==== Front mSystems mSystems mSystems mSystems 2379-5077 American Society for Microbiology 1752 N St., N.W., Washington, DC 37184670 01073-22 10.1128/msystems.01073-22 msystems.01073-22 Research Article open-peer-reviewOpen Peer Reviewantimicrobial-chemotherapyAntimicrobial Chemotherapy In vitro and ex vivo proteomics of Mycobacterium marinum biofilms and the development of biofilm-binding synthetic nanobodies https://orcid.org/0000-0001-9076-8782 Hammarén Milka Marjut 1 2 Conceptualization Funding acquisition Investigation Methodology Project administration Supervision Writing – original draft Writing – review and editing milka.hammaren@tuni.fi https://orcid.org/0000-0002-9334-6304 Luukinen Hanna 1 Formal analysis Investigation Methodology Validation Visualization Writing – original draft Writing – review and editing https://orcid.org/0000-0003-4554-6595 Sillanpää Alina 1 Formal analysis Investigation Methodology Validation Writing – review and editing https://orcid.org/0000-0002-4394-7953 Remans Kim 2 Methodology Resources Supervision Writing – review and editing https://orcid.org/0000-0003-0620-9553 Lapouge Karine 2 Investigation Methodology Writing – review and editing https://orcid.org/0000-0002-5723-9093 Custódio Tânia 3 4 5 Formal analysis Investigation Methodology Writing – review and editing https://orcid.org/0000-0003-0764-7483 Löw Christian 3 4 5 Resources Supervision Writing – review and editing https://orcid.org/0000-0002-6936-4879 Myllymäki Henna 1 Formal analysis Investigation Methodology Writing – review and editing https://orcid.org/0000-0003-3784-0890 Montonen Toni 1 Formal analysis Investigation Methodology Visualization Writing – review and editing https://orcid.org/0000-0003-1761-8571 Seeger Markus 6 Conceptualization Supervision Writing – review and editing Robertson Joseph 7 8 Data curation Investigation Methodology Writing – review and editing https://orcid.org/0000-0001-8787-5886 Nyman Tuula A. 7 8 Funding acquisition Supervision https://orcid.org/0000-0001-5325-925X Savijoki Kirsi 1 9 Conceptualization Formal analysis Investigation Methodology Visualization Writing – original draft Writing – review and editing https://orcid.org/0000-0001-5555-3815 Parikka Mataleena 1 Conceptualization Funding acquisition Supervision Writing – review and editing 1 Faculty of Medicine and Health Technology, Tampere University , Tampere, Finland 2 European Molecular Biology Laboratory , Heidelberg, Germany 3 Centre for Structural Systems Biology , Hamburg, Germany 4 Deutsches Elektronen-Synchrotron (DESY) , Hamburg, Germany 5 European Molecular Biology Laboratory , Hamburg, Germany 6 Institute for Medical Microbiology, University of Zurich , Zurich, Switzerland 7 Department of Immunology, University of Oslo , Oslo, Norway 8 Oslo University Hospital , Oslo, Norway 9 Faculty of Agriculture and Forestry, University of Helsinki , Helsinki, Finland Editor Cristea Ileana M. Princeton University , Princeton, New Jersey, USA Ad hoc peer reviewer Cos Paul University of Antwerp , Belgium Address correspondence to Milka Marjut Hammarén, milka.hammaren@tuni.fi Milka Marjut Hammarén and Hanna Luukinen contributed equally to this article. The more senior author is listed first. Kirsi Savijoki and Mataleena Parikka contributed equally to this article. The authors declare no conflict of interest. 15 5 2023 May-Jun 2023 15 5 2023 8 3 e01073-2231 10 2022 05 3 2023 Copyright © 2023 Hammarén et al. 2023 Hammarén et al. https://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution 4.0 International license. ABSTRACT The antibiotic-tolerant biofilms present in tuberculous granulomas add an additional layer of complexity when treating mycobacterial infections, including tuberculosis (TB). For a more efficient treatment of TB, the biofilm forms of mycobacteria warrant specific attention. Here, we used Mycobacterium marinum (Mmr) as a biofilm-forming model to identify the abundant proteins covering the biofilm surface. We used biotinylation/streptavidin-based proteomics on the proteins exposed at the Mmr biofilm matrices in vitro to identify 448 proteins and ex vivo proteomics to detect 91 Mmr proteins from the mycobacterial granulomas isolated from adult zebrafish. In vitro and ex vivo proteomics data are available via ProteomeXchange with identifiers PXD033425 and PXD039416, respectively. Data comparisons pinpointed the molecular chaperone GroEL2 as the most abundant Mmr protein within the in vitro and ex vivo proteomes, while its paralog, GroEL1, with a known role in biofilm formation, was detected with slightly lower intensity values. To validate the surface exposure of these targets, we created in-house synthetic nanobodies (sybodies) against the two chaperones and identified sybodies that bind the mycobacterial biofilms in vitro and those present in ex vivo granulomas. Taken together, the present study reports a proof-of-concept showing that surface proteomics in vitro and ex vivo proteomics combined is a valuable strategy to identify surface-exposed proteins on the mycobacterial biofilm. Biofilm surface–binding nanobodies could be eventually used as homing agents to deliver biofilm-targeting treatments to the sites of persistent biofilm infection. IMPORTANCE With the currently available antibiotics, the treatment of TB takes months. The slow response to treatment is caused by antibiotic tolerance, which is especially common among bacteria that form biofilms. Such biofilms are composed of bacterial cells surrounded by the extracellular matrix. Both the matrix and the dormant lifestyle of the bacterial cells are thought to hinder the efficacy of antibiotics. To be able to develop faster-acting treatments against TB, the biofilm forms of mycobacteria deserve specific attention. In this work, we characterize the protein composition of Mmr biofilms in bacterial cultures and in mycobacteria extracted from infected adult zebrafish. We identify abundant surface-exposed targets and develop the first sybodies that bind to mycobacterial biofilms. As nanobodies can be linked to other therapeutic compounds, in the future, they can provide means to target therapies to biofilms. KEYWORDS Mycobacterium biofilm surface proteome synthetic nanobody libraries nanobody biofilm-targeted therapy Academy of Finland (AKA) 338624 Hammarén Milka Marjut Academy of Finland (AKA) 326674, 322010, 326584, 348968 Parikka Mataleena Tampereen Tuberkuloosisäätiö (Tampere Tuberculosis Foundation) Hammarén Milka Marjut Tampereen Tuberkuloosisäätiö (Tampere Tuberculosis Foundation) Parikka Mataleena Jane and Aatos Erkko Foundation Parikka Mataleena Sigrid Juséliuksen Säätiö (Sigrid Jusélius Stiftelse) Parikka Mataleena Biocenter Finland (BF) Parikka Mataleena Core Facilities programme of the South-Eastern Norway Regional Health Authority Nyman Tuula A. Research Council of Norway INFRASTRUKTUR-programme 295910 Nyman Tuula A. Tampereen Tuberkuloosisäätiö (Tampere Tuberculosis Foundation) Myllymäki Henna cover-dateMay/June 2023 ==== Body pmcINTRODUCTION Mycobacterium tuberculosis (Mtb) is currently the deadliest bacterial pathogen in the world (1) and has long been known to form antibiotic-tolerant biofilms in vitro (2, 3). Biofilms are difficult and slow to fully eradicate with antibiotics (4). Tolerance arises from both the physical protection provided by an extracellular matrix surrounding the bacteria as well as the altered phenotypes of the bacterial cells embedded within the matrix (4). Antibiotic tolerance has also been shown to support the development of genetic antibiotic resistance, thereby exacerbating treatment challenges (5). Therefore, treatments that can target antibiotic-tolerant biofilms could also hinder the development of genetic antibiotic resistance—an enormous global health problem. According to the World Health Organization, 48% of previously treated infections are multidrug-resistant tuberculosis (TB). The treatment success rate for resistant strains is only 59% (1). Recent studies have taken a closer look into TB granulomas harboring antibiotic-tolerant populations. The caseous center of granulomas in the rabbit model of TB was shown to contain bacteria that are extremely antibiotic tolerant (6, 7). Recently, in a landmark paper by Chakraborty and colleagues, the presence of antibiotic-tolerant mycobacteria was shown to coincide with the presence of cellulose in the biofilm matrix inside of granulomas isolated from the lungs of mice, monkeys, and humans (8). The disassembly of the matrix with an enzymatic cellulase treatment was shown to reduce the antibiotic tolerance of mycobacteria in vivo (8). Thus, alternative treatment modalities beyond antibiotics specifically targeting antibiotic-tolerant biofilms can open new horizons in the fight against TB and other biofilm infections as well as provide better strategies to reduce antibiotic use, thereby hindering the further development and spread of genetic antibiotic resistance. Nanobodies are small, single-domain antibodies originally identified in camelids. Compared to traditional immunoglobulin antibodies, nanobodies are small (~15 kDa) and have higher stability, low immunogenicity, and better tissue penetration. Nanobodies can also easily be linked to other functional therapeutic molecules, making them promising tools for specialized treatment delivery in the battle against hard-to-reach/hard-to-treat diseases (9, 10). Similar to existing cancer-targeting antibody-linked therapeutics, we envision treatment-delivering nanobodies could be developed against the extracellular proteins of bacterial biofilms for the purpose of concentrating alternative treatments to bacterial biofilm lesions. As nanobodies cannot penetrate cells, the ideal nanobody targets would be the abundant surface-exposed proteins on the biofilms. Recently, we started to explore the extracellular composition of Mycobacterium marinum (Mmr) biofilms (11). We chose Mmr as our biofilm model as it forms mature biofilms in vitro (12, 13) that are antibiotic-tolerant (11) and is a well-established model pathogen for TB (14 - 17). Mmr causes a TB-like disease in zebrafish, which share central aspects with human TB (18, 19). Typical is the formation of caseous necrotic granulomas and the replication of the spectrum of disease states ranging from active progressive to chronic infection with dormant bacteria or reactivated disease (14, 18). Our previous work on cell surface–shaving proteomics provided a systems-level view of the biofilm matrix proteome and how the protein profile changes over time (11). However, to reliably elucidate which of the biofilm matrix proteins are the most promising binding targets for nanobodies, in this study, we created a parallel in vitro data set using cell surface protein biotinylation combined with liquid chromatography-mass spectrometry/mass spectrometry identification. In addition, we provide the first insights into the mycobacterial in vivo proteome of Mmr granulomas extracted from adult zebrafish. The extensive comparative analysis of these three overlapping data sets allowed us to reliably identify surface-exposed biofilm proteins in mycobacterial infection. To validate the surface exposure of selected hits and to take the first steps toward therapeutic delivery strategies, we also developed nanobodies against two mycobacterial chaperones, GroEL1 and GroEL2. Instead of using camelid immunizations for the generation of binders against mycobacterial biofilms, we used the synthetic nanobody (sybody) libraries developed by Zimmermann and colleagues (20, 21). We generated sybodies against two proteins identified from our proteomic analyses and showed their binding to Mmr biofilms. When chemically linked to fluorescent cargo, these nanobodies could be used to label biofilm in vitro and ex vivo in granulomas. Our results demonstrate the potential of surface proteomic strategies to identify nanobody-binding targets on biofilms and the capacity of using biofilm-targeting nanobodies to bind cargo onto biofilms in granulomas. MATERIALS AND METHODS Bacteria and culture conditions M. marinum (ATCC927) and the avirulent M. tuberculosis strain H37Ra (ATCC25177) were used in the present study. Mmr cells were cultured at 29°C and Mtb at 37°C. Mycobacterial biofilms were first cultured on a 7H10 agar plate supplemented with 10% (vol/vol) of OADC (oleic acid, albumin, dextrose, catalase) enrichment (Thermo Fisher Scientific, New Hampshire, USA) and 0.5% (vol/vol) glycerol (Sigma-Aldrich, Missouri, USA) for 1 week (Mmr) or 3 weeks (Mtb). After the pre-culturing, the bacterial mass was transferred to a 7H9 medium supplemented with 10% of ADC (albumin, dextrose, catalase) enrichment (Fisher Scientific) to obtain an optical density (OD600) of 0.1. The culturing was continued for a further 2–5 weeks in containers sealed with laboratory film. Biotinylation proteomics of in vitro biofilms Protein biotinylation To biotinylate the proteins on intact and lyzed Mmr biofilms, 5-week-old biofilms containing both the pellicle and submerged biofilm cells were pooled together, centrifuged, and resuspended in BupH-PBS (Thermo Fisher Scientific, New Hampshire, USA) and stored on ice until biotinylation. To produce the total lysate protein samples, the biofilm cells were lyzed by bead beating (100-µm glass beads at 6.5 m/s twice for 40 s with dry ice) and sonicated for 10 min in a water bath in the presence of 20 mg/mL lysozyme (Sigma-Aldrich) for 2 hours at 37°C. The residual cell debris was centrifuged to obtain cell-free extract containing both the cytoplasmic and the biofilm matrix/cell wall–associated proteins. Then, both the intact and lyzed Mmr biofilms were biotinylated with sulfo-NHS-LC-biotin (Pierce, Illinois, USA) using 1 mg of biotin per 150 mg of the sample in BupH-PBS at room temperature (RT) for 30 min with gentle agitation. After the incubation, 10 mg/mL of glycine was added to terminate the reaction. The labeled, intact biofilm cells were resuspended in a 600-µL urea lysis buffer composed of 140 mM NaCl, 20 mM Na2HPO4, 7 M urea, 0.05% (vol/vol) Tween 20, and 0.1% (wt/vol) deoxycholic acid (pH 7.2) for lyzing the cells by bead beating, as described above. The disrupted samples were centrifuged (12,000g for 10 min) to remove insoluble substances, and excess biotin was removed from the lysates by dialysis using 3-kDa Slide-A-Lyzer cassettes in BupH-PBS. The affinity capture of the biotinylated bacterial proteins was performed in SafeSeal low-binding tubes (BioScience, Utah, USA) using magnetic streptavidin-coated C1 dynabeads (Invitrogen, California, USA) in 150 mM NaCl, 20 mM Na2HPO4, 1.75 M urea, 0.05% (vol/vol) Tween 20 (Sigma-Aldrich), and 0.05% (wt/vol) CHAPS at pH 7.3. The samples were washed three times with the same buffer; three times with 150 mM NaCl, 20 mM Na2HPO4, and 0.05% (vol/vol) Tween 20 at pH 7.2; and once with 50 mM NH4HCO3 at pH 7.8 and flash-frozen in 50 mM NH4HCO3. On-bead Tryptic digestion and liquid chromatography tandem mass spectrometry (LC-MS/MS) identification of biotinylated proteins The streptavidin beads with captured biotin-labeled proteins were resuspended in fresh 50 mM NH4HCO3, then reduced using 10 mM dithiotreitol (DTT), and alkylated using 15 mM iodoacetamide. Protein samples were digested using 1 µg trypsin (Promega, Wisconsin, USA) and incubated overnight at 37°C. Following digestion, the samples were acidified and desalted using homemade C18 stage tips. Peptides were eluted from the stage tips using 50% acetonitrile (ACN)/0.1% formic acid (FA), dried to completion by speed vacuum, and resuspended in 0.1% FA. LC-MS/MS analysis was performed using a nanoElute nanoflow ultrahigh pressure LC system (Bruker Daltonics, Bremen, Germany) coupled to a timsTOF fleX mass spectrometer (Bruker Daltonics) with CaptiveSpray nanoelectrospray ion source (Bruker Daltonics). The peptides were separated using a 60-min gradient at a flow rate of 300 nL/min. The timsTOF fleX was operated in PASEF mode, and the data-dependent acquisition was performed using 10 PASEF MS/MS scans per cycle with a near 100% duty cycle. Ex vivo proteomics of the mycobacterial granulomas Zebrafish housing, Mmr infections, and granuloma extraction Adult 5- to 10-month-old female AB wild-type zebrafish (Danio rerio) were used in the experiments. The fish were housed in flow-through water-circulation systems with a 14- hour/10-hour light/dark cycle. For zebrafish infections, M. marinum ATCC927 carrying the pTEC27 plasmid that expresses the tdTomato fluorescent protein, Addgene plasmid no. 30182 (Addgene, Massachusetts, USA) was cultured in the Middlebrook 7H9 medium with ADC enrichment (Fisher Scientific) with 0.2% Tween 80 (Sigma-Aldrich) for 4 days, diluted to an OD600 of 0.07, and cultured for a further 2 days until an OD600 of ~0.4 was reached. The bacteria were harvested by centrifuging for 3 min at 10,000g and then resuspended and diluted in sterile 1× PBS (phosphate-buffered saline) with 0.3 mg/mL of Phenol Red (Sigma-Aldrich). The fish were anesthetized with 0.02% 3-aminobenzoic acid ethyl ester (pH 7.0) (Sigma-Aldrich), and a total of 5 µL of bacterial suspension (63±9 cfu/fish) was injected intraperitoneally with an Omnican 100 30 G insulin needle (Braun, Melsungen, Germany). At 8 wpi, 10 zebrafish were euthanized with 0.04% 3-aminobenzoic acid ethyl ester (pH 7.0) (Sigma-Aldrich). Red fluorescent mycobacterial granulomas were carefully dissected from the zebrafish ovaries under a stereomicroscope and the NightSea light with a 600-nm filter (Electron Microscopy Science, Massachusetts, USA) using sharp forceps. Ten granulomas were collected per tube, frozen on dry ice, and stored at −80°C until preparation for proteomics. Extraction of mycobacterial proteins and LC-MS/MS identification Extraction of proteins from mycobacterial granulomas for on-bead aggregation/digestion was conducted as follows. The granulomas in 10 replicates (each with 10 individual granulomas) were mixed with 150 µL of 0.1% RapiGest in 50 mM (wt/vol) in Tris-HCl (pH 8.0) and transferred into FastPrep-24 (MP Biomedicals, California, USA) tubes with six ceramic beads. Mycobacterial granulomas with beads were subjected to mechanistic beating with the speed set at level 6 for three cycles (30 s each) in a FastPrep-24 (MP Biomedicals) with cooling on ice between the pulses to soften/disrupt the granulomas without homogenizing the mycobacterial biofilms. Then, 150 µL of 0.4% RapiGest (wt/vol) was added onto the softened granulomas, and the suspensions were incubated at RT for 2 hours with frequent mixing. Proteins solubilized into RapiGest were separated from the beads by centrifugation (16,000g, 5 min at 20°C), and the protein concentration was measured with NanoDrop 2000/2000c spectrophotometers (Thermo Fisher Scientific, Vantaa, Finland). Protein samples were sent to the microparticle-assisted sample preparation prior to label-free quantification (LFQ) identifications using the recently reported method (22) with the following modifications. Briefly, acetonitrile at 70% (vol/vol) was used to aggregate proteins in RapiGest and 10 µL of MAgReSyn Amine beads (20 mg/mL; ReSyn Biosciences, Gauteng, South Africa) to bind the protein aggregates. For on-bead digestion, 50 mM of Tris-HCL (pH 8.0) was added to the beads, and the proteins were reduced with 10 mM DTT for 30 min at 37°C, alkylated with 20 mM iodoacetamide for 30 min at RT in the dark and quenched with 20 mM DTT. Trypsin/Lys-C Mix (mass-spec grade; Promega) was added to each sample at a 25:1 protein:protease ratio (wt/wt). The samples were gently mixed and incubated overnight at 37°C. The beads were separated by magnet; the supernatants with the released peptides were transferred into new tubes and acidified with 0.6% trifluoroacetic acid (TFA) (vol/vol); and the peptides were desalted using C18 StageTips. Peptides were analyzed using the nanoElute nanoflow ultrahigh pressure LC system combined with timsTOF fleX mass spectrometer using CaptiveSpray nanoelectrospray ionization with analysis parameters as described above. Mass spectrometry data analysis Raw MS files generated from both the in vitro and ex vivo proteomic approaches were searched with the MaxQuant software (version 2.0.1.0 for in vitro data, v.1.6.1.0 for ex vivo data) (23, 24) using the UniProt Mmr database (in vitro data) or a database composed of both zebrafish (D. rerio, Proteome ID: UP000000437, 25,707 proteins, https://www.uniprot.org/proteomes/UP000000437) and Mmr (Proteome ID: UP000001190, 5,418 proteins, https://www.uniprot.org/proteomes/UP000001190) protein sequences (ex vivo data). Carbamidomethyl (C) was set as a fixed modification, while methionine oxidation and protein N-terminal acetylation were set as a variable modification. The first search peptide tolerance of 20 ppm and main search peptide tolerance of 10 ppm were used. Trypsin without the proline restriction enzyme option was used, with two allowed miscleavages. The minimal unique + razor peptide number was set to 1, and the false discovery rate (FDR) was set to 0.01 (1%) for peptide and protein identification. Generation of reversed sequences was selected to assign the FDR. The mass spectrometry proteomics data have been deposited into the ProteomeXchange Consortium via the PRIDE partner repository (25, 26). The mass spectrometry proteomics data have been deposited to the ProteomeXchange Consortium via the PRIDE partner repository with the data set identifier PXD033425 for the in vitro data and PXD039416 for the ex vivo data. Proteome bioinformatics and statistics Protein sequences for all identified proteins were retrieved at the UniProt Knowledgebase (UniProtKB) composed of two sections, UniProtKB/Swiss-Prot and UniProtKB/TrEMBL. To determine the pIs and molecular weights (MWs) of the identified proteins, the protein sequences were submitted to EMBOSS Pepstats (27) analyses at https://www.ebi.ac.uk/Tools/seqstats/emboss_pepstats/. The presence of possible protein secretion motifs (SPI, SPII, TATP, non-classical) for all identified proteins was obtained with SignalP 6.0 (https://services.healthtech.dtu.dk/service.php?SignalP) (28). Helices/TMDs were determined with the TMHMM Server v. 2.0 at https://services.healthtech.dtu.dk/service.php?TMHMM-2.0 (29, 30) for the identified proteins. Perseus v. 2.0.3.1 (24) was used to compare the biotinylated and non-biotinylated LFQ data sets. For pairwise comparisons, a paired t-test and P < 0.05 with a minimum of two valid identifications in at least one of the groups were used to indicate statistically significant LFQ value changes. For indicating proteins with significantly higher abundancies on the Mmr biofilm matrices compared to the planktonic cell surfaces in vitro, we used the recently published LFQ data for statistical comparisons. For multivariate analyses (hierarchical clustering and PCA), the missing values within the LFQ data were replaced by imputed values from the normal distribution (width = 0.3, downshift = 1.8) and then normalized (z-score). Expression and purification of GroEL chaperones The full-length sequences of Mmr GroEL1 and GroEL2 were ordered as synthetic genes with an N-terminal His6-3C-AVI-TEV fusion tag and codon optimized for recombinant expression in E. coli. The construct design allowed the simultaneous production of biotinylated and tag-free forms of the target proteins. The constructs containing the synthetic genes subcloned into pET24a expression vectors were ordered from GeneArt (Regensburg, Germany). Chemically competent E. coli BL21(DE3) cells were transformed with the pET24a plasmids together with a BirA-encoding pACYC84 plasmid to allow the in vivo biotinylation of the AVI-tagged GroEL1 and GroEL2 proteins. The transformed bacteria were grown in LB on a shaker at 37°C overnight under selective pressure with chloramphenicol (34 µg/mL) and kanamycin (30 µg/mL). The following day, cultures were diluted 1:100 in antibiotic-containing LB with 0.5% glucose and cultured at 37°C with shaking at 200 rpm to an OD600 of 0.6. Subsequently, the cultures were induced with 0.5 mM Isopropyl β-D-1-thiogalactopyranoside (IPTG), and 50 µM of biotin was added. The bacteria were then cultured overnight at 18°C at 200 rpm and collected by 30 min centrifugation at 4°C and 4,000g. The cell pellets were resuspended in buffer A (50 mM Tris-HCl pH 8, 500 mM NaCl, 20 mM imidazole, 10% glycerol) with the following additives: 1 mg/mL lysozyme, 0.01 mg/mL DNAse I, 2 mM MgCl2, and protease inhibitors cOmplete EDTA-free protease inhibitor cocktail (Roche, Basel, Switzerland). The cells were lyzed using a microfluidizer device. The cleared supernatants were incubated with QIAGEN Ni-NTA agarose beads on rotation for 2 hours at 4°C to bind the His-tagged proteins. The beads were washed with a lysis buffer, and the His-tagged GroEL1 and GroEL2 proteins were eluted in buffer A supplemented with 500 mM imidazole. The eluted proteins were divided into two aliquots and dialyzed overnight at 4°C against 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20 mM imidazole, and 10% glycerol with simultaneous protease treatment with either His6-3C protease or His6-TEV protease (ratio 1:40) to generate AVI-tagged biotinylated proteins or tag-free proteins, respectively. The dialyzed proteins were subjected to a reverse NiNTA to remove the proteases and uncleaved products using the same buffer conditions as described in the affinity capture step of the target proteins. The proteins were further purified and analyzed by size exclusion chromatography (SEC) columns Superdex 200 10/300 in 50 mM Tris-HCl pH 8, 150 mM NaCl, 10% glycerol, and 1 mM tris(2-carboxyethyl)phosphine (TCEP). The elution fractions with the monodisperse product were pooled, concentrated to 2 mg/mL, aliquoted, flash-frozen in liquid N2, and stored at −80°C. Sybody selections Sybody selections were carried out with the fully synthetic screening platform, as described previously (20, 21). The synthetic library was produced by the Seeger Laboratory in Zurich University and delivered in the form of mRNA. Three different libraries (concave, loop, and convex) differing in the length of the CDR3 loop of the nanobody were used. The biotinylated target protein (GroEL1 or GroEL2) was immobilized, and the selections were carried out in three phases, starting with ribosome display and followed by two rounds of phage display. In the second round of phage display, the low-affinity binders were washed off with a competition buffer containing the target protein at 5 µM. The progress of the selections was followed by quantitative PCR. A biotinylated maltose-binding protein was used as the negative control to assess the enrichment of binders after each phage display round. ELISA After the three selection rounds, the sybody sequences were FX-cloned into expression vectors to produce His-myc-tagged sybodies. Per library, 94 clones were selected and produced in the periplasm of E. coli MC1061 F-. For the enzyme-linked immunosorbent assay (ELISA), the sybodies were first immobilized via Protein A + anti-Myc antibody, after which 50 nM of biotinylated GroEL1 or GroEL2 protein was added. Unspecific mannose-binding protein (MBP) was used as a negative control. The level of binding was quantified with streptavidin-horse radish peroxidase (HRP) and 3,3',5, 5' - tetramethylbenzidine (TMB) in 50 mM Na2HPO4, 25 mM citric acid, and 0.006% H2O2. After each incubation step, three washes were performed in Tris-buffered saline (TBS) buffer (20 mM Tris, 150 mM NaCl, pH 7.4) with 0.5% bovine serum albumin (BSA) and 0.05% Tween 20. For each target, we sequenced 36 clones with a signal at least 30% above the background. We included only clones with unambiguous and unique sequences for further characterization. Medium-scale expression of sybodies and characterization with size exclusion chromatography E. coli MC1061 F- cells (Lucigen, Wisconsin, USA) with unique sybody clones were cultured in separate flasks in 50 mL of TB medium with 34 µg/mL chloramphenicol at 160 rpm at 37°C. On reaching an OD600 of 0.4–0.8, the temperature was reduced to 22°C, and the expression was induced with 0.02% (wt/vol) L-arabinose. After induction, the cells were cultured overnight at 160 rpm and 22°C. The periplasmic extracts were prepared using a sucrose osmotic shock, and the sybodies were purified with QIAGEN Ni-NTA resin in a TBS buffer. GroEL2 sybodies were further purified and analyzed by SEC using an SRT10C-100 column (Sepax Technologies, Delaware, USA). The ideal monomeric sybodies eluted at 11–12.5 mL. After purification with Ni-NTA resin, the GroEL1 sybodies were desalted using a PD Minitrap column and analyzed by analytical SEC with an SRT SEC-100 column (Sepax Technologies). With this column, the ideal monomeric sybodies eluted at 7–8 mL. Monomeric sybodies were chosen for further characterization. Affinity measurements with bio-layer interpherometry (BLI) using an Octet RED96 system For the GroEL2 nanobodies, high-precision Streptavidin (SAX) probes were pre-equilibrated in an assay buffer: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.5% BSA, and 0.05% Tween 20. The baseline was measured for 180 s followed by 200 s of coating with biotinylated GroEL protein at 5 µg/mL. The probes were then incubated with clones of sybodies at 200 nM for 500 s followed by 800 s of dissociation time. The approximate affinities (K D ) were determined based on single concentration measurements of on and off rates. The measurements were carried out at 22°C. Data were reference-subtracted and aligned with each other in the Octet Data Analysis software v10.0 (FortéBio, California, USA) using a 1:1 binding model. For GroEL1, the protocol was the same except that penta-anti-His probes were used, and the sybodies were immobilized. Sybody-binding assays Western blot–based detection of sybody binding to cultured Mmr biofilms One-week-old Mmr biofilm cultures (100 µL) were pelleted and washed once with 200 µL of TBS with 0.5% BSA (wt/vol) (TBS-BSA). The biofilms were incubated for 30 min at 28°C with 0.1, 1, or 5 µg of Myc-His-tagged GroEL1 sybodies or 1 or 5 µg of Myc-His-tagged GroEL2 sybodies in TBS-BSA or with 1 or 5 µg of MBP-sybody as a negative control. The pellets were washed three times with 200 µL of TBS-BSA and resuspended in 100 µL of TBS. Four-times concentrated protein-loading buffer (Licor, Nebraska, USA) without reducing agents (DTT or 2-mercaptoethanol) was added to the samples that were boiled for 20 min at +95°C. The heat-denatured proteins were separated in a 12% Tris-Glycine SDS-PAGE, transferred onto nitrocellulose membranes that were then blocked with TBS supplemented with 0.05% Tween (vol/vol) and 1% BSA (TBSTB) (wt/vol) overnight at +4°C. The blots were then incubated for 2 hours at RT with either a monoclonal mouse anti-His-tag antibody (Merck, Darmstadt, Germany) for GroEL1 sybody experiments or a monoclonal mouse anti-c-Myc antibody (Merck) for GroEL2 sybody experiments, using both antibodies at a dilution of 1:5,000 in TBSTB. The blots were washed three times with TBS-containing 0.2% Tween (vol/vol) (TBST), incubated for 1 hour at RT with 15,000-times diluted IRDye 800CW Donkey anti-Mouse IgG secondary antibody (Licor), washed again three times with TBST, and imaged using the Odyssey DLx fluorescence imager (Licor). Mmr infections of adult zebrafish and collecting granulomas Mmr with tomato fluorescence pTEC27 plasmid was used in the granuloma experiments in zebrafish. pTEC27 was a gift from Lalita Ramakrishnan (Addgene plasmid no. 30182). The bacterial culturing and intraperitoneal injections were performed as described earlier (18) except 75 µg/mL of hygromycin was used as a selection marker for the Mmr strain including pTEC27 plasmid. The infection dose was 75 cfu. Granulomas were collected at 8 wpi utilizing the red fluorescence signal from Mmr and a NightSea lamp with an emission filter of 600 nm (Electron Microscopy Science, Pennsylvania, USA) and stored at −80°C. Imaging sybody binding against GroEL in mycobacterial biofilms in vitro One- and two-week-old Mmr and Mtb in vitro biofilms were used to study GroEL1 and GroEL2 sybody binding on intact biofilms. Biofilm mass was collected by centrifuging for 3 min at 2,000g and washed three times with PBS. The samples were then blocked with 2% BSA (Sigma-Aldrich) in PBS at RT for 30–60 min. The biofilms were incubated with myc-tagged sybody against GroEL1 or GroEL2 in 0.1% BSA in PBS at RT for 1.5 hours. After sybody incubation, the samples were washed twice with 2% BSA in PBS and incubated with 5 µg/mL of myc tag monoclonal antibody (myc.A7) Dylight 488 (Invitrogen) in 2% BSA in PBS at 4°C for 30–60 min. The antibody solution was removed, and the samples were washed twice with PBS and once with H2O. The biofilm samples were transferred onto microscopy slides, and excess liquid was carefully removed before the samples were mounted with ProLong Diamond Antifade Mountant with DAPI (Invitrogen) and covered with a high-precision cover slide. The imaging was performed using a Nikon A1R+ confocal microscope with a 60× oil immersion objective. Imaging sybody binding against GroEL of ex vivo granulomas Granuloma samples were first blocked with 2% BSA in PBS at room temperature for 1.5 hours and then stained with 100 μg/mL of nanobody in 0.1% BSA in PBS for 4 days at 4°C. To label the sybodies for granuloma staining, the sybodies were incubated with Alexa Fluor 488 NHS-label (Invitrogen) in 1:2 molar excess of the dye in PBS at room temperature for 1 hour with gentle agitation. Ten milligram per milliliter of glycine was added after the staining step to end the reaction, and unbound dye was removed with dialysis in PBS. After staining, the unbound sybody was removed by washing twice with PBS and once with H2O. The samples were mounted with ProLong Diamond Antifade Mountant with DAPI (Invitrogen) and imaged using a Nikon A1R+ confocal microscope. In all cases, a full z-stack was acquired with equal laser power and photomultiplier voltage across all samples. The maximum intensity projections of the acquired z-stacks were created and analyzed for fluorescence intensity comparisons. RESULTS Biotinylated proteins were successfully captured from the intact Mmr biofilms The workflow illustrated in Fig. 1 outlines the steps used to capture the most accessible biofilm proteins produced by Mmr in vitro and in vivo and to generate sybodies that bind selected proteins within the mycobacterial biofilms both in vitro and in granulomas. First, proteins on intact Mmr biofilms were subjected to biotinylation with cell-impermeable sulfo-NHS-LC-biotin, streptavidin affinity purification, and LC-MS/MS to identify proteins accessible as targets for sybodies. The biotinylation of the biofilm proteins was conducted in conditions that keep Mmr cells intact (11) using non-biotinylated biofilms as negative controls. When membrane-impermeable sulfo-NHS-LC-biotin labeling is applied to intact biofilms, the biotin label becomes attached to the externally available free amino groups on the exposed proteins. The deeper the protein is localized, the less likely it is to become labeled. Hence, when pulled down with streptavidin beads, the collected protein pool is enriched with surface-exposed proteins. As negative controls, the non-biotinylated control samples were not treated with sulfo-NHS-LC-biotin but were lyzed similarly to the biotinylated sample and the proteins were pulled down with streptavidin beads in separate tubes. The streptavidin pull-down from the non-biotinylated samples shows the level of non-specific binding to the streptavidin beads/tube and the endogenously biotinylated proteins. Hence, if a certain protein was also pulled down in the non-biotinylated sample to the same extent as in the surface-biotinylated sample type, it was removed from the hit list, as its presence in the sample was likely to be due to non-specific binding. Proteins that were more abundant in the pull-down were identified as likely surface-exposed proteins. Table S1 lists all the proteins identified from the biotinylated and non-biotinylated biofilms. In total, 3,080 and 1,257 proteins were detected in at least two out of the three biological replicate samples from the biotinylated and non-biotinylated biofilms, respectively (Table S1). Then, both identification data sets were compared using label-free quantification (LFQ), which indicated ca. three to five times higher intensity values (P < 0.05) for inherently biotinylated proteins, such as biotin synthase (catalyzing the conversion of dethiobiotin to biotin, BIOB_MYCMM) and biotin-dependent carboxylase (A0A2Z5Y992_MYCMR) after biotinylation, which confirms that adequate protein biotinylation efficiency was obtained under the conditions used (Table S2). In addition, the highest raw intensity values within non-biotinylated samples were obtained for one of the naturally biotinylated proteins, a biotin carboxyl carrier protein (B2HDZ3_MYCMM), further validating the streptavidin-based purification strategy used in this study. A principal component analysis (PCA) (PC1 explaining 71% of the total variance and PC2 12.4%) on the LFQ data indicated the biotinylated proteomes clustering closely together and being clearly separated from those associated with the non-biotinylated data. The heatmap shown in Fig. 2B indicates higher protein abundances for most of the matrix-associated proteins in comparison to their non-biotinylated counterparts, further confirming that the proteins exposed at the biofilm surface were successfully biotinylated, captured, and identified. Fig 1 The panel shows the general workflow of the study. The promising targets on the biofilm surface were identified by surface biotinylation of intact biofilms followed by lysis, protein extraction, and proteomic analysis. Mmr lesions, called granulomas, were collected from zebrafish, of which the total soluble proteome was determined to identify the surface hits also present in infected lesions. Two selected target proteins were purified and used as targets in a screen utilizing sybody libraries. Selected sybodies were subjected to binding tests on intact biofilms and analyzed by Western blotting and microscopy. CFM, confocal microscopy. Fig 2 Multivariate analyses on the non-biotinylated and biotinylated LFQ data, and Venn diagram comparing the number of Mmr proteins detected in vitro and ex vivo. (A) PCA plot based on the imputed and normalized LFQ data. Red and blue indicate the proteomes of three independent replica samples in the in vitro biotinylation experiment. (B) Hierarchical clustering of the biotinylated (Biot_1-3) and non-biotinylated (Non-biot_1-3) proteins (Distance = Euclidean; Linkage = Average) within each of the three biological replica samples. The black arrow refers to proteins significantly more abundant within the biotinylated protein samples (paired t-test and P < 0.05 with minimum two valid values in at least one of the groups). (C) Venn diagram comparing the number of biofilm matrix–associated proteins identified using in vitro and ex vivo proteomics approaches. Biotinylation proteomics with n = 448 corresponds to proteins showing statistically higher abundances compared to their non-biotinylated counterparts. Cell surface–shaving proteomics with n = 1034 corresponds to the number of the biofilm matrix proteins identified as significantly more abundant in comparison to their counterparts on planktonic cells (data from reference [10] ). Ex vivo proteomics with n = 91 refers to the number of mycobacterial proteins present in granulomas. One hundred sixty proteins are more abundant during biofilm than planktonic growth mode Next, all identified proteins from the biotinylated and non-biotinylated identification data sets were quantitatively compared to indicate statistically significant protein abundance changes. Table S2 lists 448 proteins with significant abundance change (t-test, P < 0.05) and with predicted secretion motifs and/or subcellular location [TMHMM, isoelectric point (pI), SignalP 6.0]. Among these proteins, only 9 harbor a signal peptide (SPI or SPII type) directing the protein to the cell wall/exterior. Six of these are potential lipoproteins (presence of lipobox), while one is equipped with 12 transmembrane domains (TMDs) anchoring the protein to the mycomembrane. From all 448 proteins, 19 proteins have 2–14 TMDs, indicating their likely location in the mycomembrane. Majority of the identified proteins (n = 420) detected without TMDs or classical secretion motifs have been listed in the MoonProt database as proteins with moonlighting functions (31), suggesting that these proteins have entered the biofilm matrix via non-classical routes. Altogether, 432 proteins show ≥1.5 times higher abundance compared to their non-biotinylated counterparts (Table S2) and are considered potential surface-exposed targets on mycobacterial biofilms. Then, we wished to investigate whether the identified proteins enriched on the biofilms (containing both the pellicle- and submerged-type biofilms) are more abundant during the biofilm mode of growth in comparison to planktonic growth. For this purpose, we used the LFQ identification data reported recently for the same Mmr strain grown in planktonic and biofilm forms (11). The LFQ data obtained by cell surface tryptic shaving included the identifications from both the planktonic cell surfaces after 4 days of growth and from pellicle- and submerged-type biofilms after 4 weeks of growth at +28°C. Table S3 lists 904 proteins with significantly higher abundance increase (unpaired t-test, P < 0.05) on both the pellicle- and/or submerged-type biofilms in comparison to the same proteins on the planktonic cell surfaces. The Venn diagram in Fig. 2C, comparing the number of these identifications with those obtained by the biotinylation proteomics in this study, indicated that ca. 20% of the proteins (n = 158) could be detected by both the tryptic in vitro–shaving proteomics and by the proteomic approach used in this study (Table S4). Thus, we suggest that these shared proteins are more abundant on the biofilm matrices compared to their counterparts on planktonic cells and therefore could include potential candidates for developing biofilm-targeting nanobodies. GroEL paralogs were among the most abundant proteins in vitro and ex vivo The top 20 proteins with significantly higher abundances on the biotinylated biofilms and with the highest raw intensity values in comparison to their non-biotinylated counterparts are shown in Fig. 5. All 20 proteins are predicted to have moonlighting functions, as indicated by the MoonProt 3.0 database (31). Computational predictions (SignalP 6.0) indicated that these proteins use a yet-unknown mechanism to reach the biofilm matrix. All top 20 proteins had at least one ortholog in Mtb. The molecular chaperone GroEL2 (A0A117DW44_9MYCO) was detected with the highest raw intensity values from the biofilm matrix. GroEL1 (B2HD10_MYCMM), a paralog of GroEL2, was also identified among the top eight proteins with high-intensity values. Both chaperones also displayed statistically significant abundance differences after biotinylation: GroEL1 with eight times and GroEL2 with four times higher LFQ values (t-test, P < 0.05) compared with those chaperones without biotinylation (Table S1). To complement/confirm these proteomic results, we also performed ex vivo proteomics on granulomas dissected from Mmr-infected adult zebrafish at 8-week postinfection (wpi). Since the surface biotinylation proteomic strategy could not be performed on homogenized granulomas, likely due to free amines (released from tissues) inactivating the NHS-biotin (data not shown), we used a global proteomic approach instead. To this end, proteins were extracted from pooled granuloma samples (in total 10 replicate samples and each with 10 granulomas) under conditions preventing cell disruption as much as possible but promoting the solubilization of the mycobacterial proteins present either on the biofilm matrices or released into the granuloma environment. As there are no protocols to distinguish or remove planktonic bacteria from a complex biological sample, we cannot exclude the possibility that some of the detected mycobacterial proteins might have originated from planktonic cell surfaces. Table S5 lists 91 mycobacterial proteins that were detected in granulomas ex vivo with the aid of protein aggregation capture on microparticles (PACM) sample preparation and LC-MS/MS. Fig. 6 shows the top 30 mycobacterial proteins detected ex vivo with the highest raw intensity values. Again, GroEL2 was detected with the highest intensity values from each of the 10 replica granuloma samples, while its paralog, GroEL1, was identified from 9 out of the 10 replicates with lower raw intensity values. Fig. 2 indicates that 49 proteins could be commonly identified by biotinylation and ex vivo proteomics. The list of these proteins is presented in Table 1. Altogether, 33 proteins were shared by both in vitro biofilm surface proteomes obtained by the biotinylation and surface-shaving proteomics (Table S4). The data obtained on GroEL1 and GroEL2 within the in vitro biofilm proteome identified by the shaving proteomics indicate that the abundance of GroEL2 is increased by ca. four times (t-test, P < 0.05) on the 4-week-old biofilms, but GroEL1, while detected with reasonably high LFQ values on the biofilm matrices at this time point, was slightly less abundant on the biofilms in comparison to the planktonic cell surfaces (Table S3). However, GroEL1 was detected as ca. two times (t-test, P < 0.05) more abundant on the 2-day-old and 1-week-old biofilm matrices compared to this chaperone on the planktonic cells (Table S3), which is in line with the earlier report indicating that GroEL1 is needed for the biofilm formation in mycobacteria (32). Thus, these findings imply the suitability of both GroEL2 and GroEL1 as promising targets for sybody binding. TABLE 1 Condensed results from the sybody screenings against Mmr GroEL1 and GroEL2 Sybody library against GroEL1 Enrichment in phage display 1 Enrichment phage display 2 No. of ELISA hits 1.3-fold above negative control No. of unique binders (total sequenced) No. of well-behaved binders in SEC and BLI (total analyzed) No. of binders to intact biofilms (total tested) Concave 2.2 1,109 11 (94) 9 (12 a ) 5 (9) 0 (3) Loop 1.9 223 7 (94) 4 (6 a ) 3 (4) 1 (2) Convex 6 5,288 18 (94) 13 (18) 3 (15) 1 (2) Sybody library against GroEL2 Enrichment in phage display 1 Enrichment in phage display 2 No. of ELISA hits two fold above negative control No. of unique binders (total sequenced) No. of well-behaved binders in SEC and BLI (total analyzed) No. of binders to intact biofilms (total tested) Concave 0.7 8.6 16 (94) 3 (3) 3 (3) 1 (3) Loop 1.7 7.6 31 (94) 26 (33) 13 (15) 3 (13) a One of the ELISA hits on the loop library turned out to be from the concave library. Selected sybodies produced against GroEL1 and GroEL2 bind intact in vitro biofilms We selected GroEL2 as the primary target for testing the sybody binding since this chaperone was present both on the in vitro and ex vivo biofilms with the highest raw intensity values. We also generated sybodies against GroEL1 as this chaperone, although detected here with somewhat lower raw intensity values, contributes to the biofilm formation in mycobacteria (32) and is more abundantly produced during the first 2 weeks of biofilm growth. In addition, both have functional orthologs in Mtb, and the protein structure of Mtb orthologs produced in Escherichia coli has been previously determined (33, 34), demonstrating that the expression and purification of these chaperones in E. coli is feasible. The recombinant GroEL1 and GroEL2 of Mmr were expressed and purified from E. coli in biotinylated and non-biotinylated forms. The purity, biotinylation, monodispersity, and stability of the proteins were assessed with SDS-PAGE, tamavidin shift assay, size exclusion chromatography (SEC), and nano differential scanning fluorimetry (nanoDSF), respectively (Fig. S1). The purified proteins were analyzed by mass spectrometry to verify their identity (Fig. S2) and were used as targets in the sybody screening platform developed in the Seeger Laboratory, as described in the literature (20, 21). Briefly, this platform allows the in vitro selection of binders from a randomized library of 1012 sybodies using ribosome display combined with two rounds of phage display. The main results of these screens are condensed in Table 1. We identified 26 and 29 unique binders against GroEL1 and GroEL2, respectively. Subsequent characterization included SEC and affinity measurements by bio-layer interferometry (BLI) on purified target proteins (results collated in Table 1). Based on the SEC data, only monomeric sybody clones with low-to-moderate column interactions were selected. Following the BLI measurements, sybody clones with a K D value below 1 µM were considered as hits. The approximate affinities to the purified target protein as determined in the BLI measurements can be found in Table 2. These criteria led to a final list of 7 and 16 GroEL1 and GroEL2 sybody clones, respectively. TABLE 2 Characteristics of GroEL1 and GroEL2 sybodies Target Sybody number Molecular weight (Dalton) Size exclusion chromatography profile Approximate KD to purified target (nM) Binding to Mmr biofilms Protein sequence GroEL1 1 15,767 Monomeric 130 No QVQLVESGGGLVQAGGSLRLSCAASGFPVEQRQMYWYR QAPGKEREWVAAIQSYGKRTKYADSVKGRFTISRDNAKN TVYLQMNSLKPEDTAVYYCVVYVGGGYKGQGTQVTVSA GRAGEQKLISEEDLNSAVDHHHHHH GroEL1 5 15,648 Monomeric 127 No QVQLVESGGGLVQAGGSLRLSCAASGFPVEHKQMRWYR QAPGKEREWVAAIESSGQYTIYADSVKGRFTISRDNAKNT VYLQMNSLKPEDTAVYYCFVGVGAGYYGQGTQVTVSAG RAGEQKLISEEDLNSAVDHHHHHH GroEL1 9 15,522 Monomeric 64 No QVQLVESGGGLVQAGGSLRLSCAASGLPVWQQGMTWY RQAPGKEREWVAAIDSVGAQTYYADSVKGRFTISRDNAK NTVYLQMNSLKPEDTAVYYCAVNVGARYIGQGTQVTVSA GRAGEQKLISEEDLNSAVDHHHHHH GroEL1 12 16,539 Monomeric 14 NA a QVQLVESGGGLVQAGGSLRLSCAASGFPVTQAWMEWY RQAPGKEREWVAAIFSHGGGTFYADSVKGRFTISRDNAK NTVYLQMNSLKPEDTAVYYCNVKDTGERDNWYDYWGQ GTQVTVSAGRAGEQKLISEEDLNSAVDHHHHHH GroEL1 14 16,404 Mostly Monomeric/sticky 31 Yes QVQLVESGGGLVQAGGSLRLSCAASGFPVXNAYMHWY RQAPGKEREWVAAILSSGAHTLYADSVKGRFTISRDNAK NTVYLQMNSLKPEDTAVYYCNVKDYGAGVRYYDYWG QGTQVTVSAGRAGEQKLISEEDLNSAVDHHHHHH GroEL1 18 16,520 Monomeric 22 No QVQLVESGGGLVQAGGSLRLSCAASGFPVKTKHMYWYR QAPGKEREWVAAITSIGMITAYADSVKGRFTISRDNAKNT VYLQMNSLKPEDTAVYYCNVKDWGTNRQAYDYWGQGT QVTVSAGRAGEQKLISEEDLNSAVDHHHHHH GroEL1 31 17,198 Monomeric 92 Yes QVQLVESGGGSVQAGGSLRLSCAASGTIYKIYYLGWFRQ APGKEREGVAALNTFSGGTYYADSVKGRFTVSLDNAKN TVYLQMNSLKPEDTALYYCAAAYDMEGYAWPLYWWH YEYWGQGTQVTVSAGRAGEQKLISEEDLNSAVDHHHH HH GroEL2 1 15,395 Monomeric 591 No QVQLVESGGGLVQAGGSLRLSCAASGFPVAITYMHWYR QAPGKEREWVAAISSTGKTTWYADSVKGRFTISRDNAKN TVYLQMNSLKPEDTAVYYCLVEVGHYYKGQGTQVTVSAG RAGEQKLISEEDLNSAVDHHHHHH* GroEL2 2 15,087 Monomeric 157 No QVQLVESGGGLVQAGGSLRLSCAASGFPVSSSTMTWYR QAPGKEREWVAAIDSVGNETYYADSVKGRFTISRDNAKN TVYLQMNSLKPEDTAVYYCAVFVGSYYGQGTQVTVSAGR AGEQKLISEEDLNSAVDHHHHHH GroEL2 3 15,554 Monomeric 18 Yes QVQLVESGGGLVQAGGSLRLSCAASGFPVAYWEMVWY RQAPGKEREWVAAIRSTGWKTVYADSVKGRFTISRDNA KNTVYLQMNSLKPEDTAVYYCTAVYVGVHYKGQGTQV TVSAGRAGEQKLISEEDLNSAVDHHHHHH GroEL2 7 16,345 Monomeric 100 No QVQLVESGGGLVQAGGSLRLSCAASGFPVNDAWMYWY RQAPGKEREWVAAIMSMGFGTWYADSVKGRFTISRDNA KNTVYLQMNSLKPEDTAVYYCNVKDRGKEHFSYDYWGQ GTQVTVSAGRAGEQKLISEEDLNSAVDHHHHHH GroEL2 8 16,234 Monomeric 13 Yes QVQLVESGGGLVQAGGSLRLSCAASGFPVYMSWMYW YRQAPGKEREWVAAIMSEGAGTWYADSVKGRFTISRD NAKNTVYLQMNSLKPEDTAVYYCNVKDTGSFHAQYDY WGQGTQVTVSAGRAGEQKLISEEDLNSAVDHHHHHH GroEL2 9 16,333 Monomeric 277 Yes QVQLVESGGGLVQAGGSLRLSCAASGFPVYQSWMYWY RQAPGKEREWVAAIMSDGSGTWYADSVKGRFTISRDN AKNTVYLQMNSLKPEDTAVYYCNVKDFGHSRSRYDYW GQGTQVTVSAGRAGEQKLISEEDLNSAVDHHHHHH GroEL2 10 16,343 Monomeric 193 Yes QVQLVESGGGLVQAGGSLRLSCAASGFPVKHWYMHW YRQAPGKEREWVAAIQSTGSYTAYADSVKGRFTISRDN AKNTVYLQMNSLKPEDTAVYYCNVKEYGFYHASYDYW GQGTQVTVSAGRAGEQKLISEEDLNSAVDHHHHHH GroEL2 11 16,259 Monomeric 271 No QVQLVESGGGLVQAGGSLRLSCAASGFPVDSAYMWWY RQAPGKEREWVAAIESNGEYTFYADSVKGRFTISRDNAKN TVYLQMNSLKPEDTAVYYCNVKDTGAHHSYYDYWGQGT QVTVSAGRAGEQKLISEEDLNSAVDHHHHHH GroEL2 16 16,232 Monomeric 15 No QVQLVESGGGLVQAGGSLRLSCAASGFPVSSSTMTWYR QAPGKEREWVAAIESWGAYTWYADSVKGRFTISRDNAK NTVYLQMNSLKPEDTAVYYCNVKDYDGVADVIYDYWGQ GTQVTVSAGRAGEQKLISEEDLNSAVDHHHHHH GroEL2 19 16,311 Monomeric 366 No QVQLVESGGGLVQAGGSLRLSCAASGFPVEWLEMAWYR QAPGKEREWVAAIYSYGMETEYADSVKGRFTISRDNAKN TVYLQMNSLKPEDTAVYYCNVKDGGHAAWWYDYWGQ GTQVTVSAGRAGEQKLISEEDLNSAVDHHHHHH GroEL2 22 16,211 Monomeric 507 No QVQLVESGGGLVQAGGSLRLSCAASGFPVYHSWMYWYR QAPGKEREWVAAIMSDGHGTWYADSVKGRFTISRDNAK NTVYLQMNSLKPEDTAVYYCNVKDTGSSTTIYDYWGQGT QVTVSAGRAGEQKLISEEDLNSAVDHHHHHH GroEL2 27 16,250 Monomeric 101 No QVQLVESGGGLVQAGGSLRLSCAASGFPVWKAYMWWY RQAPGKEREWVAAIESNGAYTFYADSVKGRFTISRDNAK NTVYLQMNSLKPEDTAVYYCNVKDTGSDSENYDYWGQG TQVTVSAGRAGEQKLISEEDLNSAVDHHHHHH GroEL2 28 16,134 Monomeric 35 No QVQLVESGGGLVQAGGSLRLSCAASGFPVDAYWMYWY RQAPGKEREWVAAIMSSGHGTWYADSVKGRFTISRDNA KNTVYLQMNSLKPEDTAVYSCNVKDKGAQAAWYDYWG QGTQVTVSAGRAGEQKLISEEDLNSAVDHHHHHH GroEL2 31 16,488 Monomeric 66 No QVQLVESGGGLVQAGGSLRLSCAASGFPVWMEWMYW YRQAPGKEREWVAAIMSEGDGTWYADSVKGRFTISRDN AKNTVYLQMNSLKPEDTAVYYCNVKDFGYNNNYYDYWG QGTQVTVSAGRAGEQKLISEEDLNSAVDHHHHHH GroEL2 32 16,078 Monomeric 153 No QVQLVESGGGLVQAGGSLRLSCAASGFPVVSQFMEWHR QAPGKEREWVAAIDSTGYSTFYADSVKGRFTISRDNAKNT VYLQMNSLKPEDTAVYYCNVKDAGEGQEQYDYWGQGT QVTVSAGRAGEQKLISEEDLNSAVDHHHHHH GroEL2 33 16,356 Monomeric 244 No QVQLVESGGGLVQAGGSLRLSCAASGFPVYQHWMYWY RQAPGKEREWVAAIMSQGAGTWYADSVRGRFTISRDNA KNTVYLQMNSLKPEDTAVYYCNVKDLGKAEYNYDYWGQ GTQVTVSAGRAGEQKLISEEDLNSAVDHHHHHH a NA, not applicable. We then tested the capacity for each clone to recognize respective epitopes on intact cultured Mmr biofilms. In the first instance, this involved the co-incubation of 1 or 5 µg of myc-His-tagged sybodies with intact Mmr biofilms. In this intact sample type, the sybody would only be able to bind if the target was surface-exposed. Unbound sybodies were washed off the biofilm pellets. The pellets with the bound sybodies were analyzed by SDS-PAGE, and the bound sybodies were detected by Western blot using Myc-tag and His-tag antibodies (Fig. 3 and Fig. S3A). Of the seven GroEL1-sybody clones tested, two were detectably binding to the biofilm surface. Of the 16 GroEL2 sybody clones, four showed detectable binding to mycobacterial biofilms. Some of the sybodies (GroEL1_SB31, GroEL2_SB3, GroEL2_SB9) formed additional bands on the gels corresponding to larger proteins than the monomeric 15-kDa sybody. These bands are likely due to possible disulfide bonds mediating sybody–sybody interactions under the non-reducing experimental conditions used. The non-reducing sample buffer preserves existing disulfide bonds leaving multimeric complexes intact on the SDS-PAGE. Similar observations have been made with disulfide-containing milk whey proteins when analyzed without reducing agents (35). Fig 3 Western blots detecting the sybodies (SB) bound onto the surface of Mmr biofilms after co-incubation with His-myc-tagged GroEL1 (A and B) and GroEL2 (C–F) sybodies. Mmr biofilms were incubated with 0.1, 1, or 5 µg of GroEL1 sybodies or 1 or 5 µg of His-GroEL2 sybodies followed by washes of the biofilm pellets, boiling in sample buffer, SDS-PAGE, and detection of the bound sybodies in the sample by Western blot using anti-His (in GroEL1-SB experiments) or anti-myc (in GroEL2-SB experiments) antibodies. In some of the experiments, the first lane (positive control) shows ~50 ng of the sybody directly loaded onto the gel. The negative control (0 µg) lane contains Mmr biofilm without sybodies. Confocal microscopy analysis confirms GroEL1 and GroEL2 sybody binding to in vitro biofilms We next wanted to determine how the sybodies bind mycobacterial biofilms in a natural environment using confocal microscopy. We used Mmr and Mtb biofilms (cultured for 2 or 3 weeks) as targets for the myc-His-tagged GroEL1 and GroEL2 sybodies. We made use of two different staining strategies: one utilizing a fluorescently labeled anti-myc antibody binding to the myc-tagged sybodies on biofilms and another where sybodies were directly labeled with a green fluorophore. No signal was observed in the Mmr biofilms stained with the fluorescent anti-myc antibody alone (Fig. 4A), whereas the addition of the GroEL1 and GroEL2 sybodies induced staining of the biofilm (Fig. 4B and C). Furthermore, we observed low-intensity signals from 2-week-old avirulent Mtb biofilms (Fig. S3B and C). At 3 weeks, we used the fluorescently labeled sybodies (Fig. 4D through F) on cultured Mmr biofilms. At both time points and with both staining strategies, we could see sybodies binding to Mmr biofilms. The green fluorescence signal intensity acquired from maximum intensity projections was significantly different (P < 0.001) between the control and both the GroEL1 and GroEL2 sybody-stained images. GroEL2 sybody samples had a higher fluorescence intensity compared to GroEL1, which is in line with our binding assays (Fig. 3) and proteomic data (Fig. 5 and 6) showing GroEL2 to be a more abundant surface epitope on mycobacterial biofilms. Fig 4 GroEL1 and GroEL2 sybodies bind biofilms in vitro as well as Mmr inside granulomas ex vivo in microscopy experiments. DAPI (cyan) was used as a counterstain for DNA. Mycobacterial biofilms were stained with green fluorescence-labeled sybodies (yellow) (D–F) or with myc-tagged sybodies + green fluorescent anti-myc antibodies (yellow) (B and C) or green fluorescent anti-myc antibody only as a negative control (yellow) (A). In the granuloma experiments (G–I front view, J–L side view), bacteria (purple) expressing a red fluorescent protein were used to allow the extraction of the granulomas. Granulomas were incubated with 100 µg/mL of green fluorescence-labeled GroEL-binding sybodies and imaged with confocal microscopy. All scale bars are 10 µm. Fig 5 List of intact biofilm matrix proteins (Biot_1-3) identified with the highest raw intensity values. NO_SP protein carries no recognizable signal peptide and is predicted to enter the biofilm matrix via non-classical and yet-unknown pathway. Non-Bio_1-3 refer to proteins identified from the intact biofilms without biotinylation. Color gradient indicates the high (yellow) and low (blue) identification raw intensity values for the indicated proteins. Fig 6 List of the Mmr proteins identified with the highest raw intensity values from the mycobacterial granulomas from zebrafish at 8 wpi. Repl_1-10, 10 replica samples with proteins extracted from 10 granulomas in each. Color gradient indicates the high (yellow) and low (blue) identification raw intensity values for the indicated proteins. GroEL1 and GroEL2 are surface-exposed epitopes on the biofilm inside granulomas Subsequently, we aimed to assess whether the sybodies could also bind mycobacterial biofilms in granulomas isolated from zebrafish infected with red fluorescent Mmr. At 8 wpi, granulomas from the ovaries of female zebrafish were dissected based on their bright red fluorescence. The non-permeabilized granulomas were incubated with (green) fluorescent-labeled GroEL1 or GroEL2 sybodies and imaged with confocal microscopy. Fig. 4G through L show representative images of sybody binding into the biofilms in granulomas. In non-capsulated granulomas, the sybodies could stain the entire lesion (Fig. 4H and K; Video S2). In capsulated granulomas, without permeabilization and blood circulation, we could see the sybodies penetrate under the fibrous capsule and stain the adjacent areas of the biofilm (Fig. 4G and J; Video S1). These results show that we have identified GroEL-targeting sybodies that are not only able to bind biofilms in in vitro cultures but are also able to bind biofilms inside granulomas. DISCUSSION Antibiotic-tolerant mycobacterial biofilms were recently shown to be present in TB (8). Such tolerance necessitates prolonged antibiotic treatment and potentially contributes to the development of antibiotic resistance (5). Thus, alternative biofilm-directed treatment modalities that do not rely solely on small molecule antibiotics open exciting horizons for more efficient treatment of TB. Miniature single-domain antibodies, the so-called nanobodies that can be chemically and genetically linked to functional entities, could be used as a part of innovative research and treatment delivery strategies (9, 10). Unbiased omics approaches are useful for the identification of appropriate, abundant mycobacterial targets. Various existing high-quality proteomic data sets have described the total proteome of mycobacterial biofilms (36) and tuberculin (37) as well as a transcriptomic profile of biofilm-forming Mycobacterium bovis (38). An interesting first study from fixed human granuloma samples identified mycobacterial proteins specific to cellular versus caseous areas (39). Also, the surface proteome of planktonic forms of Mycobacterium smegmatis has been probed (40, 41). However, as nanobodies can only reach extracellularly exposed proteins, for the purpose of developing biofilm-binding nanobodies, there is a need to reliably identify abundant surface epitopes present on mycobacterial biofilms. Our laboratory previously published the first time-series experiment characterizing the dynamics of the mycobacterial biofilm matrix proteome (11). In the current study, we took a parallel approach to characterize the surface proteome of mature mycobacterial biofilm using surface biotinylation and streptavidin purification followed by mass spectrometry. We then compared these data with our pre-existing surface-shaving data from planktonic and biofilm Mmr cultures to reliably identify proteins that are specifically enriched on the biofilm surface. Subsequently, we extracted granulomas from Mmr-infected adult zebrafish and studied the mycobacterial proteome at late-stage infection to identify biofilm surface proteins present during infection. Combining the data from the three experimental setups allowed us to identify 33 proteins that are more abundant on the biofilm surface than on planktonic cells and are also highly expressed during the late-stage infection. Cell-impermeable NHS-biotin-based strategies are a commonly used and gentle way of purifying surface-exposed proteins from bacteria (42). This strategy was previously successfully used for studying the surface proteome of planktonic mycobacteria (40, 41). Biotinylation strategies based on chemicals such as the sulfo-NHS-LC-biotin used here are essentially cell impermeable. However, when used in bacteria with a peptidoglycan layer, it is known that they can penetrate the peptidoglycan to some extent, and hence protein epitopes embedded within the cell wall may also be exposed to biotinylation (42). Therefore, follow-up experiments with selected sybodies and intact biofilms are essential for the final verification of the surface availability of the epitopes. Here, surface proteomics revealed cytoplasmic proteins as the main component of the mycobacterial extracellular proteome. This is in line with a number of previous studies reporting cell surface proteomes of different bacterial species grown either as planktonic or biofilm states (11, 42 - 57). Detection of an overwhelming number of cytoplasmic proteins, including the r-proteins, can be explained by the protein identification method used, which favors the identification of cell surface proteins that can be easily assessed by biotinylation and streptavidin capture–based technique. This also explains why the detection of structural proteins remained either below the detection limit or were identified with low-intensity values. These proteins frequently contain highly hydrophobic and complex regions, which often are difficult to identify due to the inherent lack of trypsin cleavage sites within these regions and to the tendency of the hydrophobic peptides to aggregate without solubilizing detergents (58). Growing evidence from different bacterial biofilms has also linked the presence of fibrous proteins, including amyloids or amyloid-like fibers, to a functional/structural role within the biofilm matrix; amyloids have been reported to serve as building blocks and provide mechanical robustness to the biofilm (59, 60). Such proteins have highly ordered beta-sheet-rich filamentous morphology, an ability to interact erroneously and generate insoluble/protease-resistant aggregates/fibrils (61), thereby making these proteins impossible to identify using the proteomic method and conditions used. This is because the identification of such protein structures requires the use of trifluoroacetic acid (TFA) or formic acid (FA) to disperse/solubilize the aggregates/fibrils prior to tryptic digestion and LC-MS/MS (62). Since the proteomic identification method used in this study requires capturing the target proteins in their native form, the use of these solvents during biotinylation would have affected the protein structure. Moreover, TFA or FA are typically used for inactive tryptic digestions, and therefore their application prior to enzymatic treatment is not possible. Thus, instead of or in addition to structural proteins, bacteria may also use exported/released ribosomal proteins (r-proteins) as structural proteins to stabilize and strengthen the biofilm integrity, as demonstrated with Staphylococcus aureus biofilms (44). r-proteins typically form the most dominant protein group at the bacterial cell surfaces ( 45 - 58 - 51 - 57 - 58), which was also demonstrated in this study. Since the identified cytoplasmic proteins do not possess a common mechanism driving their export out of the cells, the widespread opinion is that these proteins are released via a regulated/programmed process as part of the bacterial life cycle, which may involve autolysins, phenol-soluble modulins, phages and/or membrane vesicl es (11, 50, 54 - 63 - 63 ). In addition to their primary function within the bacterial cell, many of these cytoplasmic proteins show a secondary, i.e., moonlighting, function after being exported out of the cells ((31, 44, 64). GroEL is an example of such a protein that after being released out of the cells shows pH-dependent adherence to the biofilm matrix in S. aureus (34). This protein is highly expressed in response to stress to perform its primary chaperone function within the cell, but when present at the cell surface, it can act as an adhesive protein contributing to virulence (31, 43, 63, 64). Although our study provides proteome-wide information on the mycobacterial biofilms and confirms the presence of many cytoplasmic moonlighters on the biofilm matrix, detailed mechanisms underlying protein release onto the biofilm surface were not at the core of this study. Here, chaperone proteins GroEL1 and GroEL2 were both on the list of the top 10 most abundant proteins among the identified biofilm surface proteins. GroEL proteins have been detected within the extracellular fractions of mycobacteria, with an important role in virulence (11, 65, 66) and in biofilm formation (32). In Mtb, GroEL2 was identified as one of the most abundant antigenic proteins on the pellicle-type biofilm cells (67), further supporting its extracellular localization also during infection. This knowledge, along with the fact that there were existing functional protocols for producing these proteins in E. coli (33, 34), made GroEL1 and GroEL2 attractive candidates as the first sybody-binding targets. We characterized dozens of unique sybody clones against GroEL1 and GroEL2 by SEC and BLI. Based on these measurements, we selected only monomeric sybodies with low carbohydrate–binding capacities and with high affinity to the recombinant target protein (K D < 1 µM) for further testing in biofilms. We found 7 GroEL1 and 16 GroEL2 sybodies fulfilling these criteria. Although all the selected sybodies had high affinity to their cognate proteins, only 25% of the sybodies were able to bind to their targets in the context of the biofilm. This shows us that in vitro-determined affinity approximation against the purified target alone is not sufficient for estimating the in-situ binding. This result is expected as in the complex environment of the biofilm, not all epitopes are present/exposed and freely available for binding. Some parts of the target are likely to interact with other components of the matrix, rendering them unavailable for sybody binding. Despite these steric hindrances, we succeeded in finding two and four sybody clones developed against GroEL1 and GroEL2, respectively, that bind biofilms in the natural context. In conclusion, this study provides evidence that biofilm surface proteomics can act as a surrogate to identify surface-exposed epitopes on mycobacterial biofilms. We also show the first data assessing the most abundant mycobacterial proteins in biofilms extracted from Mmr granulomas. The identified proteins can be targeted with nanobodies. Since nanobodies are small and easily functionalized by chemical or genetic linkages, they constitute uniquely applicable tools for innovative clinical research and therapeutic strategies (68, 69). In this study, we developed GroEL1- and GroEL2-binding sybodies that were successfully used for the delivery of fluorophores to intact biofilms in vitro and ex vivo. The platform described here can aid the development of biofilm-targeting research and therapeutic strategies against mycobacterial and other biofilms. Supplementary Material Reviewer comments ACKNOWLEDGMENTS We want to thank Jacob Scheurich, Julia Flock, and Arne Börgel for the practical support at the Protein Expression and Purification Core Facility, EMBL Heidelberg; Stephan Niebling at the Sample Preparation and Characterisation Core Facility at EMBL Hamburg, for the service of carrying out BLI measurements for GroEL2 sybodies; Leslie Pan for help in the setup of the sybody screening platform; Teemu Ihalainen for his advice on planning the microscopy experiments; Hannaleena Piippo for technical assistance in the experiments and laboratory organization; Joel Selkrig and Anna Sueki for discussions on bacterial surface proteomics; and Kerstin Putzker and Peter Sehr for their kind assistance with the equipment at the Chemical Biology Core Facility. The following core facilities are acknowledged for their services and support, which were essential for this work: Protein Expression and Purification Core Facility, EMBL Heidelberg, Proteomics Core Facility at Oslo University Hospital, Zebrafish Core Facility, Tampere University, Proteomics Core Facility EMBL Heidelberg, Sample Preparation and Characterisation Core Facility at EMBL Hamburg, Tampere Imaging Facility. The study was funded by the Academy of Finland: Postdoctoral Fellowship, 338624 (M.M.H.), Clinical Researcher funding 326674 (M.P.), Project funding 322010 (M.P.), Profiling funding 326584 (M.P.) and Project funding 348968 (M.P.); Tampere Tuberculosis Foundation (M.M.H., M.P., H.M.); Jane and Aatos Erkko Foundation (M.P.), Sigrid Jusélius Foundation (M.P.), Biocenter Finland (M.P.), Core Facilities programme of the South-Eastern Norway Regional Health Authority (T.A.N.), and Research Council of Norway INFRASTRUKTUR-programme (295910). M.M.H.: study design and conceptualization, project coordination, funding acquisition, supervision, protein production and purification, in vitro proteomics sample preparation, sybody screening, sybody binding to biofilms method development, manuscript writing. H.L.: in vitro proteomics sample preparation, sample collection, sybody binding tests to biofilms and microscopy, image analysis, manuscript writing. A.S.: sample collection, in vitro proteomics sample preparation, binding tests to in vitro biofilms, binding tests to granulomas. K.R.: construct design and supervision of protein production and purification. K.L.: biophysical characterization of target protein, sybody screening. T.C.: sybody screening. C.L.: supervision of sybody screening. H.M.: sample collection, ex vivo proteomics sample preparation. T.M.: microscopy and image analysis. M.A.S.: conceptualization, supervision on the use of sybody libraries. J.R.: proteomics experiments. T.N.: proteomics supervision, funding acquisition. K.S.: study design and conceptualization, ex vivo proteomics sample preparation, proteomics data analysis, manuscript writing, visualization. M.P.: study design and conceptualization, supervision, funding acquisition. The corresponding author confirms on behalf of all authors that there have been no involvements that might raise the question of bias in the work reported or in the conclusions, implications, or opinions stated. DATA AVAILABILITY The proteomics data sets generated and/or analyzed during the current study are available in the PRIDE repository with data set identifiers PXD033425 and PXD039416 for the in vitro and the ex vivo data, respectively. The other data sets generated during and/or analyzed during the current study and not included in the manuscript are available from the corresponding author on reasonable request. ETHICS APPROVAL All experiments have been accepted by the Animal Experiment Board in Finland (under the Regional State Administrative Agency for Southern Finland) and were carried out in accordance with the EU-directive 2010/63/EU on the protection of animals used for scientific purposes and with the Finnish Act on Animal Experimentation Act 497/2013 and the Government Decree 564/2013. The use of genetically modified micro-organisms is done following the Finnish Genetic Engineering Law 377/1995, under the permission of Valvira. SUPPLEMENTAL MATERIAL The following material is available online at https://doi.org/10.1128/msystems.01073-22. 10.1128/msystems.01073-22.SuF1 Table S1 msystems.01073-22-s0001.pdf All identified proteins captured by streptavidin from the biotinylated and non-biotinylated intact and lysed biofilms. Secretory/subcellular location for each protein was predicted using EMBOSS Pepstats (pI, Mw, protein length), SignalP 6.0 (Moonlighters, T7SS, TAT, SecI-III), TMHMM (no. transmembrane domains). Protein sequences for each protein were retrieved from UniProt (https://www.uniprot.org/uploadlists/) with the aid of the UniProt IDs. IDs regarding GroEL1 and GroEL2 are indicated with bold letters and shaded in red. Cells in raw intensity value-associated columns shaded in grey indicate proteins that were not detected or were detected in only one of the replicate samples. Click here for additional data file. 10.1128/msystems.01073-22.SuF2 Table S2 msystems.01073-22-s0002.pdf List of proteins (n, 448) with significant higher abundancies after biotinylation (cells in intense red) and with predicted molecular weights, pI values, sequence lengths, and secretory motifs/subcellular location. Naturally biotinylated example proteins are in bold letter and shaded in grey. Click here for additional data file. 10.1128/msystems.01073-22.SuF3 Table S3 msystems.01073-22-s0003.pdf List of proteins (n, 904) with significantly higher abundancies (unpaired T-test and p < 0.05, cells in deep blue) on biofilm cells in comparison to planktonic cells. Cells shaded in red indicate proteins showing signficantly increased abundance on the 4-week-old biofilm matrices in comparison to their equivalent proteins on the planktonic cell surfaces. Cells shaded in yellow show the LFQ values for GroEL1 on 2-day-, 1-week- and 2-week-old biofilm matrices with T-test statistics for pairwise comparisons. log, planktonic cells; B, submerged-type biofilms; P, pellicle-type biofilms. Click here for additional data file. 10.1128/msystems.01073-22.SuF4 Table S4 msystems.01073-22-s0004.pdf M. marinum proteins shared between the in vitro biofilm surfaces identified using the biotinylation and cell-surface shaving (data from Table S3 and Savijoki et al., 2021) proteomics. Click here for additional data file. 10.1128/msystems.01073-22.SuF5 Table S5 msystems.01073-22-s0005.pdf List of all mycobacterial proteins identified fron granulomas using LC-MS/MS. Both the original and normalized raw intensity values (normalized to combined raw intensity values of all identified proteins per replica) for each protein are shown. GroEL chaperones are shown with red letters. Click here for additional data file. 10.1128/msystems.01073-22.SuF6 FIG S1 msystems.01073-22-s0006.pdf Recombinant GroEL1 and GroEL2 production in E. coli as tag-free and AVI-tagged biotinylated form. (A) Final samples of GroEL1 protein in biotinylated and tag-free form were analysed via SDS-PAGE and Coomassie staining to verify purity. (B) The biotinylation of GroEL1 was verified by 1 h co-incubation at RT of the protein with tamavidin and SDS-PAGE (without boiling) to see the shift of the band upon the binding of tamavidin. The tag-free form was used as a negative control. (C) On the left, the tamavidin shift assay was performed with biotinylated and tag-free GroEL2 samples as in B. On the right, final samples of biotinylated and tag-free GroEL2 were analysed for purity. (D) A representative graph from the SEC carried out with a Superdex 200 column to verify monodispersity of the purified proteins. (E–H) The folding and thermal stability of GroEL1 and GroEL2 as biotinylated and tag-free forms were verified by nano-DSF in buffer corresponding to the screening conditions (25 mM Tris pH 8.0 and NaCl 150 mM). The inflection point temperatures are indicated with arrows. Click here for additional data file. 10.1128/msystems.01073-22.SuF7 FIG S2 msystems.01073-22-s0007.pdf Verification of the protein identity of (A) GroEL1 and (B) GroEL2 by mass spectrometry (tryptic digest). Click here for additional data file. 10.1128/msystems.01073-22.SuF8 FIG S3 msystems.01073-22-s0008.pdf Control experiments for sybody binding (A) As a negative control, 1 µg or 5 µg of His-Myc-tagged unspecific mannose binding protein (MBP) sybody was incubated with one-week-old Mmr biofilms. The sybodies bound to biofilm pellets were run onto SDS-page, and Western blots were stained with anti-Myc antibodies. No unspecific binding of this sybody was detected. On the first lane, 50 ng of MBP sybody was directly loaded onto the gel. (B-D) Two-week-old avirulent Mtb biofilms were stained with DAPI (shown in cyan) for DNA and with Myc-tagged sybodies against GroEL1 (C) or GroEL2 (D) + green-fluorescent anti-Myc antibodies (shown in yellow) or DAPI and anti-Myc antibody as a negative control (B). The stained biofilms were imaged with confocal microscopy. The scale bars are 10 µm. Click here for additional data file. 10.1128/msystems.01073-22.SuF9 Video S1 msystems.01073-22-s0009.mov 3D representation of GroEL1 sybody binding to granulomas. Pseudo-coloured 3D images of sybody binding to granulomas eight weeks post infection. DAPI (cyan) shows the host cell DNA, purple rods are mycobacteria and orange areas show the biofilm matrix stained with fluorescence-labelled sybodies. Click here for additional data file. 10.1128/msystems.01073-22.SuF10 Video S2 msystems.01073-22-s0010.mov 3D representation of GroEL1 sybody binding to granulomas. Pseudo-coloured 3D images of sybody binding to granulomas eight weeks post infection. DAPI (cyan) shows the host cell DNA, purple rods are mycobacteria and orange areas show the biofilm matrix stained with fluorescence-labelled sybodies. Click here for additional data file. 10.1128/msystems.01073-22.SuF11 OPEN PEER REVIEW reviewer-comments.pdf An accounting of the reviewer comments and feedback. Click here for additional data file. ASM does not own the copyrights to Supplemental Material that may be linked to, or accessed through, an article. The authors have granted ASM a non-exclusive, world-wide license to publish the Supplemental Material files. Please contact the corresponding author directly for reuse. ==== Refs REFERENCES 1 OMS . 2021. Global tuberculosis report 2021: 2.2 TB mortality. https://www.who.int/teams/global-tuberculosis-programme/tb-reports/global-tuberculosis-report-2021/disease-burden/mortality. 2 Islam MS , Richards JP , Ojha AK . 2012. Targeting drug tolerance in mycobacteria: a perspective from mycobacterial biofilms. Expert Rev Anti Infect Ther 10 :1055–1066. doi:10.1586/eri.12.88 23106280 3 Trivedi A , Mavi PS , Bhatt D , Kumar A . 2016. Thiol reductive stress induces cellulose-anchored biofilm formation in Mycobacterium tuberculosis. Nat Commun 7 : 11392. doi:10.1038/ncomms11392 27109928 4 Ciofu O , Moser C , Jensen PØ , Høiby N . 2022. Tolerance and resistance of microbial biofilms. Nat Rev Microbiol 20 :621–635. doi:10.1038/s41579-022-00682-4 35115704 5 Levin-Reisman I , Ronin I , Gefen O , Braniss I , Shoresh N , Balaban NQ . 2017. Antibiotic tolerance facilitates the evolution of resistance. Science 355 :826–830. doi:10.1126/science.aaj2191 28183996 6 Sarathy JP , Via LE , Weiner D , Blanc L , Boshoff H , Eugenin EA , Barry CE , Dartois VA . 2018. Extreme drug tolerance of Mycobacterium tuberculosis in Caseum. Antimicrob Agents Chemother 62 :1–11. doi:10.1128/AAC.02266-17 7 Sarathy JP , Dartois V . 2020. Caseum: a niche for Mycobacterium tuberculosis drug-tolerant persisters. Clin Microbiol Rev 33 :1–19. doi:10.1128/CMR.00159-19 8 Chakraborty P , Bajeli S , Kaushal D , Radotra BD , Kumar A . 2021. Biofilm formation in the lung contributes to virulence and drug tolerance of Mycobacterium tuberculosis. Nat Commun 12 : 1606. doi:10.1038/s41467-021-21748-6 33707445 9 Jovčevska I , Muyldermans S . 2020. The therapeutic potential of nanobodies. BioDrugs 34 :11–26. doi:10.1007/s40259-019-00392-z 31686399 10 Bao G , Tang M , Zhao J , Zhu X . 2021. Nanobody: a promising toolkit for molecular imaging and disease therapy. EJNMMI Res 11 :6. doi:10.1186/s13550-021-00750-5 33464410 11 Savijoki K , Myllymäki H , Luukinen H , Paulamäki L , Vanha-Aho L-M , Svorjova A , Miettinen I , Fallarero A , Ihalainen TO , Yli-Kauhaluoma J , Nyman TA , Parikka M . 2021. Surface-shaving proteomics of Mycobacterium marinum identifies biofilm subtype-specific changes affecting virulence, tolerance, and persistence. mSystems 6 : e0050021. doi:10.1128/mSystems.00500-21 34156290 12 Ren H , Dover LG , Islam ST , Alexander DC , Chen JM , Besra GS , Liu J . 2007. Identification of the lipooligosaccharide biosynthetic gene cluster from Mycobacterium marinum. Mol Microbiol 63 :1345–1359. doi:10.1111/j.1365-2958.2007.05603.x 17302813 13 Hall-Stoodley L , Brun OS , Polshyna G , Barker LP . 2006. Mycobacterium marinum biofilm formation reveals cording morphology. FEMS Microbiol Lett 257 :43–49. doi:10.1111/j.1574-6968.2006.00143.x 16553830 14 Tobin DM , Ramakrishnan L . 2008. Comparative pathogenesis of Mycobacterium marinum and Mycobacterium tuberculosis. Cell Microbiol 10 :1027–1039. doi:10.1111/j.1462-5822.2008.01133.x 18298637 15 Takaki K , Davis JM , Winglee K , Ramakrishnan L . 2013. Evaluation of the pathogenesis and treatment of Mycobacterium marinum infection in zebrafish. Nat Protoc 8 :1114–1124. doi:10.1038/nprot.2013.068 23680983 16 Meijer AH . 2016. Protection and pathology in TB: learning from the zebrafish model. Semin Immunopathol 38 :261–273. doi:10.1007/s00281-015-0522-4 26324465 17 Meijer AH , Spaink HP . 2011. Host-pathogen interactions made transparent with the zebrafish model. Curr Drug Targets 12 :1000–1017. doi:10.2174/138945011795677809 21366518 18 Parikka M , Hammarén MM , Harjula S-K , Halfpenny NJA , Oksanen KE , Lahtinen MJ , Pajula ET , Iivanainen A , Pesu M , Rämet M . 2012. Mycobacterium marinum causes a latent infection that can be reactivated by gamma irradiation in adult zebrafish. PLoS Pathog 8 : e1002944. doi:10.1371/journal.ppat.1002944 23028333 19 Hammarén MM , Oksanen KE , Nisula HM , Luukinen BV , Pesu M , Rämet M , Parikka M . 2014. Adequate Th2-type response associates with restricted bacterial growth in latent mycobacterial infection of zebrafish. PLoS Pathog 10 : e1004190. doi:10.1371/journal.ppat.1004190 24968056 20 Zimmermann I , Egloff P , Hutter CAJ , Kuhn BT , Bräuer P , Newstead S , Dawson RJP , Geertsma ER , Seeger MA . 2020. Generation of synthetic nanobodies against delicate proteins. Nat Protoc 15 :1707–1741. doi:10.1038/s41596-020-0304-x 32269381 21 Zimmermann I , Egloff P , Hutter CA , Arnold FM , Stohler P , Bocquet N , Hug MN , Huber S , Siegrist M , Hetemann L , Gera J , Gmür S , Spies P , Gygax D , Geertsma ER , Dawson RJP , Seeger MA . 2018. Synthetic single domain antibodies for the conformational trapping of membrane proteins. Elife 7 : e34317. doi:10.7554/eLife.34317 29792401 22 Batth TS , Tollenaere MX , Rüther P , Gonzalez-Franquesa A , Prabhakar BS , Bekker-Jensen S , Deshmukh AS , Olsen JV . 2019. Protein aggregation capture on microparticles enables multipurpose proteomics sample preparation. Mol Cell Proteomics 18 :1027–1035. doi:10.1074/mcp.TIR118.001270 30833379 23 Cox J , Mann M . 2008. MaxQuant enables high peptide identification rates, individualized p.p.b.-range mass accuracies and proteome-wide protein quantification. Nat Biotechnol 26 :1367–1372. doi:10.1038/nbt.1511 19029910 24 Tyanova S , Temu T , Cox J . 2016. The MaxQuant computational platform for mass spectrometry-based shotgun proteomics. Nat Protoc 11 :2301–2319. doi:10.1038/nprot.2016.136 27809316 25 Deutsch EW , Csordas A , Sun Z , Jarnuczak A , Perez-Riverol Y , Ternent T , Campbell DS , Bernal-Llinares M , Okuda S , Kawano S , Moritz RL , Carver JJ , Wang M , Ishihama Y , Bandeira N , Hermjakob H , Vizcaíno JA . 2017. The proteomeXchange consortium in 2017: supporting the cultural change in proteomics public data deposition. Nucleic Acids Res 45 :D1100–D1106. doi:10.1093/nar/gkw936 27924013 26 Perez-Riverol Y , Csordas A , Bai J , Bernal-Llinares M , Hewapathirana S , Kundu DJ , Inuganti A , Griss J , Mayer G , Eisenacher M , Pérez E , Uszkoreit J , Pfeuffer J , Sachsenberg T , Yilmaz S , Tiwary S , Cox J , Audain E , Walzer M , Jarnuczak AF , Ternent T , Brazma A , Vizcaíno JA . 2019. The PRIDE database and related tools and resources in 2019: improving support for quantification data. Nucleic Acids Res 47 :D442–D450. doi:10.1093/nar/gky1106 30395289 27 Rice P , Longden I , Bleasby A . 2000. EMBOSS: the European Molecular Biology Open Software Suite. Trends Genet 16 :276–277. doi:10.1016/s0168-9525(00)02024-2 10827456 28 Teufel F , Almagro Armenteros JJ , Johansen AR , Gíslason MH , Pihl SI , Tsirigos KD , Winther O , Brunak S , von Heijne G , Nielsen H . 2022. SignalP 6.0 predicts all five types of signal peptides using protein language models. Nat Biotechnol 40 :1023–1025. doi:10.1038/s41587-021-01156-3 34980915 29 Kahsay RY , Gao G , Liao L . 2005. An improved hidden markov model for transmembrane protein detection and topology prediction and its applications to complete genomes. Bioinformatics 21 :1853–1858. doi:10.1093/bioinformatics/bti303 15691854 30 Krogh A , Larsson B , von Heijne G , Sonnhammer EL . 2001. Predicting transmembrane protein topology with a hidden markov model: application to complete genomes. J Mol Biol 305 :567–580. doi:10.1006/jmbi.2000.4315 11152613 31 Chen C , Liu H , Zabad S , Rivera N , Rowin E , Hassan M , Gomez De Jesus SM , Llinás Santos PS , Kravchenko K , Mikhova M , Ketterer S , Shen A , Shen S , Navas E , Horan B , Raudsepp J , Jeffery C . 2021. MoonProt 3.0: an update of the moonlighting proteins database. Nucleic Acids Res 49 :D368–D372. doi:10.1093/nar/gkaa1101 33245761 32 Ojha A , Anand M , Bhatt A , Kremer L , Jacobs WR , Hatfull GF . 2005. GroEL1: a dedicated chaperone involved in mycolic acid biosynthesis during biofilm formation in mycobacteria. Cell 123 :861–873. doi:10.1016/j.cell.2005.09.012 16325580 33 Qamra R , Srinivas V , Mande SC . 2004. Mycobacterium tuberculosis GroEL homologues unusually exist as lower oligomers and retain the ability to suppress aggregation of substrate proteins. J Mol Biol 342 :605–617. doi:10.1016/j.jmb.2004.07.066 15327959 34 Sielaff B , Lee KS , Tsai FTF . 2011. Structural and functional conservation of Mycobacterium tuberculosis GroEL paralogs suggests that GroEL1 is a chaperonin. J Mol Biol 405 :831–839. doi:10.1016/j.jmb.2010.11.021 21094166 35 Pizzano R , Manzo C , Nicolai MA , Addeo F . 2012. Occurrence of major whey proteins in the pH 4.6 insoluble protein fraction from UHT-treated milk. J Agric Food Chem 60 :8044–8050. doi:10.1021/jf3024563 22809470 36 Cantillon D , Wroblewska J , Cooper I , Newport MJ , Waddell SJ . 2021. Three-dimensional low shear culture of Mycobacterium bovis BCG induces biofilm formation and antimicrobial drug tolerance. NPJ Biofilms Microbiomes 7 :12. doi:10.1038/s41522-021-00186-8 33526771 37 Prasad TSK , Verma R , Kumar S , Nirujogi RS , Sathe GJ , Madugundu AK , Sharma J , Puttamallesh VN , Ganjiwale A , Myneedu VP , Chatterjee A , Pandey A , Harsha H , Narayana J . 2013. Proteomic analysis of purified protein derivative of Mycobacterium tuberculosis. Clin Proteomics 10 : 8. doi:10.1186/1559-0275-10-8 23870090 38 Flores-Valdez MA , Aceves-Sánchez M de J , Peterson EJR , Baliga N , Bravo-Madrigal J , De la Cruz-Villegas MÁ , Ares MA , Born S , Voskuil M , Pérez-Padilla NA , Burciaga-Flores M , Camacho-Villegas TA , Espinoza-Jorge MG . 2020. Transcriptional portrait of M. bovis BCG during biofilm production shows genes differentially expressed during intercellular aggregation and substrate attachment. Sci Rep 10 : 12578. doi:10.1038/s41598-020-69152-2 32724037 39 Seto S , Morimoto K , Yoshida T , Hiramatsu M , Hijikata M , Nagata T , Kikuchi F , Shiraishi Y , Kurashima A , Keicho N . 2020. Proteomic profiling reveals the architecture of granulomatous lesions caused by tuberculosis and Mycobacterium avium complex lung disease. Front Microbiol 10 : 3081. doi:10.3389/fmicb.2019.03081 32010116 40 McNamara M , Tzeng S-C , Maier C , Wu M , Bermudez LE . 2013. Surface-exposed proteins of pathogenic mycobacteria and the role of cu-zn superoxide dismutase in macrophages and neutrophil survival. Proteome Sci 11 :1–7. doi:10.1186/1477-5956-11-45 23317149 41 McNamara M , Tzeng S-C , Maier C , Zhang L , Bermudez LE . 2012. Surface proteome of “Mycobacterium avium subsp. hominissuis” during the early stages of macrophage infection. Infect Immun 80 :1868–1880. doi:10.1128/IAI.06151-11 22392927 42 Siciliano RA , Lippolis R , Mazzeo MF . 2019. Proteomics for the investigation of surface-exposed proteins in probiotics. Front Nutr 6 :52. doi:10.3389/fnut.2019.00052 31069232 43 Foulston L , Elsholz AKW , DeFrancesco AS , Losick R . 2014. The extracellular matrix of Staphylococcus aureus biofilms comprises cytoplasmic proteins that associate with the cell surface in response to decreasing pH. mBio 5 : e01667-14. doi:10.1128/mBio.01667-14 25182325 44 Graf AC , Leonard A , Schäuble M , Rieckmann LM , Hoyer J , Maass S , Lalk M , Becher D , Pané-Farré J , Riedel K . 2019. Virulence factors produced by Staphylococcus aureus biofilms have a moonlighting function contributing to biofilm integrity. Mol Cell Proteomics 18 :1036–1053. doi:10.1074/mcp.RA118.001120 30850421 45 Hiltunen AK , Savijoki K , Nyman TA , Miettinen I , Ihalainen P , Peltonen J , Fallarero A . 2019. Structural and functional dynamics of Staphylococcus aureus biofilms and biofilm matrix proteins on different clinical materials. Microorganisms 7 : 584. doi:10.3390/microorganisms7120584 31756969 46 Savijoki K , Iivanainen A , Siljamäki P , Laine PK , Paulin L , Karonen T , Pyörälä S , Kankainen M , Nyman TA , Salomäki T , Koskinen P , Holm L , Simojoki H , Taponen S , Sukura A , Kalkkinen N , Auvinen P , Varmanen P . 2014. Genomics and proteomics provide new insight into the commensal and pathogenic lifestyles of bovine- and human-associated Staphylococcus epidermidis strains. J Proteome Res 13 :3748–3762. doi:10.1021/pr500322d 25014494 47 Savijoki K , Nyman TA , Kainulainen V , Miettinen I , Siljamäki P , Fallarero A , Sandholm J , Satokari R , Varmanen P . 2019. Growth mode and carbon source impact the surfaceome dynamics of Lactobacillus rhamnosus GG. Front Microbiol 10 :1272. doi:10.3389/fmicb.2019.01272 31231350 48 Savijoki K , Miettinen I , Nyman TA , Kortesoja M , Hanski L , Varmanen P , Fallarero A . 2020. Growth mode and physiological state of cells prior to biofilm formation affect immune evasion and persistence of Staphylococcus aureus. Microorganisms 8 : 106. doi:10.3390/microorganisms8010106 31940921 49 Pagani TD , Guimarães ACR , Waghabi MC , Corrêa PR , Kalume DE , Berrêdo-Pinho M , Degrave WM , Mendonça-Lima L . 2019. Exploring the potential role of moonlighting function of the surface-associated proteins from Mycobacterium bovis bcg moreau and pasteur by comparative proteomic. Front Immunol 10 : 716. doi:10.3389/fimmu.2019.00716 31080447 50 Götz F , Yu W , Dube L , Prax M , Ebner P . 2015. Excretion of cytosolic proteins (ECP) in bacteria. Int J Med Microbiol 305 :230–237. doi:10.1016/j.ijmm.2014.12.021 25596889 51 Espino E , Koskenniemi K , Mato-Rodriguez L , Nyman TA , Reunanen J , Koponen J , Öhman T , Siljamäki P , Alatossava T , Varmanen P , Savijoki K . 2015. Uncovering surface-exposed antigens of lactobacillus rhamnosus by cell shaving proteomics and two-dimensional immunoblotting. J Proteome Res 14 :1010–1024. doi:10.1021/pr501041a 25531588 52 Ebner P , Prax M , Nega M , Koch I , Dube L , Yu W , Rinker J , Popella P , Flötenmeyer M , Götz F . 2015. Excretion of cytoplasmic proteins (ECP) in Staphylococcus aureus. Mol Microbiol 97 :775–789. doi:10.1111/mmi.13065 26009926 53 Ebner P , Rinker J , Götz F . 2016. Excretion of cytoplasmic proteins in Staphylococcus is most likely not due to cell lysis. Curr Genet 62 :19–23. doi:10.1007/s00294-015-0504-z 26148975 54 Ebner P , Luqman A , Reichert S , Hauf K , Popella P , Forchhammer K , Otto M , Götz F . 2017. Non-classical protein excretion is boosted by PSMα-induced cell leakage. Cell Rep 20 :1278–1286. doi:10.1016/j.celrep.2017.07.045 28793253 55 Ebner P , Götz F . 2019. Bacterial excretion of cytoplasmic proteins (ECP): occurrence, mechanism, and function. Trends Microbiol 27 :176–187. doi:10.1016/j.tim.2018.10.006 30442534 56 Reigada I , San-Martin-Galindo P , Gilbert-Girard S , Chiaro J , Cerullo V , Savijoki K , Nyman TA , Fallarero A , Miettinen I . 2021. Surfaceome and exoproteome dynamics in dual-species Pseudomonas aeruginosa and Staphylococcus aureus biofilms. Front Microbiol 12 : 672975. doi:10.3389/fmicb.2021.672975 34248881 57 San-Martin-Galindo P , Rosqvist E , Tolvanen S , Miettinen I , Savijoki K , Nyman TA , Fallarero A , Peltonen J . 2021. Modulation of virulence factors of Staphylococcus aureus by nanostructured surfaces. Materials & Design 208 :109879. doi:10.1016/j.matdes.2021.109879 58 Alfonso-Garrido J , Garcia-Calvo E , Luque-Garcia JL . 2015. Sample preparation strategies for improving the identification of membrane proteins by mass spectrometry. Anal Bioanal Chem 407 :4893–4905. doi:10.1007/s00216-015-8732-0 25967148 59 Serra DO , Richter AM , Klauck G , Mika F , Hengge R . 2013. Microanatomy at cellular resolution and spatial order of physiological differentiation in a bacterial biofilm. mBio 4 : e00103-13. doi:10.1128/mBio.00103-13 23512962 60 Erskine E , MacPhee CE , Stanley-Wall NR . 2018. Functional amyloid and other protein fibers in the biofilm matrix. J Mol Biol 430 :3642–3656. doi:10.1016/j.jmb.2018.07.026 30098341 61 Jain N , Chapman MR . 2019. Bacterial functional amyloids: order from disorder. Biochim Biophys Acta Proteins Proteom 1867 :954–960. doi:10.1016/j.bbapap.2019.05.010 31195143 62 Kaneko N , Yamamoto R , Sato T-A , Tanaka K . 2014. Identification and quantification of amyloid beta-related peptides in human plasma using matrix-assisted laser desorption/ionization time-of-flight mass spectrometry. Proc Jpn Acad Ser B Phys Biol Sci 90 :104–117. doi:10.2183/pjab.90.104 63 Zhu H , Lee C , Zhang D , Wu W , Wang L , Fang X , Xu X , Song D , Xie J , Ren S , Gu J . 2013. Surface-associated GroEL facilitates the adhesion of Escherichia coli to macrophages through lectin-like oxidized low-density lipoprotein receptor-1. Microbes Infect 15 :172–180. doi:10.1016/j.micinf.2012.10.001 23085345 64 Henderson B , Martin A . 2011. Bacterial virulence in the moonlight: multitasking bacterial moonlighting proteins are virulence determinants in infectious disease. Infect Immun 79 :3476–3491. doi:10.1128/IAI.00179-11 21646455 65 Hickey TBM , Ziltener HJ , Speert DP , Stokes RW . 2010. Mycobacterium tuberculosis employs Cpn60.2 as an adhesin that binds CD43 on the macrophage surface. Cell Microbiol 12 :1634–1647. doi:10.1111/j.1462-5822.2010.01496.x 20633027 66 Hickey TBM , Thorson LM , Speert DP , Daffé M , Stokes RW . 2009. Mycobacterium tuberculosis Cpn60.2 and dnak are located on the bacterial surface, where Cpn60.2 facilitates efficient bacterial association with macrophages. Infect Immun 77 :3389–3401. doi:10.1128/IAI.00143-09 19470749 67 Kerns PW , Ackhart DF , Basaraba RJ , Leid JG , Shirtliff ME . 2014. Mycobacterium tuberculosis pellicles express unique proteins recognized by the host humoral response. Pathog Dis 70 :347–358. doi:10.1111/2049-632X.12142 24453174 68 Schumacher D , Helma J , Schneider AFL , Leonhardt H , Hackenberger CPR . 2018. Nanobodies: chemical functionalization strategies and intracellular applications. Angew Chem Int Ed Engl 57 :2314–2333. doi:10.1002/anie.201708459 28913971 69 Prole DL , Taylor CW . 2019. A genetically encoded toolkit of functionalized nanobodies against fluorescent proteins for visualizing and manipulating intracellular signalling. BMC Biol 17 :41. doi:10.1186/s12915-019-0662-4 31122229