
==== Front
NPJ Vaccines
NPJ Vaccines
NPJ Vaccines
2059-0105
Nature Publishing Group UK London

39294173
961
10.1038/s41541-024-00961-6
Article
Low-frequency CD8+ T cells induced by SIGN-R1+ macrophage-targeted vaccine confer SARS-CoV-2 clearance in mice
http://orcid.org/0000-0002-4493-7052
Muraoka Daisuke d.muraoka@aichi-cc.jp

12
Moi Meng Ling sherry@m.u-tokyo.ac.jp

34
http://orcid.org/0000-0003-3831-7612
Muto Osamu 56
Nakatsukasa Takaaki 17
Deng Situo 1
Takashima Chieko 2
http://orcid.org/0000-0003-1224-227X
Yamaguchi Rui 56
Sawada Shin-ichi 8
Hayakawa Haruka 3
http://orcid.org/0000-0003-0819-5263
Nguyen Thi Thanh Ngan 4
Haseda Yasunari 9
Soga Takatoshi 9
Matsushita Hirokazu 2
Ikeda Hiroaki 1
Akiyoshi Kazunari 10
Harada Naozumi 9
1 grid.174567.6 0000 0000 8902 2273 Department of Oncology, Nagasaki University Graduate School of Biomedical Sciences, Nagasaki, Japan
2 https://ror.org/03kfmm080 grid.410800.d 0000 0001 0722 8444 Division of Translational Oncoimmunology, Aichi Cancer Center Research Institute, Nagoya, Japan
3 https://ror.org/057zh3y96 grid.26999.3d 0000 0001 2169 1048 School of International Health, Graduate School of Medicine, the University of Tokyo, Tokyo, Japan
4 https://ror.org/058h74p94 grid.174567.6 0000 0000 8902 2273 Institute of Tropical Medicine, Nagasaki University, Nagasaki, Japan
5 https://ror.org/03kfmm080 grid.410800.d 0000 0001 0722 8444 Division of Cancer Systems Biology, Aichi Cancer Center Research Institute, Nagoya, Japan
6 https://ror.org/04chrp450 grid.27476.30 0000 0001 0943 978X Division of Cancer Informatics, Nagoya University Graduate School of Medicine, Nagoya, Japan
7 grid.174567.6 0000 0000 8902 2273 Department of Surgical Oncology, Nagasaki University Graduate School of Biomedical Sciences, Nagasaki, Japan
8 https://ror.org/01hjzeq58 grid.136304.3 0000 0004 0370 1101 Synergy Institute for Futuristic Mucosal Vaccine Research and Development (cSIMVa), Chiba University, Chiba, Japan
9 United Immunity, Co., Ltd., Tokyo, 103-0022 Japan
10 https://ror.org/02kpeqv85 grid.258799.8 0000 0004 0372 2033 Department of Immunology, Graduate School of Medicine, Kyoto University, Kyoto, Japan
18 9 2024
18 9 2024
2024
9 1733 7 2023
1 9 2024
© The Author(s) 2024
2024
https://creativecommons.org/licenses/by-nc-nd/4.0/ Open Access This article is licensed under a Creative Commons Attribution-NonCommercial-NoDerivatives 4.0 International License, which permits any non-commercial use, sharing, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if you modified the licensed material. You do not have permission under this licence to share adapted material derived from this article or parts of it. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by-nc-nd/4.0/.
Vaccine-induced T cells and neutralizing antibodies are essential for protection against SARS-CoV-2. Previously, we demonstrated that an antigen delivery system, pullulan nanogel (PNG), delivers vaccine antigen to lymph node medullary macrophages and thereby enhances the induction of specific CD8+ T cells. In this study, we revealed that medullary macrophage-selective delivery by PNG depends on its binding to a C-type lectin SIGN-R1. In a K18-hACE2 mouse model of SARS-CoV-2 infection, vaccination with a PNG-encapsulated receptor-binding domain of spike protein decreased the viral load and prolonged the survival in the CD8+ T cell- and B cell-dependent manners. T cell receptor repertoire analysis revealed that although the vaccine induced T cells at various frequencies, low-frequency specific T cells mainly promoted virus clearance. Thus, the induction of specific CD8+ T cells that respond quickly to viral infection, even at low frequencies, is important for vaccine efficacy and can be achieved by SIGN-R1+ medullary macrophage-targeted antigen delivery.

Subject terms

Protein vaccines
Drug delivery
https://doi.org/10.13039/100009619 Japan Agency for Medical Research and Development (AMED) JP20pc0101048 JP21wm0125006 JP223fa627001 Moi Meng Ling Harada Naozumi issue-copyright-statement© Springer Nature Limited 2024
==== Body
pmcIntroduction

The number of cases of the coronavirus disease 2019 (COVID-19) caused by severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) has surpassed 77 million worldwide, with a mortality of more than 7 million (https://covid19.who.int/)1–3. Vaccination plays a vital role in controlling the global spread of COVID-19 by mounting immune responses against the virus4–8.

The spike (S) protein of SARS-CoV-2, particularly its receptor-binding domain (RBD), is a key target for neutralizing antibodies that inhibit the binding of the S protein to its receptor, ACE2 on host cells, thereby preventing infection9–12. Almost all SARS-CoV-2 vaccines contain the whole S protein or RBD as an antigen for the induction of neutralizing antibodies. Various types of vaccines have been developed, including inactivated virus, DNA, mRNA, and protein vaccines. To date, mRNA, protein, inactivated virus, and viral vector vaccines have been approved for use worldwide4,8; however, the virus has acquired several mutations that enable the evasion from vaccine-induced immune responses. The most number of mutations of concern are those located in the S protein that cause a reduction in its binding affinity to neutralizing antibodies13–26. Thus, vaccine platforms that exclusively rely on the induction of neutralizing antibodies may have limited efficacy against some variants of SARS-CoV-2 and may, in turn, drive the emergence of strains that are resistant to neutralization. In addition, the durability of the humoral response to SARS-CoV-2 was reported to be limited to a few months27, and the plasma levels of S1 protein-specific neutralizing antibodies were not detected in several patients who had recovered from COVID-1928, indicating that the neutralizing antibodies likely only provide short-term protection.

The SARS-CoV-2-specific CD8+ T cell response is a key mechanism for the prevention of SARS-CoV-2 infection29,30. Patients with virus-specific CD8+ T cells in the acute phase have a better prognosis after infection, implying that CD8+ T cells contribute to the control of SARS-CoV-2 infection31. Additionally, clearance of SARS-CoV-2 by vaccines is mediated by virus-specific CD8+ T cells32,33. Interestingly, vaccination against the nucleocapsid (N) protein in cynomolgus macaques did not induce virus neutralization antibodies but prevented SARS-CoV-2 infection33. In a mouse model, vaccination against the N protein alone elicited cellular immune responses that could control SARS-CoV-234, and a combined N- and S-protein vaccine had better efficacy against SARS-CoV-2 infection than the S vaccine alone34,35.

The vaccine-induced SARS-CoV-2-specific CD8+ T cell response likely has a key role in virus clearance and urgent investigation is required to elucidate its underlying mechanism to enable the development of effective long-term vaccines. As an efficient CD8+ T cell-inducing vaccine, we generated a nanoparticulate RBD protein vaccine utilizing the pullulan nanogel (PNG) antigen delivery system. Nanogel is a nanoparticulate hydrogel with three-dimensional crosslinked polymer networks. Nanogel has recently attracted attention as nanocarriers for drug delivery36,37. Cholesteryl pullulan, a pullulan polysaccharide modified with cholesterol, automatically forms a nanogel through hydrophobic interactions between cholesterol groups. The resulting PNG can efficiently encapsulate proteins and peptides into its polymer network, thereby solubilizing and stabilizing these cargos. We previously reported that, when subcutaneously injected into mice, a peptide antigen-loaded PNG migrates to the draining lymph node (DLN) in a cell-independent manner, where it is engulfed by antigen-presenting cells, especially medullary macrophages, which can exert efficient cross-presentation activity in the presence of Toll-like receptor (TLR) stimulation, resulting in the induction of a strong CD8+ T cell response38–40. PNG has been tested as a vaccine delivery system in a series of clinical trials41–44.

In this study, using a PNG-encapsulated S RBD protein vaccine (PNG:RBD vaccine), we investigated how virus-specific CD8+ T cells and antibodies contribute to the clearance of SARS-CoV-2 after vaccination. First, we confirmed that the PNG:RBD vaccine could induce a strong RBD-specific CD8+ T cell response in the vaccinated healthy mice. Simultaneously, we identified mouse C-type lectin SIGN-R1 (CD209b) as a physiological receptor for PNG, which explains lymph node medullary macrophage-selective antigen delivery and enhanced CD8+ T cell induction. We investigated how RBD-specific CD8+ T cells and antibodies contribute to the clearance of SARS-CoV-2 after vaccination with the PNG:RBD vaccine. The vaccine efficiently prevented SARS-CoV-2 infection in a K18-hACE2 mouse model, which required both CD8+ T cells and B cells. Furthermore, computational analysis of T cell receptor (TCR)-sequence data revealed that vaccine-mediated virus clearance was primarily mediated by CD8+ T cells induced at a very low frequency, rather than at a high frequency. Our study suggests that the induction of low-frequency virus-specific CD8+ T cell clones that expand rapidly after infection is crucial in determining vaccine efficacy, compared to those that induce monoclonal virus-specific CD8+ T cells.

Results

Medullary macrophage-selective antigen delivery by PNG depends on binding to SIGN-R1

We previously demonstrated that the nanoparticulate vaccine-delivery system PNG delivered vaccine antigens to lymph node medullary macrophages after subcutaneous injection and strongly enhanced antigen-specific CD8+ T cell responses through cross-presentation by medullary macrophages39. However, the mechanism underlying medullary macrophage-selective antigen delivery by PNG remains unclear. Given that pullulan, the backbone of PNG, is a polysaccharide and that antigen-presenting cells, such as macrophages and dendritic cells, express C-type lectins to recognize polysaccharides on pathogens, we first investigated whether PNG binds to mouse C-type lectins expressed in HeLa cells, including DC-SIGN (CD209a), SIGN-R1 (CD209b), mannose receptor (MRC, CD206), Dectin-1 (CD369), and macrophage-inducible C-type lectin (Mincle, CD200). PNG was found to predominantly bind to SIGN-R1 (Fig. 1a, b), and is occluded by anti-SIGN-R1 antibody (Fig. 1b). PNG did not bind to SIGN-R1 lacking the carbohydrate-recognition (CRD) domain (Fig. 1c). In previous studies, we have shown that subcutaneously injected PNG is engulfed by medullary macrophages39, and therefore, we examined whether this uptake of PNG by medullary macrophages is mediated by SIGN-R1. First, we investigated whether medullary macrophages express SIGN-R1 and found that both medullary sinus macrophages (MSMs) and medullary cord macrophages (MCMs) express SIGN-R1, consistent with previous reports45 (Fig. 1d). Additionally, when subcutaneously injected into mice, PNG was efficiently engulfed by these medullary macrophages in the DLN, and this uptake was significantly blocked by the administration of anti-SIGN-R1 antibody (Fig. 1e, f). Next, we examined whether this antigen uptake mediated by SIGN-R1 enhances antigen presentation by medullary macrophages utilizing a PNG:long peptide antigen complex used in our previous study39. This showed that antigen presentation was attenuated by anti-SIGN-R1 antibody (Supplementary Fig. 1). These results clearly indicate that PNG can deliver antigens to medullary macrophages predominance by selectively binding to SIGN-R1 which promotes antigen presentation by medullary macrophages.Fig. 1 PNG-based vaccine delivery system specifically binds to mouse SIGN-R1.

a, b, c HeLa cells were transduced with cDNA encoding the indicated C-type lectin receptor and incubated with rhodamine-PNG for 30 min. The rhodamine signal was observed under a microscope or detected by flow cytometry (scale bar = 50 μm). b Anti-SIGN-R1 antibody (22D1) was added to the cells 60 min prior to the addition of PNG (scale bar = 100 μm). d SIGN-R1 expression in macrophages were examined by flow cytometry. e, f Rhodamine-PNG was subcutaneously administrated into normal mice and the inguinal lymph node was collected after 10 min (scale bar = 100 μm). The rhodamine signal was observed by microscopy (d) or detected by flow cytometry (e). Anti-SIGN-R1 antibody (22D1) was subcutaneously injected into mice for blocking 60 min prior to the injection of PNG. *p < 0.05; n.s., not significant.

PNG-encapsulated RBD vaccine effectively prevents SARS-CoV-2 infection by inducing a potent CD8+ T cell response in mice

We investigated whether PNG vaccine induces cellular immunity via SIGN-R1+ medullary macrophages and evaluated its effects on the CD8+ T cell response to virus infection using the PNG:RBD vaccine (Supplementary Fig. 2a). The PNG:RBD vaccine had a diameter of 54.2 nm (Supplementary Fig. 2b). Efficient encapsulation was confirmed using size exclusion high performance liquid chromatography (SE-HPLC, Supplementary Fig. 2c). The PNG:RBD vaccine induced RBD-specific CD8+ T cell responses, which were attenuated by using anti-SIGN-R1 antibody (Supplementary Fig. 3). Next, we evaluated the immunogenicity of PNG:RBD vaccine comparing to that of the RBD alone vaccine. Consistent with our previous result using a different vaccine antigen39, the PNG:RBD vaccine induced significantly higher RBD-specific CD8+ T cell responses compared to those with the RBD alone vaccine after one or two vaccinations (Fig. 2a). Even 3 weeks after the last immunization, greater RBD-specific CD8+ T cell responses were detected in the spleens and lungs of the PNG:RBD vaccine group than those in the RBD alone vaccine group (Fig. 2a, b). These RBD-specific CD8+ T cells included abundant effector T cells (CD44+CCR7-CD127-) and effector memory T cells (CD44+CCR7−CD127+) and were induced in both the PNG:RBD and RBD alone vaccine groups (Fig. 2c, d, f, g). Low CD45RB and high KLRG expression was previously reported to correlate with high TCR affinity and effector function46. In the PNG:RBD vaccine group, the expression of KLRG was higher than that in the RBD alone vaccine group (Figs. 2e, h). Additionally in the PNG:RBD vaccine group, the CD45RB expression in effector memory T cells was lower than in the control group, but not in the RBD alone vaccine group (Figs. 2e, h). These findings suggest that the PNG:RBD vaccine efficiently induced antigen-specific memory CD8+ T cells with high antigen recognition ability and effector function. However, the induction of RBD-specific CD4+ T cell responses was comparable between the RBD alone and PNG:RBD vaccines and there was also no differences in the phenotypes and the expression of the activation markers CD137 and CD69 of CD4+ T cells between these vaccines in the lungs and spleens (Supplementary Fig. 4). Regarding vaccine-induced humoral responses, although the PNG:RBD vaccine induced humoral immune responses, there were no significant differences in the titer of RBD-specific serum IgG antibodies between the PNG:RBD and RBD alone vaccine groups (Fig. 2i and Supplementary Fig. 5). Neutralizing antibodies were induced in both groups to a similar degree, as assessed by antibody-mediated inhibition of RBD and hACE2 protein binding (Fig. 2j).Fig. 2 PNG:RBD vaccine induces strong cellular and humoral immune responses against SARS-CoV-2 S RBD in mice.

K18-hACE2 mice were immunized with the PNG:RBD or RBD alone vaccine twice at a 2-week interval. (a) Spleens or (b) lungs were obtained on the indicated days and specific T cell induction was analyzed with an intracellular cytokine staining assay using stimulation with the indicated peptides. c–h Characteristics of RBD-specific CD8+ T cells from the spleen (c–e) or lung (f–h). i Binding of total serum IgG to the RBD protein. Serum was obtained from vaccinated mice on day 35. Data represent OD 450 nm values for each group of four mice. j Serum was collected on day 35 and the inhibition of binding between RBD and hACE2 proteins was assessed. *p < 0.05; n.s., not significant.

We evaluated the efficacy of the PNG:RBD vaccine in protecting against SARS-CoV-2 in a K18-hACE2 transgenic mouse model47. Intranasal dosing of SARS-CoV-2 at 5 × 104 plaque-forming units (PFU) resulted in a 100% death rate in the control group (Fig. 3a). Two of seven (28.6%) mice in the RBD alone vaccine group died, whereas all mice in the PNG:RBD vaccine group survived. Furthermore, we found that although SARS-CoV-2 infection decreased the body weight by 20% in the control group, PNG:RBD prevented this weight loss. On the other hand, in the RBD alone vaccine group, a decrease in body weight was observed in some mice (Fig. 3b). Next, we evaluated the virus titers in the appropriate organs after vaccination in the infected hACE2 mice. As infection was not detected in the spleen, virus titers were measured in the saliva, lung, kidney, and liver (Supplementary Fig. 6). At 4 or 6 days post-virus challenge, although the viral titer was reduced in the saliva in mice vaccinated with RBD alone, this decrease was not significant compared to the reduction in the control group. On the other hand, PNG:RBD vaccine significantly reduced viral titers in the saliva when compared to the control group (Fig. 3c). Similarly, the virus titers in the lungs, kidneys, and livers of the PNG:RBD vaccine group were also significantly lower than those in the control or RBD alone vaccine groups (Fig. 3d). To understand the contribution of T and B cells to PNG:RBD vaccine-mediated virus clearance, we examined the virus titer in the CD8+ T cell- or B cell-depleted hACE2 mice (Fig. 3e). CD8+ T cells or B cells were depleted by administration of anti-CD8 and anti-CD20 antibodies, respectively; however, B cell depletion reduced the RBD-specific IgG while CD8+ T cell depletion did not (Supplementary Fig. 7). Administration of these antibodies prior to virus infection reversed the virus titer in the saliva and lungs of the vaccinated mice, resulting in a higher number of mice in which the virus was detected (Fig. 3f). These results indicate that while the RBD alone vaccine does not clear SARS-CoV-2 well, the PNG:RBD vaccine could induce both virus specific antibody by B cells and antigen-specific CD8+ T cells and their synergistic effect leads to the effective prevention of SARS-CoV-2 infection.Fig. 3 PNG:RBD vaccine induced better protective immunity to SARS-CoV-2 in the CD8+ T cell- and B cell-dependent manners.

K18-hACE2 mice were immunized with the PNG:RBD or RBD alone vaccine twice at a 2-week interval. At 21 days after the 2nd vaccination, mice were challenged with SARS-CoV-2. a Kaplan–Meier survival curve over 17 days post viral infection. b Body weight changes in mice after SARS-CoV-2 infection. c, d Saliva, lungs, kidneys, and livers were collected at 4 or 6 days post infection. Viral RNA was measured using quantitative PCR. e Experimental design for investigating the cells responsible for protecting from immune protection against SARS-CoV-2 in K18-hACE2 mice. f Mice were intraperitoneally injected with anti-mouse CD8a or anti-mouse CD20 antibody prior to infection and post infection. Saliva and lungs were collected at 6 days post infection and quantitative PCR was performed to measure viral RNA. Data are presented as mean ± SD. *p < 0.05; n.s., not significant.

PNG:RBD vaccine rapidly blocks the upregulation of virus-induced genes

The effects of vaccination and/or infection on gene expression were examined in the relevant organs. We focused on the lungs, the main entry point of SARS-CoV-2 into the body and the frontline of defense against viral infection, and the spleen, an important lymphoid organ for immune induction. We performed whole-gene expression analysis in the organs of vaccinated or control mice on day 3 post infection to reveal the mechanism underlying virus clearance by the PNG:RBD vaccine. The experiment involved four groups of mice: “not vaccinated–not infected (control),” “not vaccinated–infected,” “vaccinated–not infected,” and “vaccinated–infected” mice (Fig. 4). Compared to the control group, the expression of multiple genes in the not vaccinated–infected group was significantly upregulated, while a few genes were predominantly downregulated (Fig. 4a). Gene ontology (GO) analysis in the not vaccinated–infected group revealed that the upregulated genes were related to the immune response against the virus, for example, Irf7 and Stat1, and interferon-stimulated genes, such as Isg15, Ifit1, Ifit3, Ifit3b, and Oasl2 (Fig. 4b and d). This suggests that virus infection rapidly induces the expression of virus response genes in the lungs. In addition, the virus response genes expression was higher in the not vaccinated–infected group than the vaccinated–infected group (Fig. 4c, e), and the expression of these genes was comparable between the control and vaccinated–infected groups (Supplementary Fig. 8). Virus-induced gene expression was also observed in the spleen, but was suppressed by the PNG:RBD vaccine (Supplementary Fig. 9). These data suggest that the PNG:RBD vaccine-induced immunity rapidly eliminates the virus before a strong virus-specific response is elicited. We performed a CIBERSORTx analysis to estimate the relative abundance of immune cells in a sample using gene expression data and thereby examine the effects of the PNG:RBD vaccine on immune cells in the SARS-CoV-2-infected mice. There were no significant differences in the proportion of CD4+ T, CD8+ T, and B cells in the lungs among the four groups (Fig. 5). However, the infection induced the polarization of CD4+ T cells to Th1 phenotype. Interestingly, the PNG:RBD vaccine diminished this Th1-skewing effect. No significant changes in the proportion of other immune cells were observed after infection or vaccination (Supplementary Fig. 10). Additionally, we examined the active state of NK cells by using flow cytometry, as they have been reported to be involved in the clearance of SARS-CoV-248, but no significant differences were observed (Supplementary Fig. 11). Similar changes were observed in the spleen (Supplementary Figs. 12 and 13). Changes in cytokine expression by infection were also attenuated by the PNG:RBD vaccine (Fig. 4). These findings suggest that the rapid vaccine-mediated elimination of SARS-CoV-2 diminished the virus-induced changes in immune cell responses, such as Th1 polarization of CD4+ T cells.Fig. 4 PNG:RBD vaccine blunted inflammation-related gene expression associating virus infection.

K18-hACE2 mice were immunized with the PNG:RBD vaccine twice at a 2-week interval. At 21 days after the 2nd vaccination, mice were challenged with SARS-CoV-2. The lungs and spleens were collected 3 days post infection, and their RNA was subjected to RNA-seq analysis (3 mice in each group). a Venn diagram of overlapping genes identified in the differential expression analysis comparing the control, vaccinated–uninfected, not vaccinated–infected, and vaccinated–infected groups. b, c Gene ontology (GO) enrichment analysis of biological process terms enriched in the upregulated genes, comparing the not vaccinated–infected group with the control (b) or vaccinated–infected group (c). Heatmap representation of the average levels of genes upregulated in the not vaccinated–infected group compared with the control (d) or vaccinated–infected group (e).

Fig. 5 PNG:RBD vaccine suppressed changes in immune cell population after virus infection.

K18-hACE2 mice were immunized with the PNG:RBD vaccine twice at a 2-week interval. At 21 days after the 2nd vaccination, mice were challenged with SARS-CoV-2. The lungs were collected 3 days post infection and RNA-seq was performed (n = 3 per group). RNA-seq data were subjected to CIBERSORTx analysis. Heatmap (a) and T cell and B cell infiltration patterns (b) are shown. *p < 0.05.

PNG:RBD vaccine induces specific CD8+ T cell clones at low frequency that rapidly expand during virus infection

Since the prevention of virus infection by the PNG:RBD vaccine was dependent on CD8+ T cells (Fig. 3e), we examined the TCR repertoires in the lung and spleen after vaccination or viral infection in naïve mice. The PNG:RBD vaccine significantly increased the frequency of the top 10 clones and reduced the diversity index score (inverse Simpson’s index) in the lungs and spleens of naïve K18-hACE2 mice (Fig. 6a, b). Similar changes were observed in the infected mice (Fig. 6a, b). These findings suggest that, in naïve mice, both the PNG:RBD vaccine and virus infection predominantly induced the clonal expansion of antigen-specific T cells. Clonal expansion after PNG:RBD vaccination or viral infection was investigated in the lungs and spleens of each mouse by calculating the correlation coefficient of TCRβ CDR3. PNG:RBD vaccination significantly increased the correlation coefficient of TCRβ CDR3 between the spleen and lung compared to that in the control group, while viral infection had no effect (Fig. 6c, d). These results suggest that the vaccine induces T cells that are systemically distributed in vivo, whereas SARS-CoV-2 independently induces clonal T cell expansion in the lung and spleen. On the other hands, though the RBD alone vaccine induced the clonal expansion of antigen-specific T cells, these expansions were weak, and the change in the correlation coefficient of TCRβ CDR3 between the spleen and lung in the RBD alone vaccine group was slight (Supplementary Fig. 14a–d). These data are consistent with the data regarding RBD-specific CD8+ T cells in Fig. 2, showing that the RBD alone vaccine could not induce a strong cellular immune response against the vaccine antigen. Next, we investigated the effect of virus infection on the TCR repertoire in the vaccinated mice. We expected a greater increase in T cell clonality as the antigen-specific T cells induced by the PNG:RBD vaccine further proliferated after viral infection; unexpectedly, virus infection mitigated the increase in the proportion of the top 10 TCRs and decrease in the inverse Simpson’s index observed in the vaccinated mice (Fig. 6a, b). Furthermore, virus infection also significantly reduced the strong vaccine-induced correlation coefficient of TCRβ CDR3 between the lung and spleen (Fig. 6c, d). These findings suggest that viral infection in the vaccinated mice increases TCR diversity.Fig. 6 PNG:RBD induce the low-frequency T cells which clonal expanded after virus infection.

K18-hACE2 mice were immunized with the PNG:RBD vaccine twice at a 2-week interval. At 21 days after the 2nd vaccination, mice were challenged with SARS-CoV-2. The lungs and spleens were collected 3 days post infection and TCR repertoire analysis was performed (n = 3 per group). Frequency of the top ten clones (a) and (b) inverse Simpson’s diversity index in the lungs and spleens (n = 3 per group) was used to assess the diversity of TCR repertoires for each sample. c, d Correlation of the frequency of each T cell clone between the lungs and spleens (n = 3 per group). e Number of each meta-clonotype in the lungs and spleens (n = 3 per group). f Counts of meta-clonotypes detected in the lungs of vaccinated–infected mice. Each symbol represents three individual mice in each group. g Counts of meta-clonotypes detected in the lungs of vaccinated–infected mice. Each symbol represents an individual mouse, and the different colors represent 21 individual CDR3 clones. *p < 0.05.

We examined why virus infection increased TCR diversity even in the PNG:RBD vaccinated mice. Because specific CD8+ T cells contribute to the clearance of infected host cells during viral infection, we hypothesized that the observed change in TCR diversity by virus infection in the vaccinated mice was caused by the increase in the number of expanded specific CD8+ T cells. Given that TCRs with similar CDR3 can recognize the same antigens49, the enriched TCR clonotypes (meta-clonotypes enriched by vaccine or viral infection) are considered to be T cells specific for the respective antigens (i.e., virus or vaccine antigens)50. Additionally, since the PNG:RBD vaccine could not induce vaccine-specific CD4+ T cells (Supplementary Fig. 4), we assumed that the change in TCR diversity in the vaccinated mice was derived from antigen-specific CD8+ T cells. Therefore, we considered that changes in the meta-clonotypes reflects changes in antigen-specific CD8+ T cells. First, to examine the changes in clonal expanded CD8+ T cells, we evaluated the meta-clonotypes among the TCRs with 32 or more copies. Two meta-clonotypes were detected in both the lung and spleen of every vaccinated mouse (Fig. 6e and Table 1). Interestingly, virus infection increased the number of meta-clonotypes to seven and four in in the lungs and spleens, respectively, of the PNG:RBD vaccinated mice (Fig. 6e and Table 1). In contrast, only one meta-clonotype (with the centroid sequence CASSQDWGGYAEQFF) was detected in the lungs of unvaccinated mice, and no meta-clonotypes were detected in the spleens, even after virus infection (Fig. 6e and Table 1). Next, to examine whether meta-clonotypes detected after viral infection were already induced even at low frequency by the PNG:RBD vaccination, we again evaluated the meta-clonotypes among all TCRs, including TCRs on unexpanded T cells that contained one or more TCR copies. We defined the clonotypes in meta-clonotypes 1 to 7 detected in the lungs of vaccinated–infected mice as “the meta-clonotype conformant TCRs” (Table 1). Then, we searched the TCR repertoire, including low-frequency TCRs in other groups, of the meta-clonotype conformant TCRs. Although there was variation between individual mice, all meta-clonotypes excluding the meta-clonotype 7 conformant TCRs were detected in the lungs or spleens of vaccinated mice (Fig. 6f). In contrast, although a few meta-clonotypes were detected in unvaccinated mice, the frequency was lower than that in vaccinated mice (Fig. 6f). Similar results for a lower frequency of these meta-clonotypes were obtained in the RBD alone vaccinated mice (Supplementary Fig. 14e). Next, we compared the read counts of clonotypes for all seven meta-clonotypes among the four groups. Virus infection significantly increased the meta-clonotype number in the PNG:RBD vaccinated mice, indicating that virus infection promoted the expansion of antigen-specific T cells induced by the PNG:RBD vaccine (Fig. 6g). These findings show that an increase in TCR diversity after viral infection in the vaccinated mice is led by an increase in the frequency of various vaccine-induced antigen-specific CD8+ T cells. The induction of various antigen-specific T cells at a low frequency by vaccination before virus infection likely contributed to the increase in TCR diversity after viral infection. We confirmed that antigen-specific T cells induced by the PNG:RBD vaccine included various antigen-specific T cell clones with one copy (Supplementary Fig. 15a). Moreover, a decrease in the number of low frequent T clone or diversity index score was observed after blocking SIGN-R1. However, SIGN-R1 blocking does not influence the frequency of the top 10 clones (Supplementary Fig. 15). These results suggest that antigen presentation through SIGN-R1 may contribute to induction of TCR with low frequency but high expansion ability. Finally, we conducted a gene expression profiling analysis of antigen-specific T cells induced by the PNG vaccine using scRNA-seq to reveal the characteristics of low-frequency antigen-specific T cells. The antigen-specific CD8+ T cells were classified into seven clusters based on their gene expression profiles (Fig. 7a). The T cells in cluster 1 exhibited high expression of Cxcr3 and Gpr183; cluster 2 T cells showed elevated expression of Gzmk and Klre; cluster 3 T cells had high expression of Cd5 and Cd6, and cluster 5 T cells were characterized by high expression of Ccr7 and Sell. Additionally, although Il7r was highly expressed in cluster 5, it was also found to be expressed in other clusters (Fig. 7b, c). In contrast, Ifng was expressed in other clusters but not in cluster 5. No expression of Il2 was observed in any of the clusters, while Prf1 was expressed in all clusters (Fig. 7b, c). Next, antigen-specific T cell clones were divided into three groups according to their detection frequency, and the antigen-specific T cells in each group were characterized. Clones with a detection frequency of 2% or higher, between 0.05% and less than 2%, and lower than 0.05% were defined as high-, medium-, and low-frequency T cell clones, respectively. Most of the T cell clones with a medium or high frequency were observed in clusters 0 and 1, whereas low-frequency T cell clones were observed in those clusters, plus many in cluster 5 (Fig. 7d, e). Further analysis of expressed genes revealed that Gzma, Gzmk, and Cxcr3 were highly expressed in clones with a medium or high detection frequency, whereas Ccr7 and Sell were highly expressed in clones with a low detection frequency (Fig. 7f, g). In addition, Rgs10, involved in T cell adhesion; Rflnb, a known component of the TGF-beta pathway; and Pecam1, which is highly expressed in naïve or memory T cells in peripheral blood before TCR stimulation, were also highly expressed in low-frequency T cells (Fig. 7f, g). Considered together, these results suggest that low-frequency T cells induced by the PNG vaccine exhibit naïve or memory-like phenotypes with weak effector functions and might expand vigorously after SARS-CoV-2 infection.Table 1 List of identified meta-clonotypes

Treatment	Virus	Organ	Centroids cdr3_b_aa	CDR3 motif	Enriched clonotypes	v_b_gene	j_b_gene	
PNG:RBD	-	Lung	CASSLNNNERLFF	(SLN[RNS]NERL)	CASSLNRNERLFF	TRBV15	TRBJ1-4	
CASSLNNNERLFF	TRBV15	TRBJ1-4	
CASSLNNNERLFF	TRBV15	TRBJ1-4	
CASSLNSNERLFF	TRBV15	TRBJ1-4	
CASSRDRGNERLFF	([KS]RDRGNERL)	CASSRDRGNERLFF	TRBV13-3	TRBJ1-4	
CASSRDRGNERLFF	TRBV13-3	TRBJ1-4	
CASKRDRGNERLFF	TRBV13-3	TRBJ1-4	
Spleen	CASSLNNNERLFF	(SLNNNERL)	CASSLNNNERLFF	TRBV15	TRBJ1-4	
CASSLNNNERLFF	TRBV15	TRBJ1-4	
CASSLNNNERLFF	TRBV15	TRBJ1-4	
CAWRDWGSQNTLYF	([RK][DH]WGSQNTL)	CAWRDWGSQNTLYF	TRBV31	TRBJ2-4	
CAWRDWGSQNTLYF	TRBV31	TRBJ2-4	
CAWKHWGSQNTLYF	TRBV31	TRBJ2-4	
Control	Infected	Lung	CASSQDWGGYAEQFF	(SQDWGGYAEQ)	CASSQDWGGYAEQFF	TRBV5	TRBJ2-1	
CASSQDWGGYAEQFF	TRBV5	TRBJ2-1	
CASSQDWGGYAEQFF	TRBV5	TRBJ2-1	
PNG:RBD	Infected	Lung	CASSLNNNERLFF	(SLN[RN]NERL)	CASSLNNNERLFF	TRBV15	TRBJ1-4	
CASSLNNNERLFF	TRBV15	TRBJ1-4	
CASSLNRNERLFF	TRBV15	TRBJ1-4	
CASSLNNNERLFF	TRBV15	TRBJ1-4	
CASSDWGNQDTQYF	(SDWG[ND]QDTQ)	CASSDWGNQDTQYF	TRBV13-3	TRBJ2-5	
CASSDWGDQDTQYF	TRBV13-3	TRBJ2-5	
CASSDWGNQDTQYF	TRBV13-3	TRBJ2-5	
CASSDWGNQDTQYF	TRBV13-3	TRBJ2-5	
CASSPRQGGNTEVFF	(S[LP]RQG[AG][ND]TEV)	CASSLRQGGNTEVFF	TRBV5	TRBJ1-1	
CASSPRQGADTEVFF	TRBV5	TRBJ1-1	
CASSPRQGGNTEVFF	TRBV5	TRBJ1-1	
CASSLRQGGNTEVFF	(S[LP]RQG[AG]NTEV)	CASSLRQGGNTEVFF	TRBV5	TRBJ1-1	
CASSLRQGANTEVFF	TRBV5	TRBJ1-1	
CASSPRQGGNTEVFF	TRBV5	TRBJ1-1	
CASSLLGGRDTQYF	(SLLGGRDTQ)	CASSLLGGRDTQYF	TRBV16	TRBJ2-5	
CASSLLGGRDTQYF	TRBV16	TRBJ2-5	
CASSLLGGRDTQYF	TRBV16	TRBJ2-5	
CASSPDRIAEVFF	(S[RP]DR[GIV]?[AG]E[QV])	CASSPDRGEVFF	TRBV14	TRBJ1-1	
CASSPDRVAEQFF	TRBV14	TRBJ2-1	
CASSPDRIAEVFF	TRBV14	TRBJ1-1	
CASSRDRGAEVFF	TRBV14	TRBJ1-1	
CAWNHNYAEQFF	([ND][HFS]NYAEQ)	CAWNHNYAEQFF	TRBV31	TRBJ2-1	
CACDSNYAEQFF	TRBV31	TRBJ2-1	
CAWDFNYAEQFF	TRBV31	TRBJ2-1	
Spleen	CASSLNNNERLFF	(SLN[NG]NERL)	CASSLNNNERLFF	TRBV15	TRBJ1-4	
CASSLNNNERLFF	TRBV15	TRBJ1-4	
CASSLNGNERLFF	TRBV15	TRBJ1-4	
CASSLNNNERLFF	TRBV15	TRBJ1-4	
CASSQDWGQDTQYF	(SQDWGQDTQ)	CASSQDWGQDTQYF	TRBV5	TRBJ2-5	
CASSQDWGQDTQYF	TRBV5	TRBJ2-5	
CASSQDWGQDTQYF	TRBV5	TRBJ2-5	
CASSPSSYEQYF	(SPSSYEQ)	CASSPSSYEQYF	TRBV3	TRBJ2-7	
CASSPSSYEQYF	TRBV3	TRBJ2-7	
CASSPSSYEQYF	TRBV3	TRBJ2-7	
CGARDWGSSYEQYF	(RDWGSSYEQ)	CGARDWGSSYEQYF	TRBV20	TRBJ2-7	
CGARDWGSSYEQYF	TRBV20	TRBJ2-7	
CGARDWGSSYEQYF	TRBV20	TRBJ2-7	
Naked RBD	-	Lung	CASSLGQYTEVFF	(S[LS]GQ[HY]TEV)	CASSLGQYTEVFF	TRBV12-1	TRBJ1-1	
CASSLGQGYTEVFF	TRBV12-1	TRBJ1-1	
CASSLGQYTEVFF	TRBV12-1	TRBJ1-1	
CASSSGQHTEVFF	TRBV12-1	TRBJ1-1	
CTCSAGTGGAPDTQYF	(SA[G]TGG[A][QP]DTQ)	CTCSATFFAQDTQYF	TRBV1	TRBJ2-5	
CTCSAGTGGAPDTQYF	TRBV1	TRBJ2-5	
CTCSAGTGGQDTQYF	TRBV1	TRBJ2-5	
CASSPSSYEQYF	(SPSSYEQ)	CASSPSSYEQYF	TRBV3	TRBJ2-7	
CASSPSSYEQYF	TRBV3	TRBJ2-7	
CASSPSSYEQYF	TRBV3	TRBJ2-7	

Fig. 7 Characteristics of antigen-specific low-frequency T cells.

K18-hACE2 mice were immunized twice with the PNG:RBD vaccine at a 2-week interval. Splenocytes were collected 21 days after the second vaccination, and scRNA-seq was performed (pooled from three mice). a Uniform Manifold Approximation and Projection (UMAP) of the expression profiles of antigen-specific T cells induced by PNG:RBD vaccine. CD8+ T cells are classified into seven distinct transcriptional clusters. b Relative expression of the top ten most differentially expressed genes in each cluster. c Violin plots quantifying the relative transcriptional expression of genes of memory naïve markers, exhausted markers, and cytokines. d, e UMAPs of T cells in each frequency group. f Relative expression of the top ten most differentially expressed genes in each frequency group. g Analysis of genes differentially expressed between mid- and high-frequency and low-frequency antigen-specific T cells.

Discussion

Using PNG, a lymph node macrophage-selective delivery system, we successfully developed a novel protein vaccine that strongly induces antigen-specific CD8+ T cells and antibodies. This study is the first to demonstrate that PNG binds to the CRD domain of SIGN-R1 on mouse medullary macrophages and efficiently delivers antigens to these cells. We previously showed that medullary macrophages can strongly activate vaccine-specific CD8+ T cells in the presence of TLR stimulation. Several studies showed that antigen delivered through specific C-type lectin receptor, such as DEC-205 or mannose receptor51–54, to antigen-presenting cells is efficiently presented to CD8+ T cells as cross-presentation, therefore it is possible that vaccine antigens incorporated by medullary macrophages through SIGN-R1 may also be presented to T cells efficiently via a similar mechanism. Indeed, it was previously demonstrated that DC-SIGN, a human counterpart of murine SIGN-R1, efficiently internalize bound antigen and present it to T cells55. These findings support the efficacy of the SIGN-R1-targeting by the PNG vaccine delivery system to induce a strong CD8+ T cell response, which is considered the key underlying mechanism for virus clearance. In humans, DC-SIGN (CD209) is also highly expressed in lymph node medullary macrophages56. Therefore, the PNG-based vaccine shows great potential for translation into human subjects. However, the roles and functions of human lymph node medullary macrophages are still elusive, and require further research. We also demonstrated that virus clearance by the PNG:RBD vaccine is dependent on both CD8+ T cells and antibodies. Previous studies have suggested that CD8+ T cells are not associated with vaccine-induced viral clearance, whereas others suggested that virus-specific CD8+ T cells contribute to viral clearance. In natural infections, CD8+ T cells have been demonstrated to contribute significantly to viral clearance when antiviral antibodies have a low contribution32. We employed the RBD fragment of the S protein of SARS-CoV-2 as the vaccine antigen in this study. In general, the binding of vaccine-induced antibodies to the S protein is relatively weak when a partial fragment of the S protein is used, since the conformation of the fragment is different from that of the full-length S protein. Although we confirmed the clear inhibition of binding between RBD and hACE2 by vaccine-induced serum antibodies, the affinity of these antibodies might be relatively low and may lead to the observed contribution of vaccine-induced CD8+ T cells in virus clearance. Therefore, our findings are especially meaningful in the contexts where neutralizing antibodies are not effective. For example, for variants of concern (VOCs), such as the Omicron strain, that evade antibodies induced by conventional vaccines, vaccines that strongly induce cellular immunity, including our pullulan PNG-based vaccine, could be effective.

CD8+ T cell-dependent elimination of viral infection is accompanied by the accumulation of neutrophils in the lungs, inducing intense inflammation57. However, in this study, such strong inflammatory responses or changes in inflammation-related gene expression were not observed in the vaccinated mice, as determined by RNA-seq. Additionally, there were no significant differences in the gene expression signatures between the vaccinated and control mice, as determined by CIBERSORT. This may be due to a rapid clearance of the virus by vaccine-induced immune responses prior to the establishment of SARS-CoV-2 infection.

In this study, vaccination with the PNG:RBD vaccine significantly increased TCR clonality in the lungs and spleens, which corresponded to a strong correlation of TCR repertoires between these organs (Fig. 6c,d). In the vaccinated group, TCR clonality was increased by vaccination but decreased after virus infection. In addition, the correlation of TCR repertoires between the lungs and spleens was low compared with that in the vaccinated mice prior to virus challenge. As SARS-CoV-2 infects host respiratory cells after exposure through inhalation and spreads systemically thereafter, the immune responses against the virus in each organ may develop independently at first58, which is consistent with our finding of unique TCR profiles between the lung and spleen.

We performed meta-clonotype analysis of the TCR repertoire to explore the changes in TCRs in more detail. Meta-clonotype analysis is a method to group TCRs based on the CDR3 sequence and biochemical characteristics. The CDR3 sequence in TCR is highly associated with the antigen recognized by TCR, and TCRs with similar CDR3 sequences are considered to recognize the same antigen. A previous study reported that meta-clonotypes targeting specific antigens were detected in more than 59.7% of COVID-19 patients59. In the vaccinated mice in this study, virus infection increased TCR diversity and detectable meta-clonotypes, suggesting that virus infection expanded the antigen-specific CD8+ T cell clones. It is possible that antigen-specific TCRs that were first infrequent post-vaccination expanded with viral infection and became detectable. Meta-clonotypes detected after viral infection were also detected at a low frequency before viral challenge in the vaccinated mice, showing that these meta-clonotype T cells were already induced by the vaccine, although at a very low rate. Considering that TCR diversity is correlated with the efficacy of preventive vaccination after virus infection60,61 and that the rate of meta-clonotypes detected at high frequency after vaccination was significantly reduced after viral infection, we hypothesized that virus-specific T cells induced by the vaccine at high frequency might not necessarily contribute to the elimination of the virus, and that the low-frequency vaccine-elicited T cells might contribute more to the clearance of SARS-CoV-2 in the lung after vaccination.

Several studies have described antigen-specific T cells with high proliferative abilities. The BioNTech mRNA vaccine can induce vaccine-specific stem cell memory T cells with a high proliferative ability, while the PNG:RBD vaccine induces vaccine-specific CD8+ T cells, including various clones showing naïve or memory-like phenotype. These findings suggest that a large number of poor-quality antigen-specific CD8+ T cells in vaccinated patients may not confer the protection against viral infection, or the protection against viral infection may be achieved even if antigen-specific T cells are not detected after vaccination if these T cells are highly reactive to restimulation. In antibody-dependent defense against infection, the number of antigen-specific antibodies, which block the binding of the receptor to the virus, is important in controlling viral infection. However, in the protection against viral infection by cellular immune responses, the quality of antigen-specific T cells may be more important than their numbers.

It is believed that in the defense against viral infection at local sites by cellular immune responses with prophylactic vaccines, virus-specific vaccine-induced T cells proliferate explosively and eliminate virus-infected cells after recognizing viral antigens; however, it is unclear how vaccine-induced T cells eliminate the virus after infection in the lungs, for example. Since the TCR repertoires differ greatly among individual mice, it is difficult to analyze changes over time, for example, by comparing the repertoire before and after vaccination. In this study, we overcame this limitation and were able to detect the changes in the TCR repertoires in the lungs using meta-clonotype analysis.

Current vaccines depending on CD8+ T cells exert their protective effects when vaccine-specific T cells are activated by viral infection in vivo, but our study suggests that a comprehensive activation of T cells with various properties to the virus-specific antigen (same antigen) can lead to the efficient removal of virus-infected cells and, ultimately, virus elimination. Future studies should consider developing a vaccine that more efficiently eliminates SARS-CoV-2 by inducing a higher diversity of antigen-specific CD8+ T cells.

Methods

Mice

B6.Cg-Tg(K18-ACE2)2Prlmn/J mice (K18-hACE2), C57BL/6JJcl, and BALB/c mice were purchased from Jackson Laboratory or Japan SLC respectively. DUC18 mice, transgenic for TCRα/β-reactive with a Kd-restricted 9 m epitope, were established as previously described62. The mice were maintained at the Animal Center of Nagasaki University Graduate School of Medicine (Nagasaki, Japan) and were used at 7–11 weeks of age. The experimental protocol was approved by the Ethics Review Committee for Animal Experimentation of Nagasaki University Graduate School of Medicine (Approval no. 201007-1). SARS-CoV-2 infection experiments were conducted in a BSL-3 facility in accordance with local regulations and biosafety guidelines.

Cell lines and virus propagation

HeLa cells were cultured in DMEM containing 10% fetal bovine serum (FBS, NICHIREI) and antibiotics at 37 °C in 5% CO2. Vero 9013 cells (Japan Health Science Research Resources Bank) were cultured as previously described in Eagle’s Minimum Essential Medium (EMEM, Sigma-Aldrich, St. Louis, MO, USA) supplemented with 10% fetal calf serum (FCS, Gibco) without antibiotics at 37 °C in 5% CO2. SARS-CoV-2 (TY-WK-521/2020 strain) was propagated in Vero 9013 cells at 37 °C and 5% CO2 for up to 6 days.

Immunization of mice

The PNG:RBD vaccine (20 μg protein) or 20 μg of RBD alone protein or was mixed with 25 μg K3 CpG oligoDNA in 100 μL PBS and then subcutaneously injected into the right flank of mice at a 2-week interval after anesthetization with inhalation of 3–5% isoflurane. For the depletion of CD8+ T and B cells, anti-CD8 and anti-CD20 antibodies (100 μg/mouse), respectively, were intravenously injected into the mice. The PNG-long peptide antigen complex was subcutaneously injected into the back of BALB/c mice at a dose of 20 μg peptide.

Virus challenge in mice

K18-hACE2 transgenic mice were lightly sedated with inhalation isoflurane and intranasally infected with SARS-CoV-2 virus at a dose of 5 × 104 PFU/mouse. Non-infected control mice were inoculated with vehicle medium. The infected mice were euthanized, and saliva and selected tissues were collected for further analysis.

Antibodies and reagents

Phycoerythrin (PE)-conjugated anti-CD8 monoclonal antibody (mAb, 53-6.7, rat IgG2a), Brilliant Violet 421-conjugated anti-CD197 mAb (4B12, rat IgG2a), Brilliant Violet 711-conjugated anti-mouse CD127 mAb (A7R34, rat IgG2a), PE/Cyanine7-conjugated anti-mouse/human CD45R/B220 mAb (RA3-6B2, rat IgG2a), allophycocyanin (APC)/Cyanine7-conjugated anti-mouse/human CD44 mAb (IM7, rat IgG2b), APC-conjugated anti-mouse CD206 mAb (C068C2, rat IgG2a), Brilliant Violet 510-conjugated anti-mouse/human CD11b mAb (M1/70, rat IgG2b), APC/Cyanine7-conjugated anti-mouse CD11c mAb (N418, Armenian Hamster IgG), PerCP/Cyanine5.5-conjugated anti-mouse CD169 mAb (3D6.112, rat IgG2a), APC-conjugated anti- mouse/human KLRG1 (MAFA) mAb (2F1/KLRG1, Syrian Hamster IgG), PE-conjugated anti-mouse NKG2A mAb (16A11, mouse IgG2b), PerCP/Cyanine5.5-conjugated anti-mouse CD3 mAb (17A2, rat IgG2b), PE/Cy7-conjugated anti-mouse CD49b mAb (DX5, rat IgM), Brilliant Violet 421-conjugated anti-mouse CD25 mAb (PC61, rat IgG1), FITC-conjugated anti-mouse CD4 mAb (GK1.5, rat IgG2b), PerCP/Cyanine5.5-conjugated anti-mouse CD27 mAb (LG.3A10, Armenian hamster IgG), PE-conjugated anti-mouse CD137 mAb (1AH2, rat IgG1), PE/Cy7-conjugated anti-mouse GITR mAb (DTA1, rat IgG2b), Brilliant Violet 650-conjugated anti-mouse CD69 mAb (H1.2F3, Armenian hamster IgG) were purchased from BioLegend (San Diego, CA, USA). FITC-conjugated anti-CD8 mAb (KT15, rat IgG2a), anti-mouse Mincle mAb (4A9, rat IgG1), Peroxidase-conjugated anti-mouse IgG (H + L chain), anti-mouse IgG1 (H + L chain), and anti-mouse IgG2 (H + L chain) were purchased from MBL (San Diego, CA, USA). For tetramer staining, S539-specific tetramers were generated as per the manufacturer’s instructions (QuickSwitchTM Quant H-2Kb tetramer kit, MBL) with RBD peptide (S539, 10 μM). APC-conjugated anti-interferon-gamma (XMG1.2, rat IgG1) was purchased from eBioscience (San Diego, CA, USA). APC-conjugated anti-mouse CD209a (5H10, rat IgG2a), PE-conjugated anti-mouse CD137 mAb (1AH2, rat IgG1), and PE/Cy7-conjugated anti-mouse GITR mAb (DTA1, rat IgG2b) was purchased from BD Biosciences (Oxford, UK). FITC-conjugated anti-mouse Dectin1 (2A11, rat IgG2b) was purchased from Bio-Rad Laboratories (Hercules, CA, USA). FITC-conjugated anti-Rat IgG (H + L) Secondary Antibody (2A11, rat IgG2b) was purchased from Thermo Fisher Scientific. Depleting antibodies, including anti-CD8α (clone 53-6.7) and anti-CD20 (clone MB20-11), and the blocking antibody anti-CD209b (clone 22D1) were purchased from Bio X Cell (Lebanon, NH, USA). RBD peptides (S395, S511, and S539) were obtained from GenScript (Tokyo, Japan). A phosphorothioate oligodeoxynucleotide containing an unmethylated CpG motif (K3 CpG ODN, 5′-ATCGACTCTCGAGCGTTCTC-3′) was synthesized by Gene Design (Osaka, Japan). The C-type lectin complementary DNA (cDNA) plasmids were purchased from Genecopoeia (Rockville, MD, USA).

Uptake of PNG in mouse C-type lectin-expressing cells

Each C-type lectin cDNA plasmid was introduced into HeLa cells by electroporation and seeded onto a 24-well plate. The next day, the cells were incubated with 2 μg/mL rhodamine-labeled PNG at 37 °C for 30 min. Anti-CD209b antibody (22D1) was added to the wells 1 h before the addition of rhodamine-labeled PNG for blocking. The rhodamine signal was measured by flow cytometry (BD LSR Fortessa X-20) or microscopy (Keyence). The data were analyzed using FlowJo software (TOMY Digital Biology, Tokyo, Japan).

Tracking of subcutaneously injected PNG

Rhodamine-labeled PNG was subcutaneously injected into the right flank of the mice. Immune cells were collected from the inguinal DLN 10 min after injection and analyzed by flow cytometry (BD LSR Fortessa X-20) to measure the rhodamine signal in lymph node macrophages. The data were analyzed using FlowJo software. Cryosections of the inguinal DLN were prepared for immunohistochemistry. OCT-embedded sections were stained with a fluorescent dye-conjugated anti-CD209b antibody and observed under a fluorescence microscope. Anti-CD209b antibody was subcutaneously injected into mice 1 h before the administration of rhodamine-PNG for blocking.

Ex vivo antigen presentation

Antigen presentation by macrophages was evaluated ex vivo by measuring antigen-specific proliferation of CD8+ T cells as previous report39. Briefly, PNG-mutated ERK2 long peptide antigen (NDHIAYFLYQILRGLQYIHSANVLHRDLKPSNLLLNT) complex and CpG ODN were subcutaneously injected into BALB/c mice. Anti-CD209b antibody was subcutaneously injected into mice 1 h before the administration of PNG-antigen for blocking. The lymph node was resected 18 h after injection and macrophages were purified with anti-CD11b microbeads (Miltenyi Biotec). Isolated cells were cocultured with 1.0 × 105 DUC18 T cells prelabeled with a Farred dye for 72 h. T cell proliferation was determined by quantifying dye dilution on a flow cytometry (BD LSR Fortessa X-20). The data were analyzed using FlowJo software (TOMY Digital Biology, Tokyo, Japan).

PNG:RBD vaccine

We produced a recombinant RBD fragment of the SARS-CoV-2 S protein (319–546 aa) fused to a leader sequence and a histidine tag at the N and C terminus, respectively. The protein was expressed in CHO-K1 cells and purified using Ni-NTA affinity and gel filtration chromatography. Protein purity was confirmed by SDS-PAGE and SE-HPLC. Cholesteryl pullulan was purchased from NOF Co. Ltd. (Tokyo, Japan). A solution of cholesteryl pullulan phosphate-buffered saline (PBS) containing 6 M urea was combined with a solution of RBD protein. The mixture was gently stirred at 4 °C overnight and subjected to dialysis against PBS to remove urea. During this step, the protein was incorporated into the PNG formed by the self-assembly of cholesteryl pullulan. Formation of the complex between the protein and PNG was confirmed by SE-HPLC. The obtained solution was stored at 4 °C until use.

Intracellular cytokine and tetramer staining

For intracellular cytokine staining, vaccinated or infected mice were anesthetized under isoflurane inhalation (3–5%), and splenocytes were collected. The splenocytes were then incubated with a synthetic RBD-derived CD8+ T cell epitope peptide for 30 min at 37 °C, incubated for an additional 16 h with GolgiPlug (BD Biosciences), and stained with a PE-conjugated anti-CD8 mAb. Permeabilization and fixation were performed using a Cytofix/Cytoperm kit (BD Biosciences) according to the manufacturer’s instructions. The cells were stained intracellularly with an APC-conjugated anti-IFN-γ antibody and analyzed on a flow cytometer (FACS Canto II) after being washed. The data were analyzed using FlowJo software. Tetramer staining was performed as previously described63. Briefly, cells were stained with PE-labeled S395/Kb tetramer for 15 min at room temperature and then stained with antibodies for surface markers for 15 min at 4 °C. After washing, the cells were analyzed using flow cytometry.

RBD antibody ELISA

RBD protein-specific antibody responses were assessed using ELISA. Briefly, the recombinant RBD protein was absorbed onto a immunoplates (Nunc, Roskilde, Denmark) at a concentration of 10 ng/50 μL/well at 4 °C. The serum collected from the immunized mice was diluted from 1:300 to 1:8,100. After washing and blocking the plate, diluted sera were added and incubated for 10 h. After washing, peroxidase-conjugated anti-mouse IgG (H + L chain), anti-mouse IgG1 (H + L chain), or anti-mouse IgG2 (H + L chain; MBL, Nagoya, Japan) was added. After adding TMB substrate (Pierce, Rockford, IL, USA), the plate was analyzed using a microplate reader (Model 550, Bio-Rad Laboratories).

Neutralization activity

Virus titration was performed using a conventional plaque assay. The cells were seeded in 12-well plates with 1 mL EMEM supplemented with 10% FBS and incubated at 37 °C in 5% CO2 overnight to allow the formation of a monolayer. Mouse plasma samples were serially diluted two-fold in EMEM from 1:10 to 1:1,280. A total of 50 µL of virus mixture (100 PFU per well) was added to equal amounts of diluted plasma. The virus and antibody mixture was incubated at 37 °C for 60 min, and 100 µL of serially diluted sample was added to each well. At least two replicates were performed for each sample. The plates were incubated at 37 °C in 5% CO2 for 60 min, with plate tilting every 10 min. After incubation, 1 mL of overlay medium was added to each well. After 4 days of incubation, the cells were fixed with 4% paraformaldehyde for 1 h at room temperature and stained with 0.25% crystal violet (Wako Pure Chemical Industries, Osaka, Japan). After washing and drying the plates, the number of plaques was counted with the naked eye. Neutralization was defined as a 50% or higher plaque reduction compared to that in the control (infection in the absence of plasma).

Viral RNA quantitation

Viral RNA was extracted from 100 μL of liquid samples using a Quick Viral RNA kit (Zymo Research, Tustin, CA, USA), and the SARS-CoV-2 E gene was amplified using quantitative RT-PCR64. Used primers are shown in Table 2. Viral RNA was subjected to quantitative RT-PCR as previously described65.Table 2 Primers used in this study

Identification	Sequence	
BSL-18E	AAAGCGGCCGCATGCTTTTTTTTTTTTTTTTTTVN	
P20EA	TAATACGACTCCGAATTCCC	
P10EA	GGGAATTCGG	
P22EA-ST1-R	GTCTCGTGGGCTCGGAGATGTGTATAAGAGACAGCTAATACGACTCCGAATTCCC	
mCB1	AGGATTGTGCCAGAAGGTAG	
mCB2	TTGTAGGCCTGAGGGTCC	
mCB-ST1-R	TCGTCGGCAGCGTCAGATGTGTATAAGAGACAGGTTGGGTGGAGTCACATTT	
N_Sarbeco_F1	CACATTGGCACCCGCAATC	
N_Sarbeco_R1	GAGGAACGAGAAGAGGCTTG	
N_Sarbeco_P1-FAM	ACTTCCTCAAGGAACAACATTGCCA-BBQ	

RNA-seq

RNA was extracted from organs collected 3 days post infection, and RNA quality was assessed using spectrophotometry and an Agilent Bioanalyzer 2100 (Agilent Technologies). The total RNA library was prepared using a SMART-Seq® HT Kit (Takara Bio USA, Mountain View, CA, USA) and Nextera XT DNA Library Prep Kit (Illumina, San Diego, CA, USA). An Illumina NovaSeq 6000 system (Illumina) was used to sequence the libraries for 2 × 150 cycles. RNA-seq data are available in the DNA Data Bank of Japan (DDBJ) under accession numbers DRA016618.

Unbiased amplification of TCR genes with AL-PCR

Total RNA was converted to cDNA using Superscript III reverse transcriptase (Invitrogen). TCR genes were amplified by adaptor ligation-mediated PCR66,67. Used primers are shown in Table 2. High-throughput sequencing was performed using an Illumina MiSeq paired-end platform (2 × 300 bp, Illumina). TCR sequence data are available in the DDBJ under accession numbers DRA016643.

Assignment of TRAV, TRAJ, TRBV, and TRBJ segments

Assignment of TRAV, TRAJ, TRBV, and TRBJ segments in TCR genes was performed based on the international ImMunoGeneTics information system® database (http://www.imgt.org). Data processing, assignment, and aggregation were automatically performed using repertoire analysis software originally developed by Repertoire Genesis (Osaka, Japan).

Analysis of TCR data

A unique sequence read (USR) was defined as one having no identity in TRBV, TRBJ, and deduced amino acid sequence of CDR3 with the other sequence reads. The copy numbers of identical USRs were automatically counted using Repertoire Genesis software for each sample and then ranked in order of copy number. We then calculated the percentage occurrence frequencies of sequence reads with TRBV and TRBJ genes from the total sequence reads.

Immune infiltration analysis based on cell type identification by CIBERSORTx

CIBERSORTx (https://cibersort.stanford.edu/) was used to analyze the immune landscape of the lung and spleen with RNA-seq data used as the gene expression input and 511 mouse gene expression (25 immune cell types)68 set as the signature gene file. The generated CIBERSORTx values were defined as the immune cell infiltration fraction per sample.

Identification of expanded meta-clonotypes

We used tcrdist3 (v0.2.2), which implements the TCR distance metric, to search for candidate antigen-associated TCRs that are likely to confer immunity against SARS-CoV-2. Based on the idea that the same or similar clonotypes tend to appear in multiple samples from a similar antigen-stimulated population, this framework defines a “meta-clonotype” as a set of similar TCR clonotypes shared by multiple samples from a target population compared to a control background. In short, it enables efficient identification of the sequence space in which TCRs sharing a high degree of sequence similarity in terms of biochemical features and motifs of CDR3 are enriched among a target population. As a data preprocessing step for meta-clonotype identification, we selected clonotypes with at least 32 reads detected in each sample in the same group to reduce computational cost and focus on clonally expanded T cells. Following the documentation of tcrdist3, we set the background repertoire to 200,000 synthetic TCRs with a matching V-J gene and 100,000 randomly subsampled TCRs from samples of the control group as an antigen-naïve population. In searching meta-clonotypes, tcrdist3 computes a TCRdist distance matrix between all given clonotypes. The centroids of the meta-clonotype are identified by the enrichment of neighbor clonotypes from multiple samples in the target population compared to the background within the optimized radii. The optimized radius was defined for each clonotype by the relative density of adjacent TCRs in the background. In our case, the largest radius was set within a reasonable scope that contained less than an estimated proportion of 1E − 5 TCRs in the background, along with an upper radius limit (24 TCRdist units). Furthermore, we added a constraint that meta-clonotypes are formed from clonotypes from all samples in the same group.

Preparation of single-cell complementary DNA libraries

Splenocytes isolated from the vaccinated mice were stained with PE-labeled S395/Kb tetramer for 15 min at room temperature and then stained with antibodies for surface markers for 15 min at 4 °C. Zombie NIR Fixable Viability Kit (BioLegend) was used to exclude dead cells. RBD-specific CD8+ T cells were sorted on an Aria III (BD Biosciences). Single-cell suspensions were subjected to GEM (Gel Bead-In Emulsions) generation and barcoding using the Chromium Next GEM Single Cell 5′ GEM Kit V.2 (PN-1000244) on the Chromium Next GEM Chip K Single Cell Kit (PN-1000286), according to the manufacturer’s instructions (10x Genomics, Pleasanton, California, USA). Collected complementary DNAs (cDNAs) from GEMs were amplified, and TCR target amplification was performed using a TCR Amplification Kit (PN-1000254). The TCR and gene expression cDNA libraries were constructed using the Library Construction Kit (PN-1000190). The cDNA was sequenced using a NovaSeq System (Illumina, San Diego, California, USA) with a pair-end 150 bp sequencing strategy.

Preprocessing of paired scRNA-seq and scTCR-seq data

Raw sequencing data for RNA expression and VDJ from mouse CD8+ T scRNA-seq were processed using Cell Ranger software (V.6.0.1; 10x Genomics). RNA expression data were aligned to the mm10 reference genome and VDJ sequencing data to the GRCm38 VDJ reference pre-built by 10x Genomics. Gene expression count matrices were imported into the R package Seurat (V.4.1.0) using R (V.4.1.3). Cells were filtered to retain those with ≤10% mitochondrial RNA content and several unique molecular identifiers numbered between 200 and 5000. RNA expression data were normalized against total expression per cell and natural log transformed with a scale factor of 10,000. Counts were log-normalized, scaled, and centered. The 2000 most-variable features were calculated with variance-stabilizing transformation and used for principal component analysis. Clustering was performed with Seurat: FindClusters, with the resolution set to 0.2. Dimension reduction was performed with Uniform Manifold Approximation and Projection. scRNA-seq and scTCR-seq data are available in the DDBJ under accession numbers DRA007761.

Statistical analysis

Data obtained in the virus challenge experiment were analyzed using the Steel–Dwass test. Data from the other experiments were analyzed using unpaired two-tailed Student’s t tests and one-way or two-way analysis of variance (ANOVA) with a multiple comparisons Bonferroni post hoc test. Statistical significance was set at p < 0.05. FDR was calculated to compare RNA-seq data between multiple groups. A p value or FDR less than 0.05 was considered to indicate statistical significance. All error bars represent mean ± SD. The Kaplan–Meier method was used for survival analysis, using SPSS Advanced Statistics (v28, IBM SPSS, Armonk, NY, USA). All other statistical analyses were performed using R software (v4.2.2, The R Foundation for Statistical Computing, Vienna, Austria).

Supplementary information

Supplemental

Supplementary information

The online version contains supplementary material available at 10.1038/s41541-024-00961-6.

Acknowledgements

We thank Yamaguchi Sayuri, Akane Katagiri, Minami Isaka, Kirara Iwanaga, Kazumi Haga, Rieko Haraguchi, and Shashika Lavangi Wijesooriya; members of the Department of Virology, Institute of Tropical Medicine, Nagasaki University; members of the Department of Developmental Medicine, Graduate School of Medicine, University of Tokyo; and staff of United Immunity and Repertoire Genesis Ltd. for providing technical assistance, advice, and support. We would like to acknowledge Drs. Makoto Takeda, Masayuki Saijo, and Mutsuo Ito of the National Institute of Infectious Diseases, Japan, for providing the SARS-CoV-2 strain (2019-nCoV/Japan/TY/WK-521/2020). We would also like to express our deepest gratitude to Drs. Koichi Morita and Ngwe Tun Mya Myat of Nagasaki University for assistance in the use of the animal facility regarding the SARS-CoV-2 animal experiments. This study was supported by Japan Agency for Medical Researchs and Development under grant number JP20pc0101048, JP21wm0125006, and JP223fa627001 to M.L.M. or N.H., and 243fa727001h0003 to K.A.

Author contributions

D.M. and M.L.M. designed the experiments; D.M., M.L.M., T.N., S.D., C.T., H.H., Y.H., N.H., and T.T.N.N. performed the experiments; D.M. analyzed the data; M.L.M., N.H., T.S., S.S., N.T.M.M., K.A., H.M., T.N., and H.I. contributed reagents, materials, and analytical tools; O.M. and R.Y. analyzed the TCR-seq data; D.M., M.L.M., O.M., and N.H. wrote the original draft of the paper; all authors approved the final draft for journal submission.

Data availability

Data supporting the findings of this study are available in this paper, Supplementary information, or are available from the corresponding authors, Daisuke Muraoka (d.muraoka@aichi-cc.jp) upon request. All sequence data are available from DDBJ (https://www.ddbj.nig.ac.jp/index.html).

Competing interests

Y.H., T.S., and N.H. is an employee, Chief Scientific Officer, and Chairman of United Immunity, Co., Ltd., respectively. The other authors declare no conflicts of interest.

Publisher’s note Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

These authors contributed equally: Daisuke Muraoka, Meng Ling Moi.
==== Refs
References

1. Zhu N A novel coronavirus from patients with pneumonia in China, 2019 N. Engl. J. Med. 2020 382 727 733 10.1056/NEJMoa2001017 31978945
Zhu, N. et al. A novel coronavirus from patients with pneumonia in China, 2019. N. Engl. J. Med. 382, 727–733 (2020).31978945
2. Huang C Clinical features of patients infected with 2019 novel coronavirus in Wuhan, China Lancet 2020 395 497 506 10.1016/S0140-6736(20)30183-5 31986264
Huang, C. et al. Clinical features of patients infected with 2019 novel coronavirus in Wuhan, China. Lancet 395, 497–506 (2020).31986264
3. Wu F A new coronavirus associated with human respiratory disease in China Nature 2020 579 265 269 10.1038/s41586-020-2008-3 32015508
Wu, F. et al. A new coronavirus associated with human respiratory disease in China. Nature 579, 265–269 (2020).32015508
4. Polack FP Safety and efficacy of the BNT162b2 mRNA Covid-19 vaccine N. Engl. J. Med. 2020 383 2603 2615 10.1056/NEJMoa2034577 33301246
Polack, F. P. et al. Safety and efficacy of the BNT162b2 mRNA Covid-19 vaccine. N. Engl. J. Med. 383, 2603–2615 (2020).33301246
5. Ramasamy MN Safety and immunogenicity of ChAdOx1 nCoV-19 vaccine administered in a prime-boost regimen in young and old adults (COV002): a single-blind, randomised, controlled, phase 2/3 trial Lancet 2021 396 1979 1993 10.1016/S0140-6736(20)32466-1 33220855
Ramasamy, M. N. et al. Safety and immunogenicity of ChAdOx1 nCoV-19 vaccine administered in a prime-boost regimen in young and old adults (COV002): a single-blind, randomised, controlled, phase 2/3 trial. Lancet 396, 1979–1993 (2021).33220855
6. Sadoff J Safety and efficacy of single-dose Ad26.COV2.S vaccine against Covid-19 N. Engl. J. Med. 2021 384 2187 2201 10.1056/NEJMoa2101544 33882225
Sadoff, J. et al. Safety and efficacy of single-dose Ad26.COV2.S vaccine against Covid-19. N. Engl. J. Med. 384, 2187–2201 (2021).33882225
7. Voysey M Safety and efficacy of the ChAdOx1 nCoV-19 vaccine (AZD1222) against SARS-CoV-2: an interim analysis of four randomised controlled trials in Brazil, South Africa, and the UK Lancet 2021 397 99 111 10.1016/S0140-6736(20)32661-1 33306989
Voysey, M. et al. Safety and efficacy of the ChAdOx1 nCoV-19 vaccine (AZD1222) against SARS-CoV-2: an interim analysis of four randomised controlled trials in Brazil, South Africa, and the UK. Lancet 397, 99–111 (2021).33306989
8. Baden LR Efficacy and safety of the mRNA-1273 SARS-CoV-2 vaccine N. Engl. J. Med. 2021 384 403 416 10.1056/NEJMoa2035389 33378609
Baden, L. R. et al. Efficacy and safety of the mRNA-1273 SARS-CoV-2 vaccine. N. Engl. J. Med. 384, 403–416 (2021).33378609
9. Lan J Structure of the SARS-CoV-2 spike receptor-binding domain bound to the ACE2 receptor Nature 2020 581 215 220 10.1038/s41586-020-2180-5 32225176
Lan, J. et al. Structure of the SARS-CoV-2 spike receptor-binding domain bound to the ACE2 receptor. Nature 581, 215–220 (2020).32225176
10. Barnes CO SARS-CoV-2 neutralizing antibody structures inform therapeutic strategies Nature 2020 588 682 687 10.1038/s41586-020-2852-1 33045718
Barnes, C. O. et al. SARS-CoV-2 neutralizing antibody structures inform therapeutic strategies. Nature 588, 682–687 (2020).33045718
11. Khoury DS Neutralizing antibody levels are highly predictive of immune protection from symptomatic SARS-CoV-2 infection Nat. Med. 2021 27 1205 1211 10.1038/s41591-021-01377-8 34002089
Khoury, D. S. et al. Neutralizing antibody levels are highly predictive of immune protection from symptomatic SARS-CoV-2 infection. Nat. Med. 27, 1205–1211 (2021).34002089
12. Yuan M Liu H Wu NC Wilson IA Recognition of the SARS-CoV-2 receptor binding domain by neutralizing antibodies Biochem. Biophys. Res. Commun. 2021 538 192 203 10.1016/j.bbrc.2020.10.012 33069360
Yuan, M., Liu, H., Wu, N. C. & Wilson, I. A. Recognition of the SARS-CoV-2 receptor binding domain by neutralizing antibodies. Biochem. Biophys. Res. Commun. 538, 192–203 (2021).33069360
13. Zhou D Evidence of escape of SARS-CoV-2 variant B.1.351 from natural and vaccine-induced sera Cell 2021 184 2348 2361 e2346 10.1016/j.cell.2021.02.037 33730597
Zhou, D. et al. Evidence of escape of SARS-CoV-2 variant B.1.351 from natural and vaccine-induced sera. Cell 184, 2348–2361 e2346 (2021).33730597
14. Hoffmann M SARS-CoV-2 variants B.1.351 and P.1 escape from neutralizing antibodies Cell 2021 184 2384 2393 e2312 10.1016/j.cell.2021.03.036 33794143
Hoffmann, M. et al. SARS-CoV-2 variants B.1.351 and P.1 escape from neutralizing antibodies. Cell 184, 2384–2393 e2312 (2021).33794143
15. Wang P Antibody resistance of SARS-CoV-2 variants B.1.351 and B.1.1.7 Nature 2021 593 130 135 10.1038/s41586-021-03398-2 33684923
Wang, P. et al. Antibody resistance of SARS-CoV-2 variants B.1.351 and B.1.1.7. Nature 593, 130–135 (2021).33684923
16. Tegally H Detection of a SARS-CoV-2 variant of concern in South Africa Nature 2021 592 438 443 10.1038/s41586-021-03402-9 33690265
Tegally, H. et al. Detection of a SARS-CoV-2 variant of concern in South Africa. Nature 592, 438–443 (2021).33690265
17. Washington NL Emergence and rapid transmission of SARS-CoV-2 B.1.1.7 in the United States Cell 2021 184 2587 2594 e2587 10.1016/j.cell.2021.03.052 33861950
Washington, N. L. et al. Emergence and rapid transmission of SARS-CoV-2 B.1.1.7 in the United States. Cell 184, 2587–2594 e2587 (2021).33861950
18. Boehm E Novel SARS-CoV-2 variants: the pandemics within the pandemic Clin. Microbiol. Infect. 2021 27 1109 1117 10.1016/j.cmi.2021.05.022 34015535
Boehm, E. et al. Novel SARS-CoV-2 variants: the pandemics within the pandemic. Clin. Microbiol. Infect. 27, 1109–1117 (2021).34015535
19. Planas D Reduced sensitivity of SARS-CoV-2 variant Delta to antibody neutralization Nature 2021 596 276 280 10.1038/s41586-021-03777-9 34237773
Planas, D. et al. Reduced sensitivity of SARS-CoV-2 variant Delta to antibody neutralization. Nature 596, 276–280 (2021).34237773
20. Yadav PD Neutralization of variant under investigation B.1.617.1 with sera of BBV152 vaccinees Clin. Infect. Dis. 2022 74 366 368 10.1093/cid/ciab411 33961693
Yadav, P. D. et al. Neutralization of variant under investigation B.1.617.1 with sera of BBV152 vaccinees. Clin. Infect. Dis. 74, 366–368 (2022).33961693
21. Akkiz H The biological functions and clinical significance of SARS-CoV-2 variants of corcern Front. Med. 2022 9 849217 10.3389/fmed.2022.849217
Akkiz, H. The biological functions and clinical significance of SARS-CoV-2 variants of corcern. Front. Med. 9, 849217 (2022).
22. Edara VV Infection and vaccine-induced neutralizing-antibody responses to the SARS-CoV-2 B.1.617 variants N. Engl. J. Med. 2021 385 664 666 10.1056/NEJMc2107799 34233096
Edara, V. V. et al. Infection and vaccine-induced neutralizing-antibody responses to the SARS-CoV-2 B.1.617 variants. N. Engl. J. Med. 385, 664–666 (2021).34233096
23. Liu J BNT162b2-elicited neutralization of B.1.617 and other SARS-CoV-2 variants Nature 2021 596 273 275 10.1038/s41586-021-03693-y 34111888
Liu, J. et al. BNT162b2-elicited neutralization of B.1.617 and other SARS-CoV-2 variants. Nature 596, 273–275 (2021).34111888
24. Wall EC Neutralising antibody activity against SARS-CoV-2 VOCs B.1.617.2 and B.1.351 by BNT162b2 vaccination Lancet 2021 397 2331 2333 10.1016/S0140-6736(21)01290-3 34090624
Wall, E. C. et al. Neutralising antibody activity against SARS-CoV-2 VOCs B.1.617.2 and B.1.351 by BNT162b2 vaccination. Lancet 397, 2331–2333 (2021).34090624
25. Krause PR SARS-CoV-2 variants and vaccines N. Engl. J. Med. 2021 385 179 186 10.1056/NEJMsr2105280 34161052
Krause, P. R. et al. SARS-CoV-2 variants and vaccines. N. Engl. J. Med. 385, 179–186 (2021).34161052
26. Tregoning JS Flight KE Higham SL Wang Z Pierce BF Progress of the COVID-19 vaccine effort: viruses, vaccines and variants versus efficacy, effectiveness and escape Nat. Rev. Immunol. 2021 21 626 636 10.1038/s41577-021-00592-1 34373623
Tregoning, J. S., Flight, K. E., Higham, S. L., Wang, Z. & Pierce, B. F. Progress of the COVID-19 vaccine effort: viruses, vaccines and variants versus efficacy, effectiveness and escape. Nat. Rev. Immunol. 21, 626–636 (2021).34373623
27. Long QX Clinical and immunological assessment of asymptomatic SARS-CoV-2 infections Nat. Med. 2020 26 1200 1204 10.1038/s41591-020-0965-6 32555424
Long, Q. X. et al. Clinical and immunological assessment of asymptomatic SARS-CoV-2 infections. Nat. Med. 26, 1200–1204 (2020).32555424
28. Wu F Evaluating the association of clinical characteristics with neutralizing antibody levels in patients who have recovered from mild COVID-19 in Shanghai, China JAMA Intern. Med. 2020 180 1356 1362 10.1001/jamainternmed.2020.4616 32808970
Wu, F. et al. Evaluating the association of clinical characteristics with neutralizing antibody levels in patients who have recovered from mild COVID-19 in Shanghai, China. JAMA Intern. Med. 180, 1356–1362 (2020).32808970
29. Peng Y Broad and strong memory CD4(+) and CD8(+) T cells induced by SARS-CoV-2 in UK convalescent individuals following COVID-19 Nat. Immunol. 2020 21 1336 1345 10.1038/s41590-020-0782-6 32887977
Peng, Y. et al. Broad and strong memory CD4(+) and CD8(+) T cells induced by SARS-CoV-2 in UK convalescent individuals following COVID-19. Nat. Immunol. 21, 1336–1345 (2020).32887977
30. Rydyznski Moderbacher C Antigen-specific adaptive immunity to SARS-CoV-2 in acute COVID-19 and associations with age and disease severity Cell 2020 183 996 1012 e1019 10.1016/j.cell.2020.09.038 33010815
Rydyznski Moderbacher, C. et al. Antigen-specific adaptive immunity to SARS-CoV-2 in acute COVID-19 and associations with age and disease severity. Cell 183, 996–1012 e1019 (2020).33010815
31. Tan AT Early induction of functional SARS-CoV-2-specific T cells associates with rapid viral clearance and mild disease in COVID-19 patients Cell Rep. 2021 34 108728 10.1016/j.celrep.2021.108728 33516277
Tan, A. T. et al. Early induction of functional SARS-CoV-2-specific T cells associates with rapid viral clearance and mild disease in COVID-19 patients. Cell Rep. 34, 108728 (2021).33516277
32. Kingstad-Bakke B Vaccine-induced systemic and mucosal T cell immunity to SARS-CoV-2 viral variants Proc. Natl. Acad. Sci. USA 2022 119 e2118312119 10.1073/pnas.2118312119 35561224
Kingstad-Bakke, B. et al. Vaccine-induced systemic and mucosal T cell immunity to SARS-CoV-2 viral variants. Proc. Natl. Acad. Sci. USA 119, e2118312119 (2022).35561224
33. Ishii H Neutralizing-antibody-independent SARS-CoV-2 control correlated with intranasal-vaccine-induced CD8(+) T cell responses Cell Rep. Med. 2022 3 100520 10.1016/j.xcrm.2022.100520 35233545
Ishii, H. et al. Neutralizing-antibody-independent SARS-CoV-2 control correlated with intranasal-vaccine-induced CD8(+) T cell responses. Cell Rep. Med. 3, 100520 (2022).35233545
34. Hajnik RL Dual spike and nucleocapsid mRNA vaccination confer protection against SARS-CoV-2 Omicron and Delta variants in preclinical models Sci. Transl. Med. 2022 14 eabq1945 10.1126/scitranslmed.abq1945 36103514
Hajnik, R. L. et al. Dual spike and nucleocapsid mRNA vaccination confer protection against SARS-CoV-2 Omicron and Delta variants in preclinical models. Sci. Transl. Med. 14, eabq1945 (2022).36103514
35. Dangi T Class J Palacio N Richner JM Penaloza MacMaster P Combining spike- and nucleocapsid-based vaccines improves distal control of SARS-CoV-2 Cell Rep. 2021 36 109664 10.1016/j.celrep.2021.109664 34450033
Dangi, T., Class, J., Palacio, N., Richner, J. M. & Penaloza MacMaster, P. Combining spike- and nucleocapsid-based vaccines improves distal control of SARS-CoV-2. Cell Rep. 36, 109664 (2021).34450033
36. Zoratto N Strategies to load therapeutics into polysaccharide-based nanogels with a focus on microfluidics: a review Carbohydr. Polym. 2021 266 118119 10.1016/j.carbpol.2021.118119 34044935
Zoratto, N. et al. Strategies to load therapeutics into polysaccharide-based nanogels with a focus on microfluidics: a review. Carbohydr. Polym. 266, 118119 (2021).34044935
37. Ma X Bioengineered nanogels for cancer immunotherapy Chem. Soc. Rev. 2022 51 5136 5174 10.1039/D2CS00247G 35666131
Ma, X. et al. Bioengineered nanogels for cancer immunotherapy. Chem. Soc. Rev. 51, 5136–5174 (2022).35666131
38. Gu XG A novel hydrophobized polysaccharide/oncoprotein complex vaccine induces in vitro and in vivo cellular and humoral immune responses against HER2-expressing murine sarcomas Cancer Res. 1998 58 3385 3390 9699670
Gu, X. G. et al. A novel hydrophobized polysaccharide/oncoprotein complex vaccine induces in vitro and in vivo cellular and humoral immune responses against HER2-expressing murine sarcomas. Cancer Res. 58, 3385–3390 (1998).9699670
39. Muraoka D Nanogel-based immunologically stealth vaccine targets macrophages in the medulla of lymph node and induces potent antitumor immunity ACS Nano 2014 8 9209 9218 10.1021/nn502975r 25180962
Muraoka, D. et al. Nanogel-based immunologically stealth vaccine targets macrophages in the medulla of lymph node and induces potent antitumor immunity. ACS Nano 8, 9209–9218 (2014).25180962
40. Muraoka D Harada N Shiku H Akiyoshi K Self-assembled polysaccharide nanogel delivery system for overcoming tumor immune resistance J. Control Release 2022 347 175 182 10.1016/j.jconrel.2022.05.004 35526613
Muraoka, D., Harada, N., Shiku, H. & Akiyoshi, K. Self-assembled polysaccharide nanogel delivery system for overcoming tumor immune resistance. J. Control Release 347, 175–182 (2022).35526613
41. Ishihara, M. et al. NY-ESO-1-specific redirected T cells with endogenous TCR knockdown mediate tumor response and cytokine release syndrome. J. Immunother. Cancer 10, e003811 (2022).
42. Miyauchi K Clinical relevance of antigen spreading pattern induced by CHP-MAGE-A4 cancer vaccination Immunotherapy 2016 8 527 540 10.2217/imt-2016-0007 26888315
Miyauchi, K. et al. Clinical relevance of antigen spreading pattern induced by CHP-MAGE-A4 cancer vaccination. Immunotherapy 8, 527–540 (2016).26888315
43. Kageyama S Dose-dependent effects of NY-ESO-1 protein vaccine complexed with cholesteryl pullulan (CHP-NY-ESO-1) on immune responses and survival benefits of esophageal cancer patients J. Transl. Med. 2013 11 246 10.1186/1479-5876-11-246 24093426
Kageyama, S. et al. Dose-dependent effects of NY-ESO-1 protein vaccine complexed with cholesteryl pullulan (CHP-NY-ESO-1) on immune responses and survival benefits of esophageal cancer patients. J. Transl. Med. 11, 246 (2013).24093426
44. Nagata Y Prognostic significance of NY-ESO-1 antigen and PIGR expression in esophageal tumors of CHP-NY-ESO-1-vaccinated patients as adjuvant therapy Cancer Immunol. Immunother. 2022 71 2743 2755 10.1007/s00262-022-03194-5 35429246
Nagata, Y. et al. Prognostic significance of NY-ESO-1 antigen and PIGR expression in esophageal tumors of CHP-NY-ESO-1-vaccinated patients as adjuvant therapy. Cancer Immunol. Immunother. 71, 2743–2755 (2022).35429246
45. Kang YS SIGN-R1, a novel C-type lectin expressed by marginal zone macrophages in spleen, mediates uptake of the polysaccharide dextran Int. Immunol. 2003 15 177 186 10.1093/intimm/dxg019 12578847
Kang, Y. S. et al. SIGN-R1, a novel C-type lectin expressed by marginal zone macrophages in spleen, mediates uptake of the polysaccharide dextran. Int. Immunol. 15, 177–186 (2003).12578847
46. Krummey SM CD45RB Status of CD8(+) T cell memory defines T cell receptor affinity and persistence Cell Rep. 2020 30 1282 1291 e1285 10.1016/j.celrep.2020.01.016 32023448
Krummey, S. M. et al. CD45RB Status of CD8(+) T cell memory defines T cell receptor affinity and persistence. Cell Rep. 30, 1282–1291 e1285 (2020).32023448
47. Winkler ES SARS-CoV-2 infection of human ACE2-transgenic mice causes severe lung inflammation and impaired function Nat. Immunol. 2020 21 1327 1335 10.1038/s41590-020-0778-2 32839612
Winkler, E. S. et al. SARS-CoV-2 infection of human ACE2-transgenic mice causes severe lung inflammation and impaired function. Nat. Immunol. 21, 1327–1335 (2020).32839612
48. Zafarani, A. et al. Natural killer cells in COVID-19: from infection, to vaccination and therapy. Future Virol. 18, 177–191 (2023).
49. Fischer DS Wu Y Schubert B Theis FJ Predicting antigen specificity of single T cells based on TCR CDR3 regions Mol. Syst. Biol. 2020 16 e9416 10.15252/msb.20199416 32779888
Fischer, D. S., Wu, Y., Schubert, B. & Theis, F. J. Predicting antigen specificity of single T cells based on TCR CDR3 regions. Mol. Syst. Biol. 16, e9416 (2020).32779888
50. Thomas N Tracking global changes induced in the CD4 T-cell receptor repertoire by immunization with a complex antigen using short stretches of CDR3 protein sequence Bioinformatics 2014 30 3181 3188 10.1093/bioinformatics/btu523 25095879
Thomas, N. et al. Tracking global changes induced in the CD4 T-cell receptor repertoire by immunization with a complex antigen using short stretches of CDR3 protein sequence. Bioinformatics 30, 3181–3188 (2014).25095879
51. Burgdorf S Lukacs-Kornek V Kurts C The mannose receptor mediates uptake of soluble but not of cell-associated antigen for cross-presentation J. Immunol. 2006 176 6770 6776 10.4049/jimmunol.176.11.6770 16709836
Burgdorf, S., Lukacs-Kornek, V. & Kurts, C. The mannose receptor mediates uptake of soluble but not of cell-associated antigen for cross-presentation. J. Immunol. 176, 6770–6776 (2006).16709836
52. Burgdorf S Kautz A Bohnert V Knolle PA Kurts C Distinct pathways of antigen uptake and intracellular routing in CD4 and CD8 T cell activation Science 2007 316 612 616 10.1126/science.1137971 17463291
Burgdorf, S., Kautz, A., Bohnert, V., Knolle, P. A. & Kurts, C. Distinct pathways of antigen uptake and intracellular routing in CD4 and CD8 T cell activation. Science 316, 612–616 (2007).17463291
53. Sancho D Identification of a dendritic cell receptor that couples sensing of necrosis to immunity Nature 2009 458 899 903 10.1038/nature07750 19219027
Sancho, D. et al. Identification of a dendritic cell receptor that couples sensing of necrosis to immunity. Nature 458, 899–903 (2009).19219027
54. Joffre OP Segura E Savina A Amigorena S Cross-presentation by dendritic cells Nat. Rev. Immunol. 2012 12 557 569 10.1038/nri3254 22790179
Joffre, O. P., Segura, E., Savina, A. & Amigorena, S. Cross-presentation by dendritic cells. Nat. Rev. Immunol. 12, 557–569 (2012).22790179
55. Engering A The dendritic cell-specific adhesion receptor DC-SIGN internalizes antigen for presentation to T cells J. Immunol. 2002 168 2118 2126 10.4049/jimmunol.168.5.2118 11859097
Engering, A. et al. The dendritic cell-specific adhesion receptor DC-SIGN internalizes antigen for presentation to T cells. J. Immunol. 168, 2118–2126 (2002).11859097
56. Granelli-Piperno A Dendritic cell-specific intercellular adhesion molecule 3-grabbing nonintegrin/CD209 is abundant on macrophages in the normal human lymph node and is not required for dendritic cell stimulation of the mixed leukocyte reaction J. Immunol. 2005 175 4265 4273 10.4049/jimmunol.175.7.4265 16177066
Granelli-Piperno, A. et al. Dendritic cell-specific intercellular adhesion molecule 3-grabbing nonintegrin/CD209 is abundant on macrophages in the normal human lymph node and is not required for dendritic cell stimulation of the mixed leukocyte reaction. J. Immunol. 175, 4265–4273 (2005).16177066
57. Cannon MJ Openshaw PJ Askonas BA Cytotoxic T cells clear virus but augment lung pathology in mice infected with respiratory syncytial virus J. Exp. Med. 1988 168 1163 1168 10.1084/jem.168.3.1163 3262705
Cannon, M. J., Openshaw, P. J. & Askonas, B. A. Cytotoxic T cells clear virus but augment lung pathology in mice infected with respiratory syncytial virus. J. Exp. Med. 168, 1163–1168 (1988).3262705
58. Machhi J The natural history, pathobiology, and clinical manifestations of SARS-CoV-2 infections J. Neuroimmune Pharm. 2020 15 359 386 10.1007/s11481-020-09944-5
Machhi, J. et al. The natural history, pathobiology, and clinical manifestations of SARS-CoV-2 infections. J. Neuroimmune Pharm. 15, 359–386 (2020).
59. Mayer-Blackwell, K. et al. TCR meta-clonotypes for biomarker discovery with tcrdist3 enabled identification of public, HLA-restricted clusters of SARS-CoV-2 TCRs. Elife 10, e68605 (2021).
60. Chang CM Profiling of T cell repertoire in SARS-CoV-2-infected COVID-19 patients between mild disease and pneumonia J. Clin. Immunol. 2021 41 1131 1145 10.1007/s10875-021-01045-z 33950324
Chang, C. M. et al. Profiling of T cell repertoire in SARS-CoV-2-infected COVID-19 patients between mild disease and pneumonia. J. Clin. Immunol. 41, 1131–1145 (2021).33950324
61. Pan YG Vaccination reshapes the virus-specific T cell repertoire in unexposed adults Immunity 2021 54 1245 1256 e1245 10.1016/j.immuni.2021.04.023 34004140
Pan, Y. G. et al. Vaccination reshapes the virus-specific T cell repertoire in unexposed adults. Immunity 54, 1245–1256 e1245 (2021).34004140
62. Hanson HL Eradication of established tumors by CD8+ T cell adoptive immunotherapy Immunity 2000 13 265 276 10.1016/S1074-7613(00)00026-1 10981969
Hanson, H. L. et al. Eradication of established tumors by CD8+ T cell adoptive immunotherapy. Immunity 13, 265–276 (2000).10981969
63. Muraoka D Establishment of animal models to analyze the kinetics and distribution of human tumor antigen-specific CD8(+) T cells Vaccine 2013 31 2110 2118 10.1016/j.vaccine.2013.02.056 23499606
Muraoka, D. et al. Establishment of animal models to analyze the kinetics and distribution of human tumor antigen-specific CD8(+) T cells. Vaccine 31, 2110–2118 (2013).23499606
64. Wikramaratna, P. S., Paton, R. S., Ghafari, M. & Lourenco, J. Estimating the false-negative test probability of SARS-CoV-2 by RT-PCR. Euro Surveill. 25, 2000568 (2020).
65. Corman, V. M. et al. Detection of 2019 novel coronavirus (2019-nCoV) by real-time RT-PCR. Euro Surveill. 25, 2000045 (2020).
66. Kitaura K Shini T Matsutani T Suzuki R A new high-throughput sequencing method for determining diversity and similarity of T cell receptor (TCR) alpha and beta repertoires and identifying potential new invariant TCR alpha chains BMC Immunol. 2016 17 38 10.1186/s12865-016-0177-5 27729009
Kitaura, K., Shini, T., Matsutani, T. & Suzuki, R. A new high-throughput sequencing method for determining diversity and similarity of T cell receptor (TCR) alpha and beta repertoires and identifying potential new invariant TCR alpha chains. BMC Immunol. 17, 38 (2016).27729009
67. Kitaura K Different somatic hypermutation levels among antibody subclasses disclosed by a new next-generation sequencing-based antibody repertoire analysis Front Immunol. 2017 8 389 10.3389/fimmu.2017.00389 28515723
Kitaura, K. et al. Different somatic hypermutation levels among antibody subclasses disclosed by a new next-generation sequencing-based antibody repertoire analysis. Front Immunol. 8, 389 (2017).28515723
68. Chen Z Inference of immune cell composition on the expression profiles of mouse tissue Sci. Rep. 2017 7 40508 10.1038/srep40508 28084418
Chen, Z. et al. Inference of immune cell composition on the expression profiles of mouse tissue. Sci. Rep. 7, 40508 (2017).28084418
