
==== Front
F1000Res
F1000Res
F1000Research
2046-1402
F1000 Research Limited London, UK

10.12688/f1000research.142843.2
Research Article
Articles
In silico analysis of molecular mimicry between human aquaporin 3, Aspergillus fumigatus aquaporin and aquaporins from allergic sources
[version 2; peer review: 2 approved]

Sánchez Andrés Conceptualization Data Curation Formal Analysis Investigation Methodology Supervision Writing – Original Draft Preparation Writing – Review & Editing https://orcid.org/0000-0001-7460-3427
a123
Padilla Yaquelin Conceptualization Data Curation Formal Analysis Software Writing – Original Draft Preparation Writing – Review & Editing 3
Lorduy Adriana Conceptualization Data Curation Formal Analysis Methodology Software Writing – Original Draft Preparation Writing – Review & Editing 3
Sanchez Jorge Conceptualization Data Curation Methodology Software Supervision Validation Visualization 2
Munera Marlon Conceptualization Data Curation Formal Analysis Methodology Supervision Validation Visualization https://orcid.org/0000-0003-3428-0541
1
Baena Claudia Data Curation Formal Analysis Methodology Software Validation Writing – Review & Editing https://orcid.org/0000-0001-7196-2694
3
Bernal Carlos Conceptualization Investigation Methodology Software Supervision Validation Visualization https://orcid.org/0000-0001-8681-5777
3
Urrego Juan Conceptualization Investigation Methodology Supervision Validation Visualization Writing – Review & Editing https://orcid.org/0000-0002-1388-8227
3
1 Group of Research Medicine (GINUMED), Rafael Nunez University Corporation, Cartagena, Bolívar, Colombia
2 Clinical and Experimental Allergy Group (GACE), University of Antioquia, Medellín, Antioquia, Colombia
3 Research Group of Pharmaceutical, Cosmetic, and Food Technology (GITFCA), University of Cartagena, Cartagena, Bolívar, Colombia
a andres.sanchez@curnvirtual.edu.co
No competing interests were disclosed.

12 9 2024
2024
13 3585 9 2024
Copyright: © 2024 Sánchez A et al.
2024
https://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
The author(s) is/are employees of the US Government and therefore domestic copyright protection in USA does not apply to this work. The work may be protected under the copyright laws of other jurisdictions when used in those jurisdictions.

Background

Atopic dermatitis (AD) is a chronic inflammatory skin condition that has a significant impact on quality of life. The immune response and allergy symptoms in AD are triggered by the recognition of specific allergens by IgE antibodies. Cross-reactivity can lead to auto-IgE responses, potentially worsening AD symptoms. Our research aimed to enhance our understanding of allergenic sources, including A. fumigatus, and their role in AD. We focused on molecular mimicry between human AQP3 and A. fumigatus aquaporin.

Methods

In our in-silico analysis, we compared the amino acid sequences of human aquaporin 3 (AQP3) and A. fumigatus aquaporin with 25 aquaporins from various allergenic sources, sourced from the UniProt and NCBI databases. Phylogenetic relationship analysis and homology-based modeling were conducted. We identified conserved antigenic regions located within the 3D structures.

Results

The global identity levels among the studied aquaporins averaged 32.6%. One antigenic site exhibited a remarkable local region, with a conserved identity of 71.4%. We categorized the aquaporins into five monophyletic clades (A–E), with group B showing the highest identity (95%), including six mammalian aquaporins, including AQP3. When comparing A. fumigatus aquaporins, the highest identity was observed with Malassezia sympodialis at 35%. Both human and A. fumigatus aquaporins have three linear and three discontinuous epitopes.

Conclusions

We identified potential linear and conformational epitopes of AQP3, indicating a possible molecular mimicry between humans and A. fumigatus aquaporins. This suggests autoreactivity and potential cross-reactivity, although further validation using in vitro and in vivo experiments is required.

Atopic dermatitis
in silico
molecular mimicry
Aspergillus fumigatus
aquaporins.
The author(s) declared that no grants were involved in supporting this work.Revised Amendments from Version 1

The corrections were made, and information related to non-IgE responses was included.
==== Body
pmcIntroduction

Atopic dermatitis (AD) is a chronic and recurrent inflammatory skin disorder characterized by symptoms, such as eczema, erythema, persistent itching, and continuous skin damage. Over the past 30 years, the prevalence of AD has shown a notable rise, affecting between 5% and 20% of the child population and approximately 7% of adults in industrialized countries. 1 , 2 The pathogenesis of AD is not completely clear; however, allergens can activate an intense Th2 response. 3 While IgE-mediated pathways are prominent in atopic dermatitis, non-IgE mechanisms also play a crucial role, particularly in contact dermatitis and in some cases of atopic dermatitis where patients do not exhibit elevated IgE levels. Allergenic sources can vary depending on the population; for example, house dust mites are the main source of sensitization in tropical countries, whereas in Europe, pollen is the main trigger for allergies. In addition, depending on the environmental conditions, it is possible to be exposed to different species; therefore, epidemiological studies have shown variations in the frequencies of sensitization. 4 The severity of the disease is influenced by several factors, including compromised skin barrier integrity due to reduced levels of filaggrins and ceramides as well as an elevated presence of water channels such as aquaporin, which drives the skin, making the patient more susceptible to atopic dermatitis. 5 In general, allergy management includes allergen avoidance, pharmacotherapy, and immunotherapy, where only the latter has a beneficial effect that lasts for years and allows for a reduction in anti-inflammatory treatment. 6 – 8

In addition to other environmental factors, the skin microbiome plays a pivotal role in AD development. Aspergillus fumigatus is an opportunistic pathogen in both poikilothermic and homeothermic animals. In humans, this pathogen has been associated with many pathologies such as invasive cutaneous aspergillosis, saprophytic lung colonization, and aspergillomas. In addition, A. fumigatus can induce IgE-mediated allergic diseases including rhinitis, allergic sinusitis, asthma, hypersensitivity pneumonitis, and AD. 9 , 10 It has been characterized as an important allergenic source, and some allergens, including thioredoxins and cyclophilins, share homology with human proteins and are implicated in the autoreactive response in AD.

Despite the identification of sensitization to extracts from allergenic sources, such as fungi, the recognition of specific IgE sensitization to allergens is necessary to carry out a better diagnosis and immunotherapy. 11 However, this represents a challenge, because most fungal allergens cross-react with other taxonomically distant species, making it difficult to prove the clinical relevance of IgE reactivity against these allergens. In addition, it is important to consider that the evolution of AD varies greatly among patients with this disease and can be triggered by different factors. For example, in A. fumigatus and AD, studies suggest that specific IgE-mediated activation is induced not by multiple allergens and not by a few major allergens, as is the case with asthma and rhinitis. 12 , 13 Another problem presented by the diagnosis of allergic diseases associated with A. fumigatus is the lack of standardized allergens for preparation of molecular component tests. Therefore, the discovery of new fungal allergens and the identification of the prevalence of these new components may provide an opportunity to learn more about the pathology of atopic dermatitis, improving the diagnosis and treatment of this disease.

In recent years, aquaporin has become a candidate protein for the study of skin and allergic diseases such as AD, given its role in epidermal hydration and the transport of various substances such as glycerol, salts, and exocrine fluids, favoring dry skin and allergen leakage. 14 They have also been associated with various atopic diseases, such as glaucoma, cancer, epilepsy, obesity, epidermal hyperplasia, and neuromyelitis optical, among others. In AD, an increase in the expression of aquaporin 3 has been observed, which may be related to water loss and the severity of the disease, in contrast to healthy individuals who maintain a balanced expression of this protein in the basal, horny, and spinous layers. 5 The consequences of aquaporin 3 (AQP3) overexpression extend beyond cutaneous water retention as it becomes a target for the exacerbated immune response in AD inflammation. This hypothesis suggests that it may be recognized by human autoantibodies, which, due to the persistence of self-protein exposure, contribute to increased inflammation and chronicity of AD.

Additionally, this protein is present in most organisms with a wide variety of isoforms and functions throughout the taxonomic framework. Recently, aquaporin has been identified in highly allergenic species, such as house dust mites. In a study carried out by Mao et al., describing the Dermatophagoides farinae proteome, two-dimensional immunoblotting was performed, which showed binding with IgE antibodies in a band that has the same isoelectric point and molecular weight of the aquaporin family, suggesting its possible role as an allergen. The objective of this study was to perform an in silico analysis to investigate the potential molecular mimicry between human aquaporins and those from A. fumigatus, as well as various allergenic sources.

Methods

For the selection of aquaporins, the Aspergillus fumigatus (KEY82230) and human aquaporin 3 (Q92482) sequences of interest were compared with existing allergenic protein sequences using Allermatch ( https://allermatch.org/), an allergen comparative server that allows allergen sequence alignment; therefore, those with high identity values were chosen. The sequence pool was obtained from the UniProt ( https://www.uniprot.org/) and National Center for Biotechnology Information (NCBI) databases. Given the diversity in amino acid origins and lengths across the molecules under examination, we employed coverage and identity values to gauge the extent of their relationships. The identity and coverage values between the molecules used in this study were determined using the EMBOSS Needle ( https://www.ebi.ac.uk/Tools/psa/emboss_needle/), specialized for performing paired alignments, and the web server from Praline ( http://www.ibi.vu.nl/), which allowed for paired and multiple alignments. When carrying out the alignment, it was considered that the sequences were different and came from different sources; therefore, the alignment parameters were set to utilize the BLOSUM62 matrix, which primarily assesses evolutionary divergence, along with adjustments to the conditional scoring matrix. 15 , 16

Phylogenetic analysis

To construct the phylogenetic tree, we conducted a study using “Molecular Evolutionary Genetic Analysis” (MEGA) version 11 program. We employed the neighbor-joining (R) reconstruction method, supported by 100 bootstrap repetitions, to ensure the reliability and robustness of the analysis. Evolutionary distances were computed using the Poisson correction method, which uses a comparison matrix to identify sequence similarities. This matrix was created based on all amino acid sequences of the selected allergens, with all empty gaps removed (full deletions). Branch length summation (SBL) was presented as a measure of overall comparison and homologies, providing insights into the number of nodes, their positions, and the formation of the evolutionarily closest sequence “clusters. 15 , 17

3D models of proteins

Aquaporin models were acquired from the Protein Data Bank and AlphaFold ( Homo sapiens, Felis catus, Equus caballus, Bos taurus, Mus musculus, Malassezia sympodialis, Saccharomyces cerevisiae, Penicillium chrysogenum, Escherichia coli). For A. fumigatus and Cannis lupus familiaris aquaporin 3D structures were modeled by homology using the Swiss Model server ( https://swissmodel.expasy.org/), and these models were refined in ModRefiner. ( https://zhanggroup.org/ModRefiner/), an algorithm for the fine-grained refinement of protein structures at the atomic level. 18

Epitope prediction

Models were used to locate possible epitope regions predicted by the Ellipro server ( http://tools.iedb.org/ellipro/), which was used to predict linear and discontinuous epitopes in the aquaporins of A. fumigatus, (AQP3), Cannis lupus familiaris, Felis catus, Equus caballus, Bos taurus, Mus musculus, Malassezia sympodialis, Saccharomyces cerevisiae, Penicillium chrysogenum and Escherichia coli. The potential epitopes were selected under the criteria of a score ≥ 7, as this value evaluates how exposed the residue is and the binding capacity of the epitope with the paratope. 15 , 17

Identification of aquaporin domains

The characterization of the protein domains was carried out using the Interpro web server ( https://www.ebi.ac.uk/interpro/); with this bioinformatic tool we obtained those domains with functional activity present in the protein sequence of the aquaporins studied. Subsequently, a review of the tertiary structure was carried out using the PyMOL program, which functioned as a molecular viewer, allowing identification of the location of the protein domains in the tertiary structure of each one.

Results

Aquaporins sequence alignments

A total of 25 aquaporin sequences from different sources were selected and compared with the A. fumigatus aquaporin and human aquaporin ( Table 1), the identity percentages of the aquaporins from different sources Vs A. fumigatus aquaporin and AQP3 are shown in Table 2. Notably, human AQP3 exhibited maximum values of identity and similarity of 95.5% and 98.6%, respectively, with aquaporin allergy sources. When comparing A. fumigatus aquaporins and AQP3, an identity of 32.6% and a similarity of 47.5% were observed, indicating a significant degree of homology between them. Regarding the AQP of A. fumigatus, the highest identity values were observed in the AQP of M. simpodialies (35%), followed by the mammalian species that also had greater identity with human AQP3, such as C. familiaris (33, 9%), Felis gatus (33, 10%), Mus musculus (33, 10%), and Bos taurus (32, 80%). The lowest identity and similarity results were obtained with apple ( Malus domestica), with values of 0.2% and 0.9%, respectively.

Table 1. Aquaporins studies.

Organisms	Protein	Uniprot/NCBI Entry	Aminoácidos	
Aspergillus fumigatus	aquaglyceroporin	KEY82230	335	
Homo sapiens	Aquaporin-3	Q92482	292	
Dermatophagoides pteronyssinus	Aquaporin	A0A2D1VL80	265	
Dermatophagoides farinae	Aquaporin	A0A2C9PGE6	259	
Blomia tropicalis	Aquaporin	A0A1Z1W2B1	256	
Euroglyphus maynei	Aquaporin-like protein	A0A1Y3AUR4	289	
Malus domestica	Aquaporin	H2EIG5	144	
Vitis vinífera	Aquaporin TIP4-1	A0A438K8X4	196	
Actinidia deliciosa	Aquaporin PIP2-1	A0A1X9ZIG1	283	
Citrus sinensis	Putative aquaporin TIP13	A0A067DDA2	251	
Cannabis sativa	Uncharacterized protein	A0A7J6FF47	250	
Blatella germanica	Aquaporin TIP3-1	A0A2P8XIM1	200	
Periplaneta americana	Putative glycerol diffusion channel	D0J8Y8	247	
Penaeus vannamei	Aquaporin	A0A3R7PEU6	308	
Canis lupus familiaris	Aquaporin-3	E2RI15	292	
Felis catus	Aquaporin-3	A0A2I2UBV1	292	
Equus caballus	Aquaporin-3	F6TFP8	419	
Bos Taurus	Aquaporin-3	Q08DE6	292	
Mus musculus	Aquaporin-3	Q8R2N1	292	
Alternaria alternata	Aquaporin	A0A177DNX7	408	
Malassezia Sympodialis	Putative channel-like protein	A0A1M7ZZV8	291	
Saccharomyces cerevisiae	Aquaglycerol porin AQY3	P43549	646	
Penicillium chrysogenum	Aquaporin-3	A0A167PPH9	279	
Penicillium rubens	Pc12g14590 protein	B6H130	306	
Escherichia coli	Glycerol uptake facilitator protein	P0AER0	281	
Ascaris lumbricoides	Aquaporin	A0A0M3I310	267	
Staphylococcus aureus	Glycerol uptake facilitator protein	AYU99483	247	

Table 2. Identity and similarity between AQP3, A. fumigatus aquaporin and aquaporins from allergen sources.

Sources	AQP3	Aspergillus Fumigatus	
Identity (%)	Similarity (%)	Score	Identity (%)	Similarity (%)	Score	
Aspergillus fumigatus	32,6	47,5	492,5	-	-	-	
Dermatophagoides pteronyssinus	18,1	32,2	42,0	15,50	25,5	41	
Dermatophagoides farinae	31,5	48,7	386,0	22,90	36	291	
Blomia tropicalis	19,6	32,7	44,5	13,70	20	29	
Euroglyphus maynei	29	46	360	21,80	34,6	252,5	
Malus domestica	1,7	3,2	14,5	0,20	0,9	3	
Vitis vinifera	1,7	30,5	175	18,20	27,7	149,5	
Actinidia deliciosa	21,2	32,9	218,5	24,30	38	247	
Citrus sinensis	25,4	38,4	193,5	18,80	29,6	167	
Cannabis sativa	24,6	39	190,5	19,50	34,7	167	
Blatella germanica	22,6	33,4	141,0	15,90	23,2	84,5	
Periplaneta americana	27,1	44,4	332	24,20	34	330	
Penaeus vannamei	14,9	28,5	80,5	13,00	20,2	27	
Canis lupus familiaris	72,9	75,9	1294	33,90	50,3	468,5	
Felis catus	95,5	97,6	1484	33,10	48,4	508,5	
Equus caballus	66,6	68,7	1497	27,90	42,7	498	
Bos taurus	94,9	98,3	1486	32,80	48,1	497,5	
Mus musculus	95,5	98,6	1493	33,10	48,1	506,5	
Alternaria alternata	15,6	25,4	214	14,50	22,6	205	
Malassezia Simpodiales	33,1	49,5	401,5	35,90	49,6	516	
Saccharomyces cerevisiae	15,8	25,1	516	22,60	31,4	668,5	
Penicillium chrysogenum	33,2	50,9	377,5	3,50	43,4	477	
Penicillium rubens	24,6	35,2	205	20,90	32,8	144,5	
Escherichia coli	35,6	53,2	475,5	31,70	45,2	436,5	
Ascaris lumbricoides	9,9	16,1	30,5	10,40	16,7	17,5	
Staphylococcus aureus	31,7	43,6	377,5	27,70	37,4	337,5	

Phylogenetic analysis

Phylogenetic relationships were determined using the neighbor-joining method, incorporating all 27 amino acid sequences. The resulting phylogenetic tree is presented in a circular format in Figure 1. Evolutionary distances were calculated using the Poisson correction method and were exprex|ssed as the number of amino acid substitutions per site. The tree visually represents the grouping and arrangement of the analyzed aquaporins, facilitating a comprehensive comparison and revealing their interrelatedness.

Figure 1. Phylogenetic tree based on amino acid sequences of the studied aquaporins.

The sums of branch lengths for an optimal tree totaled 12.5. The tree reveals the formation of five groups, designated as letters from A to E.

Based on branch distances, the phylogenetic tree presented the formation of five distinct groups, denoted as letters A to E. Multiple sequence alignments were performed using the Praline server to further explore the similarities within each group. Group A consisted of fungal species with a shared identity of 39%, whereas group B comprised mammalian aquaporins with a high identity of 95%. Group C was composed of two mite species with an identity of 53%, group D encompassed plant sources with 40% identity, and group E included pathogens and mites with an identity of 31%. Notably, this analysis revealed significant allergen sources in tropical regions, such as D. pteronissinus and B. tropicalis.

Species such as P. americana, S. aureus, E. coli, B. germanica, and M. domestica did not fit within any specific group because of their substantial branch distances from the root of clustering. Consequently, they were categorized into independent groups. Among the identified groups, those most closely related to the aquaporins of A. fumigatus and humans were found in groups A and B. Additionally, noteworthy proximity was observed between E. coli and D. farinae in group B.

The guidance provided by the phylogenetic tree and the results of paired alignments of the EMBOSS needle and aquaporin sequences were selected with a score ≥380. This threshold ensured an identity greater than 30% for each aquaporin sequence. Subsequently, paired alignments of the selected aquaporins against A. fumigatus were performed using Praline. This approach provides a more visually informative result, enabling a better understanding of the conserved regions in each sequence ( Figure 2). By employing this screening process, we can identify more conserved sequences, thus increasing the likelihood of identifying regions that may contain potential epitopes.

Figure 2. Sequence alignment of aquaporins from A. fumigatus and humans was performed using Praline.

The colors used in the alignment represent the level of sequence conservation, with blue indicating lower conservation and red indicating higher conservation. In the accompanying image, highlighted boxes denote the most conserved regions in the sequence, with each color (red, yellow, and green) representing the degree of conservation in descending order.

Aquaporin 3D models

Using PyMOL, we visualized the structures of the 12 selected aquaporin proteins. They were represented in the form of “cartoons” and were color-coded using the spectrum. These models exhibit the characteristic structure of aquaporins, consisting of six alpha helices connected by extracellular and intracellular “loops” that form the water and substance transport channel ( Figure 3).

Figure 3. Structures of aquaporins obtained from sources including PDB, Uniprot, AlphaFold, and Swiss-model. Their clustering corresponds to the arrangement in the phylogenetic tree. (A) This cluster comprises aquaporins from fungi. (B) Aquaporins from animals, except for E. coli, belong to this group.

Moreover, certain structures display distinctive extensions in their amino acid chains, resulting in variations in their tertiary structures. Examples include S. cerevisiae and E. caballus. Consequently, during epitope exploration, most of these regions were exposed, leading to the exclusion of these sequences as potential allergenic sources due to the absence of epitopes in the conserved regions of interest. This minimized the likelihood of cross-reactivity.

Prediction of linear and discontinuous epitopes

Using the 3D structures of A. fumigatus, Homo sapiens, Dermatophagoides farinae, Canis lupus familiaris, Felis catus, Equus caballus, Bos taurus, Mus musculus, Malassezia Sympodialis, Saccharomyces cerevisiae, Penicillium chrysogenum, and Escherichia coli, we predicted the linear and discontinuous epitopes for each aquaporin ( Table 3). We utilized PyMOL to analyze the identified linear and conformational epitopes, and thoroughly examined the distinct regions within each of these 3D structures. These epitopes are marked with the representative colors in the 3D structure. Although this characterization was performed for all 12 studied aquaporins, this work focused only on the epitopes found in the aquaporins of interest ( A. fumigatus and AQP3), as shown in Figures 4 and 5.

Table 3. Lineal and discontinuous epitotpes from A. fumigatus and human aquaporin 3 (AQP3).

Aspergillus Fumigatus aquaporin	
Lineal Epitopes	
No.	Chain	Start	Final	Peptide	N. Residues	Score	
1	A	218	231	DDGNIGAGPLTPLA	14	0,763	
2	A	80	93	QVTLSKGEKGDYQS	13	0,7	
3	A	151	180	AIVYGNYRSAIDQFEGGAHIRTVPGYSPTA	30	0,7	
Discontinuous Epitopes	
1	A	54	61	A:R54, A:T55, A:Y56, A:C57, A:R58, A:D59, A:A60, A:F61	8	0,869	
2	A	211	306	A:F211, A:F293, A:G295, A:W296, A:I297, A:Y298, A:D299, A:M300, A:F301, A:L302, A:Y303, A:T304, A:G305, A:T306	14	0,815	
3	A	215	234	A:A215, A:D218, A:D219, A:G220, A:N221, A:I222, A:G223, A:A224, A:G225, A:P226, A:L227, A:T228, A:L230, A:A231, A:F234	15	0,763	
Human Aquaporin 3	
Lineal Epitopes	
1	A	1	23	MGRQKELVSRCGEMLHIRYRLLR	23	0,872	
2	A	259	292	FVYQLMIGCHLEQPPPSNEEENVKLAHVKHKEQI	34	0,856	
3	A	45	58	QVVLSRGTHGGFLT	14	0,709	
4	A	120	143	FGLYYDAIWHFADNQLFVSGPNGT	24	0,702	
Discontinuous Epitopes			
1	A	1	5	A:M1, A:G2, A:R3, A:Q4, A:K5	5	0,957	
2	A	271	285	A:Q271, A:P272, A:P273, A:P274, A:S275, A:N276, A:E278, A:E279, A:N280, A:V281, A:K282, A:L283, A:A284, A:H285	14	0,914	
3	A	6	103	A:E6, A:L7, A:V8, A:S9, A:R10, A:C11, A:G12, A:E13, A:M14, A:L15, A:H16, A:I17, A:L21, A:L22, A:R23, A:L26, A:E96, A:P97, A:I99, A:P102, A:I103	21	0,775	

Figure 4. Depiction of predicted linear epitopes.

All epitopes are color-coded on the surface models. Red, green, blue, and yellow correspond to the highest values, respectively.

Figure 5. Representation of predicted discontinuous epitopes from A. fumigatus aquaporin and AQP3. All epitopes are highlighted with color on the surface models, where red, green, and blue signify the highest values, respectively.

Furthermore, the PyMOL visualization program allowed us to calculate the root mean standard deviation (RMSD), which measures the structural similarity between two aligned objects, specifically the proteins of interest ( Figure 6). The closer the RMSD value is to zero, the stronger the molecular similarity between the proteins. We obtained an RMSD value of 1.003, indicating a significant molecular similarity.

Figure 6. The structural overlap of A. fumigatus aquaporin (magenta) and human aquaporin AQP3 (cyan) is depicted in a cartoon model. The root-mean-square deviation (RMSD) is 1.003.

In addition, we identified epitopes that contained conserved sequences. In the case of fungal aquaporins, Linear Epitope (LE) 2 was identified, whereas in human aquaporins, LE 3 was found. Individual analysis revealed highly conserved fragments with more than four residues. For fungal aquaporins, the conserved residue is 80QVTLSKG86, whereas for human aquaporins, it is 45QVVLSRG52. The percentage of identity and similarity between these fragments was 71.4% and 85.7%, respectively, suggesting that these residues were highly likely to be antigenic patches ( Figures 7 and 8).

Figure 7. Potential similar antigenic patches in linear epitopes of A. fumigatus aquaporin and AQP3.

Figure 8. Identification of transmembrane functional activity domains in the aquaporin proteins of human AQP3 and the fungus A. fumigatus through color-coded assignment in their secondary structure.

Discussion

Numerous diseases, including atopic dermatitis, bullous pemphigoid, chronic spontaneous urticaria, and multiple sclerosis, are associated with the presence of IgE autoantibodies. In the context of allergic responses intertwined with autoimmunity, researchers have categorized autoantigens that bind to IgE into three functional groups: 1) autoantigens that share sequence homology with environmental allergens, 2) autoantigens that lack sequence homology with known environmental allergens, and 3) chemically modified autoantigens. However, the identification of environmental allergens with homology to human proteins and their influence on the allergic response vary among these autoantigens, and their clinical significance often remains unclear. 19

Aquaporin is a promising protein candidate for studying cutaneous, autoimmune, and allergic diseases, including atopic dermatitis (AD), because of its involvement in epidermal hydration and transportation of various substances such as glycerol, salts, and exocrine fluids. These functions contribute to skin dryness, which, in turn, facilitates the filtration of allergens. 14 This protein is widely present in numerous organisms, and exhibits a diverse range of isoforms and functions across different taxonomic groups.

Recent research has identified the presence of aquaporins in allergenic species such as dust mites. 20 Mao et al. characterized the proteome of Dermatophagoides farinae, and two-dimensional immunoblotting revealed the binding of IgE antibodies to a band with the same isoelectric point and molecular weight as the aquaporin family, suggesting its potential role as an allergen. 21

On the other hand, in a systematic review, a total of 32 articles were examined to assess the role of the microbiota in atopic dermatitis. The microbiome profile revealed substantial variation in bacterial diversity along with an increased presence of fungi. Notably, there was diversification and expansion of species belonging to the genus Aspergillus within the fungal group, whereas a reduction in the number of Malassezia spp. was observed. Research has also demonstrated that A. fumigatus is a prominent source of sensitization in patients with severe atopic dermatitis. Additionally, the presence of new allergens from this species is believed to have a significant impact on the severity of the condition. 22

The comprehensive analysis of aquaporins provides guidance for considering other potential allergenic sources beyond the main aquaporins studied, namely AQP3 and A. fumigatus aquaporin. We conducted a comparative analysis of 25 aquaporin sequences from various sources, including A. fumigatus aquaporin and human aquaporin 3 (AQP3). A comparison between A. fumigatus aquaporin and AQP3 revealed an identity of 32.6% and similarity of 47.5%, indicating a relevant level of homology between these two proteins despite the evolutionary gap and taxonomic diversification among species. Notably, human AQP3 exhibited the maximum identity and similarity values of 95.5% and 98.6%, respectively. These high values could be attributed to the inclusion of aquaporins from mammalian allergen sources. Given that these species belong to a taxonomic group closer to humans, it is understandable that the APQs are more conserved.

Five clades were constructed for the phylogenetic analysis. A and B showed the highest identity with A. fumigatus aquaporins and AQP3. The alignment results suggest that divergence among aquaporins primarily occurs in smaller species, while it remains conserved in mammals. In addition, the presence of aquaporin isoforms, each with special functions and locations, such as AQP3, indicates functional and phenotypic variability among different cell types within the same organism. However, despite this diversity, the identity of aquaporins within the clades revealed values higher than 30%, particularly in clade B (95%), indicating that if the protein is recognized by antibodies, potential cross-reactivity among these species can occur.

Only a limited number of studies have investigated the relationship between aquaporins derived from allergenic sources and their potential relevance in human diseases. Zhou et al. conducted an assessment using transcriptomics to identify potential AQPs in Blomia tropicalis using molecular cloning techniques, followed by a comparative analysis of identity among mite aquaporin sequences and human aquaporins. The author identified five putative AQP-coding sequences, known as BlotAQP1-5, which were indexed into all three subgroups: AQPs, aquaglyceroporins, and superAQPs. BlotAQP1, BlotAQP2, and BlotAQP5 were clustered with the aquaglyceroporins hAQP3, hAQP7, hAQP9, and hAQP10, with a common sequence consensus ‘N-G-NPSRD-PRL.’ The molecular weight and isoelectric point of these molecules were consistent with the findings reported by Mao et al. in their two-dimensional electrophoresis study. 23 This observation suggests the potential recognition of aquaporins, specifically aquaglycerins such as AQP3, by IgE in patients with allergies. These results are consistent with those presented in our findings, where despite the evolutionary distance between species, there is an identity exceeding 30% and consensus sequences that may serve as potential antigenic patches.

In contrast, in regions where higher conservation was observed among the sequences, neither linear nor conformational epitopes were identified. This is attributed to the fact that these sequences are in the transmembrane region of the protein, which limits their accessibility to antibodies. However, despite the absence of epitopes, these conserved regions are interesting. During cell lysis caused by mechanical injury or microbial effects, these proteins can be linearly exposed, leading to the emergence of neoepitopes that can be recognized by IgE or phagocytic cells. 24

Although little is known about the role of AQP3 as an allergen or autoantigen, other aquaporins have been studied for their relevance as antigens in autoimmune diseases. Sagan et al. investigated the relevance of AQP4 as an autoantigen in neuromyelitis optica, recognized by T lymphocytes, in an animal model. 25 This aquaporin is a water channel expressed in astrocytes in areas in contact with the blood-brain barrier, and 75% of patients with neuromyelitis have antibodies capable of recognizing AQP4. Therefore, the relevance of human aquaporins found in other tissues, such as AQP3 in the skin, can be considered as potential autoantigens and, through molecular mimicry, triggers relevant skin diseases such as atopic dermatitis. 26 Evidence indicates cross-reactivity with aquaporins expressed by bacteria and mycobacteria, including Escherichia coli and Mycobacterium species, in relation to this specific autoantigen. 27 This indicated that antibodies targeting aquaporins from A. fumigatus could potentially recognize and target this autoantigen. In a previous study, we found that AQP4 exhibits only one predicted cross-reactive epitope. It has been postulated that the recognition of a single epitope by autoantibodies could trigger an epitope spreading mechanism, leading to the involvement of additional autoantigens in the immune response. 28 For both A. fumigatus aquaporins and AQP3, a total of four linear epitopes and three discontinuous epitopes were described. Structural superimposition highlighted a notable degree of similarity between the proteins, indicating that the epitopes could reside within the corresponding antigenic regions. This observation supports the idea of a potential molecular mimicry between these proteins.

It is important to acknowledge that our study has several limitations. In silico modeling and epitope prediction analyses are not definitive, and there may be variations in the actual structure compared with our proposed models. Nonetheless, bioinformatic analyses offer several advantages in directing research resources efficiently. They play a crucial role in the preliminary assessment of hypotheses and help to determine whether it is justified to proceed with in vitro or ex vivo experiments. Also, AD is traditionally associated with IgE-mediated allergic responses, with elevated serum IgE levels and sensitization to environmental allergens. However, new evidence highlights the importance of considering non-IgE mechanisms in the pathogenesis and management of AD induce by A. fumigatus. 29 , 30 These non-IgE pathways contribute to the complexity of the disease and have significant implications for understanding its clinical variability, diagnosis, and treatment strategies and they should be considered in future studies of AQP as a trigger for atopic dermatitis.

Conclusion

During alignment of aquaporin sequences from A. fumigatus and AQP3, specific conserved epitopes were observed. Analysis revealed that the local sequence identity exceeded 70%, indicating molecular mimicry in these regions of both aquaporins. Further investigation of epitopes and domain identification revealed the most conserved region in transmembrane domains 12 and 14 of the respective aquaporins. This study represents a groundbreaking contribution to the exploration and analysis of aquaporin as a potential allergen and autoallergen in atopic dermatitis, as it is the first known study to focus on this subject. To confirm cross-reactivity, future in vitro studies are needed to demonstrate the IgE-binding capacity in these regions.

By acquiring knowledge regarding the sequences and structures of potential epitopes from different allergenic sources, we can modify and synthesize these molecules for future in vitro and in vivo studies. This not only expands the literature in the field of immunotherapy but also facilitates the diagnosis and treatment of autoimmune diseases such as atopic dermatitis. It is important to note that in silico tests optimize these studies by providing rapid results and circumventing the high costs associated with laboratory testing.

Acknowledgements

We thank the participants coauthor and institutions for their support in collecting the information. A preprint version of this article can be found ( https://www.techrxiv.org/doi/full/10.22541/au.169521327.76672515).

Data availability

Allermatch ( https://allermatch.org/)

UniProt ( https://www.uniprot.org/)

National Center for Biotechnology Information (NCBI) databases ( https://www.ncbi.nlm.nih.gov/).

There is no further data associated with this article.

10.5256/f1000research.171499.r323088
Reviewer response for version 2
Olivier Celso Eduardo 1Referee
1 American Institute Alergoimuno, Americana, Brazil
20 9 2024 Copyright: © 2024 Olivier CE
2024
https://creativecommons.org/licenses/by/4.0/ This is an open access peer review report distributed under the terms of the Creative Commons Attribution Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
Version 2recommendationapprove
The version 2 is ready to be indexed. Congratulations!

Is the work clearly and accurately presented and does it cite the current literature?

Partly

If applicable, is the statistical analysis and its interpretation appropriate?

Not applicable

Are all the source data underlying the results available to ensure full reproducibility?

Yes

Is the study design appropriate and is the work technically sound?

Yes

Are the conclusions drawn adequately supported by the results?

Partly

Are sufficient details of methods and analysis provided to allow replication by others?

Yes

Reviewer Expertise:

Allergy and Immunology; non-IgE-mediated hypersensitivity

I confirm that I have read this submission and believe that I have an appropriate level of expertise to confirm that it is of an acceptable scientific standard.

10.5256/f1000research.156440.r297871
Reviewer response for version 1
Garcia Elizabeth 1Referee https://orcid.org/0000-0002-7456-4007

1 Fundacion Santa Fe de Bogota, Bogotá, Bogota, Colombia
24 7 2024 Copyright: © 2024 Garcia E
2024
https://creativecommons.org/licenses/by/4.0/ This is an open access peer review report distributed under the terms of the Creative Commons Attribution Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
Version 1recommendationapprove
The present study offers key insights into the potential immunological cross-reactivity between human and fungal aquaporins. Major highlights include the discovery of substantial sequence and structural homology, which indicates possible sites for cross-reactivity, and the epitope analysis that identified overlapping regions among proteins, suggesting mechanisms for immune response triggers. The allergenic potential of aquaporins from various sources extends the study's implications, indicating similar underlying mechanisms in various allergic conditions, specially atopic dermatitis. The innovative integration of bioinformatics tools provides a comprehensive view of molecular mimicry, setting a precedent for future studies. Clinically, identifying specific epitopes that contribute to cross-reactivity opens avenues for targeted therapies and diagnostic tools, enhancing allergy management and prevention.

Minor highlights include the rigorous methodology and the clear direction for future research, emphasizing experimental validation to confirm findings. This study, with its broad potential impact, notably contributes to understanding molecular mimicry in allergic diseases and sets the stage for future investigations in the field.

Is the work clearly and accurately presented and does it cite the current literature?

Yes

If applicable, is the statistical analysis and its interpretation appropriate?

Yes

Is the study design appropriate and is the work technically sound?

Yes

Are the conclusions drawn adequately supported by the results?

No

Are sufficient details of methods and analysis provided to allow replication by others?

Yes

Reviewer Expertise:

As an allergist and immunologist I have contributed to studies such as: “Potential contribution of Helicobacter pylori proteins in the pathogenesis of type 1 gastric neuroendocrine tumor and urticaria. In silico approach. PLOS ONE | https://doi.org/10.1371/journal.pone.0281485. April 25, 2023

I confirm that I have read this submission and believe that I have an appropriate level of expertise to confirm that it is of an acceptable scientific standard.

10.5256/f1000research.156440.r301819
Reviewer response for version 1
Olivier Celso Eduardo 1Referee
1 American Institute Alergoimuno, Americana, Brazil
13 7 2024 Copyright: © 2024 Olivier CE
2024
https://creativecommons.org/licenses/by/4.0/ This is an open access peer review report distributed under the terms of the Creative Commons Attribution Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
Version 1recommendationapprove-with-reservations
It is a well-executed in-silico analysis comparing the amino acid sequences of human aquaporin 3  and Aspergillus fumigatus aquaporin with 25

aquaporins from various allergenic sources researched from the UniProt and NCBI databases. However, in "background," "introduction," and "discussion," the authors assume that the IgE antibody exclusively mediates allergic diseases and hypersensitivities mechanisms. Recently, at least seven types (with several subtypes) of hypersensitivity reactions were postulated. I suggest the authors peruse and pay attention to the following references in order to refer appropriately to the subject: [ref 1, 2].

Is the work clearly and accurately presented and does it cite the current literature?

Partly

If applicable, is the statistical analysis and its interpretation appropriate?

Not applicable

Are all the source data underlying the results available to ensure full reproducibility?

Yes

Is the study design appropriate and is the work technically sound?

Yes

Are the conclusions drawn adequately supported by the results?

Partly

Are sufficient details of methods and analysis provided to allow replication by others?

Yes

Reviewer Expertise:

Allergy and Immunology; non-IgE-mediated hypersensitivity

I confirm that I have read this submission and believe that I have an appropriate level of expertise to confirm that it is of an acceptable scientific standard, however I have significant reservations, as outlined above.

Competing interests: No competing interests were disclosed.

Competing interests: No competing interests were disclosed.

Competing interests: No competing interests were disclosed.
==== Refs
References

1 Múnera M Sanchez A Buendía E : Autoantigens in atopic dermatitis: The characterization of autoantigens and their diagnostic value. Translational Autoimmunity. Elsevier;2023; pp.37–48. 10.1016/B978-0-323-85389-7.00019-3
2 McKenzie C Silverberg JI : The prevalence and persistence of atopic dermatitis in urban United States children. Ann. Allergy Asthma Immunol. 2019;123 (2 ):173–178.e1. 10.1016/j.anai.2019.05.014 31128232
3 Luger T Amagai M Dreno B : Atopic dermatitis: Role of the skin barrier, environment, microbiome, and therapeutic agents. J. Dermatol. Sci. 2021;102 (3 ):142–157. 10.1016/j.jdermsci.2021.04.007 34116898
4 Sánchez J Calvo V Sánchez A : Sensitization to 10 mites in a tropic area. Der p and Der f are important risk factor for sensitization to other mites from Pyroglyphidae, Acaridae, Chortoglyphidae, and Glyciphagidae families. Rev. Alerg. Mex. 2017;64 (2 ):153–162. 10.29262/ram.v64i2.243 28658723
5 Olsson M Broberg A Jernås M : Increased expression of aquaporin 3 in atopic eczema. Allergy. 2006;61 (9 ):1132–1137. 10.1111/j.1398-9995.2006.01151.x 16918518
6 Sánchez J Páez B Macías-Weinmann A : Puntos clave en el tratamiento de la dermatitis en Latinoamérica. El Consenso SLAAI. Rev. Alerg. Mex. 2015;62 (3 ):226–233. 10.29262/ram.v62i3.87 26239333
7 Cardona R Sánchez A Larenas-Linnemann D : Extractos alergénicos para inmunoterapia en Latinoamérica. Rev. Alerg. Mex. 2018;65 (1 ):25–40. 10.29262/ram.v65i1.287 29723939
8 Sánchez J Sánchez A Cardona R : Critical review of ISAAC results for atopic dermatitis in tropical cities. Rev. Alerg. Mex. 2018;65 (4 ):389–399. 10.29262/ram.v65i4.341 30602209
9 Celakovska J Vankova R Bukac J : Atopic dermatitis and sensitisation to molecular components of alternaria, cladosporium, penicillium, aspergillus, and malassezia—results of allergy explorer alex 2. J. Fungi. 2021 Mar 1;7 (3 ):1–15. 10.3390/jof7030183
10 Glatz M Bosshard P Schmid-Grendelmeier P : The Role of Fungi in Atopic Dermatitis. Immunology and Allergy Clinics of North America. W.B. Saunders;2017; Vol.37 : pp.63–74. 10.1016/j.iac.2016.08.012 27886911
11 Sánchez P Vélez-del-Burgo A Suñén E : Fungal allergen and Mold allergy diagnosis: role and relevance of Alternaria alternata alt a 1 protein family. J. Fungi. 2022;8 (3 ):277. 10.3390/jof8030277 35330279
12 Muthu V Singh P Choudhary H : Role of recombinant Aspergillus fumigatus antigens in diagnosing Aspergillus sensitisation among asthmatics. Mycoses. 2020;63 (9 ):928–936. 10.1111/myc.13124 32490571
13 Disch R Menz G Biaser K : Different Reactivity to Recombinant Aspergillus fumigatus Allergen l/a in Patients with Atopic Dermatitis or Allergic Asthma Sensitised to Aspergillus fumigatus. Int. Arch. Allergy Immunol. 1995;108 (1 ):89–94. 10.1159/000237123 7647590
14 Ikezoe K Oga T Honda T : Aquaporin-3 potentiates allergic airway inflammation in ovalbumin-induced murine asthma. Sci. Rep. 2016 May 11;6 . 10.1038/srep25781 27165276
15 Emiliani Y Sánchez A Munera M : In silico analysis of cross reactivity among phospholipases from Hymenoptera species. F1000Res. 2021 Jan 5;10 :2. 10.12688/f1000research.27089.2 34046162
16 Emiliani Y Muzi G Sánchez A : Prediction of molecular mimicry between proteins from Trypanosoma sp. and human antigens associated with systemic lupus erythematosus. Microb. Pathog. 2022 Nov 1;172 :105760. 10.1016/j.micpath.2022.105760 36126789
17 Sánchez A Cardona R Munera M : Identification of antigenic epitopes of thyroperoxidase, thyroglobulin and interleukin-24. Exploration of cross-reactivity with environmental allergens and possible role in urticaria and hypothyroidism. Immunol. Lett. 2020 Apr 1;220 :71–78. 10.1016/j.imlet.2020.02.003 32027873
18 Múnera M Farak J Pérez M : Prediction of molecular mimicry between antigens from Leishmania sp. and human: Implications for autoimmune response in systemic lupus erythematosus. Microb. Pathog. 2020 Nov 1;148 :104444. 10.1016/j.micpath.2020.104444 32827635
19 Sánchez A Cardona R Munera M : Identification of antigenic epitopes of thyroperoxidase, thyroglobulin and interleukin-24. Exploration of cross-reactivity with environmental allergens and possible role in urticaria and hypothyroidism. Immunol. Lett. 2020 Apr 1;220 :71–78. 10.1016/j.imlet.2020.02.003 32027873
20 Wang LL Yu LL Zhou Y : Molecular Dynamics Simulations of Mite Aquaporin DerfAQP1 from the Dust Mite Dermatophagoides farinae (Acariformes: Pyroglyphidae). Biomed. Res. Int. 2020;2020 :1–7. 10.1155/2020/6717390
21 Le Mao J Mayer CE Peltre G : Mapping of Dermatophagoides farinae mite allergens by two-dimensional immunoblotting. J. Allergy Clin. Immunol. 1998;102 (4 ):631–636.9802372
22 Celakovska J Vankova R Bukac J : Atopic dermatitis and sensitisation to molecular components of alternaria, cladosporium, penicillium, aspergillus, and malassezia—results of allergy explorer alex 2. J. Fungi. 2021 Mar 1;7 (3 ):1–15. 10.3390/jof7030183
23 Zhou Y Li L Qian J : Identification of three aquaporin subgroups from Blomia tropicalis by transcriptomics. Int. J. Mol. Med. 2018 Dec 1;42 (6 ):3551–3561. 10.3892/ijmm.2018.3877 30221673
24 Koşaloğlu-Yalçın Z Lanka M Frentzen A : Predicting T cell recognition of MHC class I restricted neoepitopes. Onco Targets Ther. 2018 Nov 2;7 (11 ). 10.1080/2162402X.2018.1492508
25 Sagan SA Winger RC Cruz-Herranz A : Tolerance checkpoint bypass permits emergence of pathogenic T cells to neuromyelitis optica autoantigen aquaporin-4. Proc. Natl. Acad. Sci. USA. 2016 Dec 20;113 (51 ):14781–14786. 10.1073/pnas.1617859114 27940915
26 Ren Z Wang Y Duan T : Cross-immunoreactivity between bacterial aquaporin-Z and human aquaporin-4: potential relevance to neuromyelitis optica. J. Immunol. 2012;189 (9 ):4602–4611. 10.4049/jimmunol.1200486 23008451
27 Cossu D Yokoyama K Tomizawa Y : Altered humoral immunity to mycobacterial antigens in Japanese patients affected by inflammatory demyelinating diseases of the central nervous system. Sci. Rep. 2017;7 (1 ):3179. 10.1038/s41598-017-03370-z 28600575
28 Munera M Buendía E Sanchez A : AQP4 as a vintage autoantigen: what do we know till now? Heliyon. 2022;8 :e12132. 10.1016/j.heliyon.2022.e12132 36506380
29 Jutel M : Nomenclature of allergic diseases and hypersensitivity reactions: Adapted to modern needs: An EAACI position paper. Allergy. 2023;78 (11 ):2851–2874. 10.1111/all.15889 37814905
30 Olivier CE : Contribution of the Leukocyte Adherence Inhibition Test in Diagnosing Non–IgE-Mediated Immunoreactivity against Aspergillus fumigatus in Patients with Allergic Rhinitis and Asthma. Asian J. Immunol. 2024;7 (1 ):12–20.
