WI . The beta-catenin destruction complex. Cold Spring Harb Perspect Biol. (2013) 5 :a007898. 10.1101/cshperspect.a007898 23169527 12. Nong J Kang K Shi Q Zhu X Tao Q Chen YG . Phase separation of axin organizes the beta-catenin destruction complex. J Cell Biol. (2021) 220 :4. 10.1083/jcb.202012112 33651074 13. Kan W Enos MD Korkmazhan E Muennich S Chen DH Gammons MV . Limited Dishevelled/Axin oligomerization determines efficiency of Wnt/beta-catenin signal transduction. Elife. (2020) 9. 10.7554/eLife.55015 32297861 14. Simonetta KR Taygerly J Boyle K Basham SE Padovani C Lou Y . Prospective discovery of small molecule enhancers of an e3 ligase-substrate interaction. Nat Commun. (2019) 10 :1402. 10.1038/s41467-019-09358-9 30926793 15. Tanaka N Mashima T Mizutani A Sato A Aoyama A Gong B . Apc mutations as a potential biomarker for sensitivity to tankyrase inhibitors in colorectal cancer. Mol Cancer Ther. (2017) 16 :752–62. 10.1158/1535-7163.MCT-16-0578 28179481 16. Yoon GH Kim K Park DS Choi SC . Rnf152 negatively regulates Wnt/Beta-catenin signaling in xenopus embryos. BMB Rep. (2022) 55 :232–7. 10.5483/BMBRep.2022.55.5.187 35410636 17. Konigshoff M Eickelberg O . Wnt signaling in lung disease: a failure or a regeneration signal? Am J Respir Cell Mol Biol. (2010) 42 :21–31. 10.1165/rcmb.2008-0485TR 19329555 18. Tiwari SK Agarwal S Seth B Yadav A Nair S Bhatnagar P . Correction to curcumin-loaded nanoparticles potently induce adult neurogenesis and reverse cognitive deficits in alzheimer's disease model via canonical Wnt/beta-catenin pathway. ACS Nano. (2019) 13 :7355. 10.1021/acsnano.9b03830 31135130 19. Uluckan O Jimenez M Karbach S Jeschke A Grana O Keller J . Chronic skin inflammation leads to bone loss by il-17-mediated inhibition of wnt signaling in osteoblasts. Sci Transl Med. (2016) 8 :330ra37. 10.1126/scitranslmed.aad8996 27089206 20. Seifert AW Kiama SG Seifert MG Goheen JR Palmer TM Maden M . Skin shedding and tissue regeneration in African spiny mice (Acomys). Nature. (2012) 489 :561–5. 10.1038/nature11499 23018966 21. Oliveira LFS Predes D Borges HL Abreu JG . Therapeutic potential of naturally occurring small molecules to target the Wnt/beta-catenin signaling pathway in colorectal cancer. Cancers (Basel). (2022) 14 :2. 10.3390/cancers14020403 35053565 22. Chen D Gao S Gao F Liu A Li J Li J . Smek1 promotes lung adenocarcinoma proliferation and invasion by activating Wnt/beta-catenin signaling pathway. Clin Transl Oncol. (2022) 22 :8. 10.1007/s12094-022-03001-8 36463369 23. Huang P Yan R Zhang X Wang L Ke X Qu Y . Activating Wnt/beta-catenin signaling pathway for disease therapy: challenges and opportunities. Pharmacol Ther. (2019) 196 :79–90. 10.1016/j.pharmthera.2018.11.008 30468742 24. Praxenthaler H Kramer E Weisser M Hecht N Fischer J Grossner T . Extracellular matrix content and Wnt/beta-catenin levels of cartilage determine the chondrocyte response to compressive load. Biochim Biophys Acta Mol Basis Dis. (2018) 1864 :851–9. 10.1016/j.bbadis.2017.12.024 29277327 25. Roberts JD Murphy NP Hamilton RM Lubbers ER James CA Kline CF . Ankyrin-B dysfunction predisposes to arrhythmogenic cardiomyopathy and is amenable to therapy. J Clin Invest. (2019) 129 :3171–84. 10.1172/JCI125538 31264976 26. Davis SL Cardin DB Shahda S Lenz HJ Dotan E O'Neil BH . A Phase 1b dose escalation study of wnt pathway inhibitor vantictumab in combination with nab-paclitaxel and gemcitabine in patients with previously untreated metastatic pancreatic cancer. Invest New Drugs. (2020) 38 :821–30. 10.1007/s10637-019-00824-1 31338636 27. Fischer MM Cancilla B Yeung VP Cattaruzza F Chartier C Murriel CL . Wnt antagonists exhibit unique combinatorial antitumor activity with taxanes by potentiating mitotic cell death. Sci Adv. (2017) 3 :e1700090. 10.1126/sciadv.1700090 28691093 28. Rao MS Gupta R Liguori MJ Hu M Huang X Mantena SR . Novel computational approach to predict off-target interactions for small molecules. Front Big Data. (2019) 2 :25. 10.3389/fdata.2019.00025 33693348 29. Nejadmoghaddam MR Minai-Tehrani A Ghahremanzadeh R Mahmoudi M Dinarvand R Zarnani AH . Antibody-drug conjugates: possibilities and challenges. Avicenna J Med Biotechnol. (2019) 11 :3–23.30800238 30. Zhou X Smith QR Liu X . Brain penetrating peptides and peptide-drug conjugates to overcome the blood-brain barrier and target Cns diseases. Wiley Interdiscip Rev Nanomed Nanobiotechnol. (2021) 13 :e1695. 10.1002/wnan.1695 33470550 31. Habault J Poyet JL . Recent advances in cell penetrating peptide-based anticancer therapies. Molecules. (2019) 24 :5. 10.3390/molecules24050927 30866424 32. Chen X Tan H Xu J Tian Y Yuan Q Zuo Y . Klotho-derived peptide 6 ameliorates diabetic kidney disease by targeting Wnt/beta-catenin signaling. Kidney Int. (2022) 102 :506–20. 10.1016/j.kint.2022.04.028 35644285 33. Chen XY Wan SF Yao NN Lin ZJ Mao YG Yu XH . Inhibition of the immunoproteasome lmp2 ameliorates ischemia/hypoxia-induced blood-brain barrier injury through the Wnt/beta-catenin signalling pathway. Mil Med Res. (2021) 8 :62. 10.1186/s40779-021-00356-x 34857032 34. Yang B Li S Chen Z Feng F He L Liu B . Amyloid beta peptide promotes bone formation by regulating Wnt/beta-catenin signaling and the opg/rankl/rank system. FASEB J. (2020) 34 :3583–93. 10.1096/fj.201901550R 31944393 35. Tong X Zhuang Z Wang X Yang X Bai L Su L . Acbp suppresses the proliferation, migration, and invasion of colorectal cancer via targeting Wnt/beta-catenin signaling pathway. Biomed Pharmacother. (2021) 137 :111209. 10.1016/j.biopha.2020.111209 33581651 36. Colini Baldeschi A Pittaluga E Andreola F Rossi S Cozzolino M Nicotera G . Atrial natriuretic peptide acts as a neuroprotective agent in in vitro models of parkinson's disease via up-regulation of the Wnt/beta-catenin pathway. Front Aging Neurosci. (2018) 10 :20. 10.3389/fnagi.2018.00020 29449807 37. Xie W Zhang Y He Y Zhang K Wan G Huang Y . A Novel recombinant human frizzled-7 Protein exhibits anti-tumor activity against triple negative breast cancer via abating Wnt/beta-catenin pathway. Int J Biochem Cell Biol. (2018) 103 :45–55. 10.1016/j.biocel.2018.08.004 30096373 38. Nile AH de Sousa EMF Mukund S Piskol R Hansen S Zhou L . A Selective peptide inhibitor of frizzled 7 receptors disrupts intestinal stem cells. Nat Chem Biol. (2018) 14 :582–90. 10.1038/s41589-018-0035-2 29632413 39. Bernkopf DB Bruckner M Hadjihannas MV Behrens J . An aggregon in conductin/Axin2 regulates Wnt/Beta-catenin signaling and holds potential for cancer therapy. Nat Commun. (2019) 10 :4251. 10.1038/s41467-019-12203-8 31534175 40. Li X Peng J Pang J Wu Y Huang X Li Y . Apolipoprotein E-Mimetic peptide Cog1410 promotes autophagy by phosphorylating gsk-3beta in early brain injury following experimental subarachnoid hemorrhage. Front Neurosci. (2018) 12 :127. 10.3389/fnins.2018.00127 29556174 41. Liu H Wu X Luo J Zhao L Li X Guo H . Adiponectin peptide alleviates oxidative stress and Nlrp3 inflammasome activation after cerebral ischemia-reperfusion injury by regulating Ampk/Gsk-3beta. Exp Neurol. (2020) 329 :113302. 10.1016/j.expneurol.2020.113302 32275928 42. Wang Z Shan W Li H Feng J Lu S Ou B . The pacap-derived peptide mpapo facilitates corneal wound healing by promoting corneal epithelial cell proliferation and trigeminal ganglion cell axon regeneration. Int J Biol Sci. (2019) 15 :2676–91. 10.7150/ijbs.35630 31754339 43. Oh Y Ahn CB Je JY . Blue mussel-derived peptides piisvywk and fsvvpspk trigger Wnt/Beta-catenin signaling-mediated osteogenesis in human bone marrow mesenchymal stem cells. Mar Drugs. (2020) 18 :10. 10.3390/md18100510 33050263 44. Lee S Hong DG Yang S Kim J Baek M Kim S . Anti-Inflammatory effect of Ikk-activated gsk-3beta inhibitory peptide prevented nigrostriatal neurodegeneration in the rodent model of parkinson's disease. Int J Mol Sci. (2022) 23 :2. 10.3390/ijms23020998 35055183 45. Liu C Sun S Xie J Li H Li T Wu Q . Glp-1r Agonist Exendin-4 protects against hemorrhagic transformation induced by rtpa after ischemic stroke via the Wnt/beta-catenin signaling pathway. Mol Neurobiol. (2022) 59 :3649–64. 10.1007/s12035-022-02811-9 35359227 46. Khaliq SA Baek MO Cho HJ Chon SJ Yoon MS . C-Peptide inhibits decidualization in human endometrial stromal cells Via Gsk3beta-Pp1. Front Cell Dev Biol. (2020) 8 :609551. 10.3389/fcell.2020.609551 33330513 47. Zhang L Cao M Yu Z Xu S Ju L Qian J . The restoration of Wnt/Beta-catenin signalling activity by a tuna backbone-derived peptide ameliorates hypoxia-induced cardiomyocyte injury. Am J Transl Res. (2020) 12 :5221–36.33042415 48. Kampo S Ahmmed B Zhou T Owusu L Anabah TW Doudou NR . Scorpion venom analgesic peptide, bmk agap inhibits stemness, and epithelial-mesenchymal transition by down-regulating ptx3 in breast cancer. Front Oncol. (2019) 9 :21. 10.3389/fonc.2019.00021 30740360 49. Held A Glas A Dietrich L Bollmann M Brandstadter K Grossmann TN . Targeting beta-catenin dependent wnt signaling via peptidomimetic inhibitors in murine chondrocytes and Oa cartilage. Osteoarthritis Cartilage. (2018) 26 :818–23. 10.1016/j.joca.2018.02.908 29559252 50. Liao H Li X Zhao L Wang Y Wang X Wu Y . A protac peptide induces durable beta-catenin degradation and suppresses wnt-dependent intestinal cancer. Cell Discov. (2020) 6 :35. 10.1038/s41421-020-0171-1 32550000 51. Zhang J Liao L Li Y Xu Y Guo W Tian W . Parathyroid hormone-related peptide (1-34) promotes tooth eruption and inhibits osteogenesis of dental follicle cells during tooth development. J Cell Physiol. (2019) 234 :11900–11. 10.1002/jcp.27857 30584670 52. Blache P Canterel-Thouennon L Busson M Verdie P Subra G Ychou M . A short sox9 peptide mimics sox9 tumor suppressor activity and is sufficient to inhibit colon cancer cell growth. Mol Cancer Ther. (2019) 18 :1386–95. 10.1158/1535-7163.MCT-18-1149 31092563 53. Pouraghajan K Mahdiuni H Ghobadi S Khodarahmi R . Lrh-1 (Liver Receptor Homolog-1) derived affinity peptide ligand to inhibit interactions between beta-catenin and lrh-1 in pancreatic cancer cells: from computational design to experimental validation. J Biomol Struct Dyn. (2022) 40 :3082–97. 10.1080/07391102.2020.1845241 33183172 54. Hang K Ye C Xu J Chen E Wang C Zhang W . Apelin enhances the osteogenic differentiation of human bone marrow mesenchymal stem cells partly through Wnt/beta-catenin signaling pathway. Stem Cell Res Ther. (2019) 10 :189. 10.1186/s13287-019-1286-x 31238979 55. Li Y Wang Z Su P Liang Y Li Z Zhang H . Circ-Eif6 Encodes Eif6-224aa to promote tnbc progression via stabilizing Myh9 and activating the Wnt/beta-catenin pathway. Mol Ther. (2022) 30 :415–30. 10.1016/j.ymthe.2021.08.026 34450253 56. Kayalar O Oztay F Ongen HG . Gastrin-releasing peptide induces fibrotic response in mrc5s and proliferation in A549s. Cell Commun Signal. (2020) 18 :96. 10.1186/s12964-020-00585-y 32552754 57. Abdul Khaliq S Umair Z Baek MO Chon SJ Yoon MS . C-Peptide promotes cell migration by controlling matrix metallopeptidase-9 activity through direct regulation of beta-catenin in human endometrial stromal cells. Front Cell Dev Biol. (2022) 10 :800181. 10.3389/fcell.2022.800181 35127683 58. Trujillo JA Luke JJ Zha Y Segal JP Ritterhouse LL Spranger S . Secondary Resistance to immunotherapy associated with beta-catenin pathway activation or pten loss in metastatic melanoma. J Immunother Cancer. (2019) 7 :295. 10.1186/s40425-019-0780-0 31703593 59. Zhang Y Wang Y Zeng L Liu Y Sun H Li S . Amphibian-derived peptide homodimer oa-gl17d promotes skin wound regeneration through the Mir-663a/Tgf-Beta1/smad axis. Burns Trauma. (2022) 10 :tkac032. 10.1093/burnst/tkac032 35832307 60. Wu X Luo J Liu H Cui W Guo W Zhao L . Recombinant adiponectin peptide promotes neuronal survival after intracerebral haemorrhage by suppressing mitochondrial and atf4-chop apoptosis pathways in diabetic mice via smad3 signalling inhibition. Cell Prolif. (2020) 53 :e12759. 10.1111/cpr.12759 31922310 61. Xu Y Qu X Zhou J Lv G Han D Liu J . et al. Pilose antler peptide-32kd ameliorates adriamycin-induced myocardial injury through tgf-beta/smad signaling pathway. Front Cardiovasc Med. (2021) 8 :659643. 10.3389/fcvm.2021.659643 34124197 62. Ji X Tang Z Shuai W Zhang Z Li J Chen L . Endogenous peptide lyenrl prevents the activation of hypertrophic scar-derived fibroblasts by inhibiting the tgf-beta1/smad pathway. Life Sci. (2019) 231 :116674. 10.1016/j.lfs.2019.116674 31344427 63. Urata M Kokabu S Matsubara T Sugiyama G Nakatomi C Takeuchi H . A Peptide that blocks the interaction of Nf-Kappab P65 subunit with smad4 enhances bmp2-induced osteogenesis. J Cell Physiol. (2018) 233 :7356–66. 10.1002/jcp.26571 29663368 64. Arroyo R Lopez S Romo E Montoya G Hoz L Pedraza C . Carboxy-terminal cementum protein 1-derived peptide 4 (Cemp1-P4) promotes mineralization through Wnt/beta-catenin signaling in human oral mucosa stem cells. Int J Mol Sci. (2020) 21(4). 10.3390/ijms21041307 32075221 65. Shimoda M Lyu Y Wang KH Kumar A Miura H Meckler JF . Kshv Transactivator-derived small peptide traps coactivators to attenuate myc and inhibits leukemia and lymphoma cell growth. Commun Biol. (2021) 4 :1330. 10.1038/s42003-021-02853-0 34857874 66. Eubelen M Bostaille N Cabochette P Gauquier A Tebabi P Dumitru AC . A Molecular mechanism for Wnt ligand-specific signaling. Science. (2018) 361 :6403. 10.1126/science.aat1178 30026314 67. Liu J Xiao Q Xiao J Niu C Li Y Zhang X . Wnt/beta-catenin signalling: function, biological mechanisms, and therapeutic opportunities. Signal Transduct Target Ther. (2022) 7 :3. 10.1038/s41392-021-00762-6 34980884 68. Colozza G Koo BK . Wnt/beta-catenin signaling: structure, assembly and endocytosis of the signalosome. Dev Growth Differ. (2021) 63 :199–218. 10.1111/dgd.12718 33619734 69. Alok A Lei Z Jagannathan NS Kaur S Harmston N Rozen SG . Wnt proteins synergize to activate beta-catenin signaling. J Cell Sci. (2017) 130 :1532–44. 10.1242/jcs.198093 28289266 70. Chae WJ Bothwell ALM . Canonical and non-canonical Wnt signaling in immune cells. Trends Immunol. (2018) 39 :830–47. 10.1016/j.it.2018.08.006 30213499 71. Corda G Sala A . Non-Canonical Wnt/Pcp signalling in cancer: Fzd6 takes centre stage. Oncogenesis. (2017) 6 :e364. 10.1038/oncsis.2017.69 28737757 72. Zhang Y Zhang L Fan X Yang W Yu B Kou J . Captopril attenuates tac-induced heart failure via inhibiting wnt3a/beta-catenin and Jak2/Stat3 pathways. Biomed Pharmacother. (2019) 113 :108780. 10.1016/j.biopha.2019.108780 30889487 73. Chen X Zhang X Wang Y Lei H Su H Zeng J . Inhibition of immunoproteasome reduces infarction volume and attenuates inflammatory reaction in a rat model of ischemic stroke. Cell Death Dis. (2015) 6 :e1626. 10.1038/cddis.2014.586 25633295 74. Yu F Yu C Li F Zuo Y Wang Y Yao L . Wnt/Beta-Catenin signaling in cancers and targeted therapies. Signal Transduct Target Ther. (2021) 6 :307. 10.1038/s41392-021-00701-5 34456337 75. Schenkelaars Q Fierro-Constain L Renard E Hill AL Borchiellini C . Insights into frizzled evolution and new perspectives. Evol Dev. (2015) 17 :160–9. 10.1111/ede.12115 25801223 76. Janda CY Waghray D Levin AM Thomas C Garcia KC . Structural basis of wnt recognition by frizzled. Science. (2012) 337 :59–64. 10.1126/science.1222879 22653731 77. MacDonald BT He X . Frizzled and Lrp5/6 Receptors for Wnt/beta-catenin signaling. Cold Spring Harb Perspect Biol. (2012) 4 :12. 10.1101/cshperspect.a007880 23209147 78. Yang L Wu X Wang Y Zhang K Wu J Yuan YC . Fzd7 has a critical role in cell proliferation in triple negative breast cancer. Oncogene. (2011) 30 :4437–46. 10.1038/onc.2011.145 21532620 79. Kanwar SS Yu Y Nautiyal J Patel BB Majumdar AP . The Wnt/beta-catenin pathway regulates growth and maintenance of colonospheres. Mol Cancer. (2010) 9 :212. 10.1186/1476-4598-9-212 20691072 80. Nambotin SB Lefrancois L Sainsily X Berthillon P Kim M Wands JR . Pharmacological inhibition of Frizzled-7 displays anti-tumor properties in hepatocellular carcinoma. J Hepatol. (2011) 54 :288–99. 10.1016/j.jhep.2010.06.033 21055837 81. Gurney A Axelrod F Bond CJ Cain J Chartier C Donigan L . Wnt pathway inhibition via the targeting of frizzled receptors results in decreased growth and tumorigenicity of human tumors. Proc Natl Acad Sci U S A. (2012) 109 :11717–22. 10.1073/pnas.1120068109 22753465 82. Chan JC Knudson O Wu F Morser J Dole WP Wu Q . Hypertension in mice lacking the proatrial natriuretic peptide convertase corin. Proc Natl Acad Sci U S A. (2005) 102 :785–90. 10.1073/pnas.0407234102 15637153 83. Su L Xu G Shen J Tuo Y Zhang X Jia S . Anticancer bioactive peptide suppresses human gastric cancer growth through modulation of apoptosis and the cell cycle. Oncol Rep. (2010) 23 :3–9. 10.3892/or_00000599 19956858 84. Nunan J Small DH . Proteolytic processing of the amyloid-beta protein precursor of alzheimer's disease. Essays Biochem. (2002) 38 :37–49. 10.1042/bse0380037 12463160 85. Xu C Xu Z Zhang Y Evert M Calvisi DF Chen X . Beta-catenin signaling in hepatocellular carcinoma. J Clin Invest. (2022) 132 :4. 10.1172/JCI154515 35166233 86. Yu J Liu D Sun X Yang K Yao J Cheng C . Cdx2 Inhibits the proliferation and tumor formation of colon cancer cells by suppressing Wnt/Beta-catenin signaling via transactivation of gsk-3beta and axin2 expression. Cell Death Dis. (2019) 10 :26. 10.1038/s41419-018-1263-9 30631044 87. Bernkopf DB Hadjihannas MV Behrens J . Negative-feedback regulation of the Wnt pathway by conductin/Axin2 involves insensitivity to upstream signalling. J Cell Sci. (2015) 128 :33–9. 10.1242/jcs.159145 25380820 88. Lin J Song T Li C Mao W . Gsk-3beta in DNA Repair, apoptosis, and resistance of chemotherapy, radiotherapy of cancer. Biochim Biophys Acta Mol Cell Res. (2020) 1867 :118659. 10.1016/j.bbamcr.2020.118659 31978503 89. Melani F Rubenstein AH Oyer PE Steiner DF . Identification of proinsulin and c-peptide in human serum by a specific immunoassay. Proc Natl Acad Sci U S A. (1970) 67 :148–55. 10.1073/pnas.67.1.148 4318774 90. Kumar KJ Yang HL Tsai YC Hung PC Chang SH Lo HW . Lucidone protects human skin keratinocytes against free radical-induced oxidative damage and inflammation through the up-regulation of Ho-1/Nrf2 antioxidant genes and down-regulation of Nf-kappab signaling pathway. Food Chem Toxicol. (2013) 59 :55–66. 10.1016/j.fct.2013.04.055 23712098 91. Lazcano-Perez F Roman-Gonzalez SA Sanchez-Puig N Arreguin-Espinosa R . Bioactive peptides from marine organisms: a short overview. Protein Pept Lett. (2012) 19 :700–7. 10.2174/092986612800793208 22489781 92. Soo Yeon Park Young-Sang Kim Chang-Bum . Partial purification and identification of three antioxidant peptides with hepatoprotective effects from blue mussel (Mytilus Edulis) hydrolysate by peptic hydrolysis. J Funct Foods. (2016) 16 :254. 10.1016/j.jff.2015.10.023 93. Maugeri G D'Amico AG Reitano R Magro G Cavallaro S Salomone S . Pacap and Vip inhibit the invasiveness of glioblastoma cells exposed to hypoxia through the regulation of Hifs and Egfr expression. Front Pharmacol. (2016) 7 :139. 10.3389/fphar.2016.00139 27303300 94. Sze KH Zhou H Yang Y He M Jiang Y Wong AO . Pituitary adenylate cyclase-activating polypeptide (Pacap) as a growth hormone (Gh)-releasing factor in grass carp: Ii. solution structure of a brain-specific pacap by nuclear magnetic resonance spectroscopy and functional studies on gh release and gene. Express Endocrinol. (2007) 148 :5042–59. 10.1210/en.2007-0576 17615143 95. Ma Y Zhao S Wang X Shen S Ma M Xu W . A new recombinant pacap-derived peptide efficiently promotes corneal wound repairing and lacrimal secretion. Invest Ophthalmol Vis Sci. (2015) 56 :4336–49. 10.1167/iovs.15-17088 26176871 96. Li X Guo H Zhao L Wang B Liu H Yue L . Adiponectin attenuates Nadph oxidase-mediated oxidative stress and neuronal damage induced by cerebral ischemia-reperfusion injury. Biochim Biophys Acta Mol Basis Dis. (2017) 1863 :3265–76. 10.1016/j.bbadis.2017.08.010 28844957 97. Hayashi H Campenot RB Vance DE Vance JE . Apolipoprotein E-Containing lipoproteins protect neurons from apoptosis via a signaling pathway involving low-density lipoprotein receptor-related protein-1. J Neurosci. (2007) 27 :1933–41. 10.1523/JNEUROSCI.5471-06.2007 17314289 98. Wu H Niu H Wu C Li Y Wang K Zhang J . The autophagy-lysosomal system in subarachnoid haemorrhage. J Cell Mol Med. (2016) 20 :1770–8. 10.1111/jcmm.12855 27027405 99. Je JY Qian ZJ Byun HG Kim SK . Purification and characterization of an antioxidant peptide obtained from tuna backbone protein by enzymatic hydrolysis. Process Biochemistry. (2007) 42 :840–6. 10.1016/j.procbio.2007.02.006 100. Gosens R Meurs H Schmidt M . The Gsk-3/Beta-catenin-signalling axis in smooth muscle and its relationship with remodelling. Naunyn Schmiedebergs Arch Pharmacol. (2008) 378 :185–91. 10.1007/s00210-008-0269-8 18612673 101. Valenta T Hausmann G Basler K . The many faces and functions of Beta-Catenin. EMBO J. (2012) 31 :2714–36. 10.1038/emboj.2012.150 22617422 102. O'Dowd BF Heiber M Chan A Heng HH Tsui LC Kennedy JL . A Human gene that shows identity with the gene encoding the angiotensin receptor is located on chromosome 11. Gene. (1993) 136 :355–60. 10.1016/0378-1119(93)90495-O 8294032 103. Tatemoto K Hosoya M Habata Y Fujii R Kakegawa T Zou MX . Isolation and characterization of a novel endogenous peptide ligand for the human apj receptor. Biochem Biophys Res Commun. (1998) 251 :471–6. 10.1006/bbrc.1998.9489 9792798 104. Hosoya M Kawamata Y Fukusumi S Fujii R Habata Y Hinuma S . molecular and functional characteristics of Apj. tissue distribution of mrna and interaction with the endogenous ligand apelin. J Biol Chem. (2000) 275 :21061–7. 10.1074/jbc.M908417199 10777510 105. Emanuel RL Torday JS Mu Q Asokananthan N Sikorski KA Sunday ME . Bombesin-like peptides and receptors in normal fetal baboon lung: roles in lung growth and maturation. Am J Physiol. (1999) 277 :L1003–17. 10.1152/ajplung.1999.277.5.L1003 10564187 106. Bakker AB Schreurs MW de Boer AJ Kawakami Y Rosenberg SA Adema GJ . Melanocyte lineage-specific antigen gp100 is recognized by melanoma-derived tumor-infiltrating lymphocytes. J Exp Med. (1994) 179 :1005–9. 10.1084/jem.179.3.1005 8113668 107. Skipper JC Gulden PH Hendrickson RC Harthun N Caldwell JA Shabanowitz J . Mass-spectrometric evaluation of hla-a*0201-associated peptides identifies dominant naturally processed forms of ctl epitopes from mart-1 and Gp100. Int J Cancer. (1999) 82 :669–77.10417764 108. De Plaen E Arden K Traversari C Gaforio JJ Szikora JP De Smet C . Structure, chromosomal localization, and expression of 12 genes of the mage family. Immunogenetics. (1994) 40 :360–9. 10.1007/BF01246677 7927540 109. van der Bruggen P Bastin J Gajewski T Coulie PG Boel P De Smet C . A peptide encoded by human gene mage-3 and presented by Hla-A2 induces cytolytic t lymphocytes that recognize tumor cells expressing mage-3. Eur J Immunol. (1994) 24 :3038–43. 10.1002/eji.1830241218 7805731 110. Nolte A Scheffold C Slotty J Huenefeld C Schultze JL Grabbe S . Generation of melanoma-specific cytotoxic t lymphocytes for allogeneic immunotherapy. J Immunother. (2003) 26 :257–69. 10.1097/00002371-200305000-00009 12806279 111. Duenas-Cuellar RA Santana CJC Magalhaes ACM Pires OR Fontes W . Scorpion toxins and ion channels: potential applications in cancer therapy. Toxins (Basel). (2020) 12 :5. 10.3390/toxins12050326 32429050 112. Shao J Kang N Liu Y Song S Wu C Zhang J . Purification and characterization of an analgesic peptide from buthus martensii karsch. Biomed Chromatogr. (2007) 21 :1266–71. 10.1002/bmc.882 17604360 113. Liu YF Hu J Zhang JH Wang SL Wu CF . Isolation, purification, and n-terminal partial sequence of an antitumor peptide from the venom of the chinese scorpion buthus martensii karsch. Prep Biochem Biotechnol. (2002) 32 :317–27. 10.1081/PB-120015456 12455825 114. Ma R Cui Y Zhou Y Bao YM Yang WY Liu YF . Location of the analgesic domain in scorpion toxin bmk agap by mutagenesis of disulfide bridges. Biochem Biophys Res Commun. (2010) 394 :330–4. 10.1016/j.bbrc.2010.02.179 20206129 115. Ono W Sakagami N Nishimori S Ono N Kronenberg HM . Parathyroid hormone receptor signalling in osterix-expressing mesenchymal progenitors is essential for tooth root formation. Nat Commun. (2016) 7 :11277. 10.1038/ncomms11277 27068606 116. Anstine LJ Majmudar PR Aponte A Singh S Zhao R Weber Bonk KL . Tle3 Sustains luminal breast cancer lineage fidelity to suppress metastasis. Cancer Res. (2023) 23 :5953. 10.1158/0008-5472.22549895 36696357 117. Deka J Wiedemann N Anderle P Murphy-Seiler F Bultinck J Eyckerman S . Bcl9/Bcl9l are critical for wnt-mediated regulation of stem cell traits in colon epithelium and adenocarcinomas. Cancer Res. (2010) 70 :6619–28. 10.1158/0008-5472.CAN-10-0148 20682801 118. Bird GH Bernal F Pitter K Walensky LD . Synthesis and biophysical characterization of stabilized alpha-helices of Bcl-2 domains. Methods Enzymol. (2008) 446 :369–86. 10.1016/S0076-6879(08)01622-4 18603134 119. Walensky LD Kung AL Escher I Malia TJ Barbuto S Wright RD . Activation of apoptosis in vivo by a hydrocarbon-stapled bh3 helix. Science. (2004) 305 :1466–70. 10.1126/science.1099191 15353804 120. Zhang K Gao L Wang J Chu X Zhang Z Zhang Y . A novel Brd family protac inhibitor dbet1 exerts great anti-cancer effects by targeting c-myc in acute myeloid leukemia cells. Pathol Oncol Res. (2022) 28 :1610447. 10.3389/pore.2022.1610447 35832114 121. Chen CP Lyu Y Chuang F Nakano K Izumiya C Jin D . Kaposi's sarcoma-associated herpesvirus hijacks rna polymerase ii to create a viral transcriptional factory. J Virol. (2017) 91 :11. 10.1128/JVI.02491-16 28331082 122. Hrckulak D Kolar M Strnad H Korinek V . Tcf/Lef Transcription factors: an update from the internet resources. Cancers (Basel). (2016) 8 :7. 10.3390/cancers8070070 26742076 123. Doumpas N Lampart F Robinson MD Lentini A Nestor CE Cantu C . Tcf/Lef dependent and independent transcriptional regulation of Wnt/beta-catenin target genes. EMBO J. (2019) 38 :2. 10.15252/embj.201798873 30425074 124. Nusse R Clevers H . Wnt/beta-catenin signaling, disease, and emerging therapeutic modalities. Cell. (2017) 169 :985–99. 10.1016/j.cell.2017.05.016 28575679 125. Santiago L Daniels G Wang D Deng FM Lee P . Wnt signaling pathway protein lef1 in cancer, as a biomarker for prognosis and a target for treatment. Am J Cancer Res. (2017) 7 :1389–406.28670499 126. Komaki M Iwasaki K Arzate H Narayanan AS Izumi Y Morita I . Cementum Protein 1 (Cemp1) induces a cementoblastic phenotype and reduces osteoblastic differentiation in periodontal ligament cells. J Cell Physiol. (2012) 227 :649–57. 10.1002/jcp.22770 21465469 127. Zhou B Liu Y Kahn M Ann DK Han A Wang H . Interactions between beta-catenin and transforming growth factor-beta signaling pathways mediate epithelial-mesenchymal transition and are dependent on the transcriptional co-activator camp-response element-binding protein (Creb)-binding protein (Cbp). J Biol Chem. (2012) 287 :7026–38. 10.1074/jbc.M111.276311 22241478 128. DiRenzo DM Chaudhary MA Shi X Franco SR Zent J Wang K . A crosstalk between tgf-beta/smad3 and Wnt/beta-catenin pathways promotes vascular smooth muscle cell proliferation. Cell Signal. (2016) 28 :498–505. 10.1016/j.cellsig.2016.02.011 26912210 129. Freeman TJ Smith JJ Chen X Washington MK Roland JT Means AL . Smad4-mediated signaling inhibits intestinal neoplasia by inhibiting expression of beta-catenin. Gastroenterology. (2012) 142:562–71 e2. 10.1053/j.gastro.2011.11.026 22115830 130. Liu N Meng B Zeng L Yin S Hu Y Li S . Discovery of a novel rice-derived peptide with significant anti-gout potency. Food Funct. (2020) 11 :10542–53. 10.1039/D0FO01774D 33185232 131. Zhou C Zhu X Liu N Dong X Zhang X Huang H . B-Lymphoid tyrosine kinase-mediated fam83a phosphorylation elevates pancreatic tumorigenesis through interacting with beta-catenin. Signal Transduct Target Ther. (2023) 8 :66. 10.1038/s41392-022-01268-5 36797256