
==== Front
BMC Infect Dis
BMC Infect Dis
BMC Infectious Diseases
1471-2334
BioMed Central London

39198721
9775
10.1186/s12879-024-09775-2
Research
Reverse vaccinology approaches to design a potent multiepitope vaccine against the HIV whole genome: immunoinformatic, bioinformatics, and molecular dynamics approaches
Hashempour Ava 1
Khodadad Nastaran khodadad.n84@gmail.com

1
Akbarinia Shokufeh 1
Ghasabi Farzane 1
Ghasemi Younes 23
Nazar Mohamad Matin Karbalaei Ali 1
Falahi Shahab shahabivan@gmail.com

14
1 https://ror.org/01n3s4692 grid.412571.4 0000 0000 8819 4698 HIV/AIDS Research Center, Institute of Health, Shiraz University of Medical Sciences, Shiraz, Iran
2 https://ror.org/01n3s4692 grid.412571.4 0000 0000 8819 4698 Pharmaceutical Sciences Research Center, Shiraz University of Medical Sciences, Shiraz, Iran
3 https://ror.org/01n3s4692 grid.412571.4 0000 0000 8819 4698 Department of Biotechnology, School of Pharmacy, Shiraz University of Medical Sciences, Shiraz, Iran
4 https://ror.org/042hptv04 grid.449129.3 0000 0004 0611 9408 Zoonotic Diseases Research Center, Ilam University of Medical Sciences, Ilam, Iran
28 8 2024
28 8 2024
2024
24 8739 1 2024
20 8 2024
© The Author(s) 2024
2024
https://creativecommons.org/licenses/by/4.0/ Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/.
Substantial advances have been made in the development of promising HIV vaccines to eliminate HIV-1 infection. For the first time, one hundred of the most submitted HIV subtypes and CRFs were retrieved from the LANL database, and the consensus sequences of the eleven HIV proteins were obtained to design vaccines for human and mouse hosts. By using various servers and filters, highly qualified B-cell epitopes, as well as HTL and CD8 + epitopes that were common between mouse and human alleles and were also located in the conserved domains of HIV proteins, were considered in the vaccine constructs. With 90% coverage worldwide, the human vaccine model covers a diverse allelic population, making it widely available. Codon optimization and in silico cloning in prokaryotic and eukaryotic vectors guarantee high expression of the vaccine models in human and E. coli hosts. Molecular dynamics confirmed the stable interaction of the vaccine constructs with TLR3, TLR4, and TLR9, leading to a substantial immunogenic response to the designed vaccine. Vaccine models effectively target the humoral and cellular immune systems in humans and mice; however, experimental validation is needed to confirm these findings in silico.

Supplementary Information

The online version contains supplementary material available at 10.1186/s12879-024-09775-2.

Keywords

HIV
Vaccine
Bioinformatic
TLR
Molecular dynamic
Main HIV subtypes and CRF
http://dx.doi.org/10.13039/501100004320 Shiraz University of Medical Sciences grant number 29468 issue-copyright-statement© BioMed Central Ltd., part of Springer Nature 2024
==== Body
pmcIntroduction

Mortality from pathogenic agents has decreased globally; nevertheless, infectious diseases still inflict great catastrophes in human history [1–6]. For example, acquired immunodeficiency syndrome (AIDS) is a global health crisis caused by human immunodeficiency virus (HIV)-1 and is challenging to diagnose and treat [7]. Two types of HIV, HIV-1 and HIV-2, are recognized as the major causes of the AIDS pandemic, and HIV-1 is the most prevalent type [8, 9].

Antiretroviral therapy (ART) prevents the spread of HIV infection, slows the progression of AIDS, and extends the lifespan; hence, ART cannot eliminate HIV in the human body [7]. Therefore, there are still numerous obstacles to controlling or eradicating HIV infection that necessitate the development of an efficient vaccine. The global burden of HIV-infected individuals has been reduced significantly by the introduction of effective drugs such as ritonavir, dolutegravir, and efavirenz [10]. However, it is believed that a successful vaccine is needed to eradicate HIV [11].

There are several new approaches for developing an efficient HIV vaccine. Nonetheless, the main difficulties preventing the production of an optimal vaccine include the following: (1) HIV replication introduces a high rate of mutation in its genome that leads to the creation of new subtypes and circulating recombinant forms (CRFs) and strains; (2) HIV-1 establishes a latent reservoir; (3) there is no suitable animal model for investigating HIV behavior; (4) there are several funding issues associated with vaccine development [12]; (5) the designed vaccines are unable to induce both helper T-cell and cellular responses [13] and fail to produce broadly neutralizing antibodies; and (6) there are a wide variety of ways in which HIV can be transmitted to humans [14]. This is why the HIV vaccine cannot induce a sufficient immune response in the worldwide human population; for example, one of the most efficiently designed vaccines was RV144, which provides only 31.2% protection against HIV [15].

Different forms of vaccination are used to eradicate or control HIV infections, among which the conventional method is a very old approach that involves the use of live attenuated or dead organisms [16]. Currently, analyzing immunological data is the most efficient and powerful strategy for developing vaccines [17]. For example, multiepitope vaccines for several pathogens have attracted increased amounts of attention worldwide [18]. Furthermore, bioinformatic approaches have several advantages, including success in preclinical models, safety, specificity of the target, simplicity of production, etc. [19].

In this computational study, the vaccine models were well matched to the main HIV subtypes and CRFs that targeted the humoral and cellular immune systems in computer-based immune response simulations in both human and mouse hosts. For this purpose, one hundred HIV-1 sequences of the most prevalent subtypes and CRFs were retrieved from the Los Alamos National Laboratory (LANL) database, and consensus sequences of the main genes [Gag, protease (Pro), integrase (IN), reverse transcriptase (RT), and envelope (Env)], regulatory genes (Tat and Rev), and accessory genes (Vif, Nef, Vpr, and Vpu)] were generated. Using various servers, thousands of B cell, CD4, and CD8 primary epitopes were predicted and screened for distinctive criteria, including population coverage, antigenicity, allergenicity, toxicity, immunogenicity, topology, homology, and IFN-γ induction. Among several epitopes, only those located in the conserved domains of the two ORFs and nine proteins were candidates in the vaccine construct sequence. The secondary and tertiary structures of the vaccine constructs were investigated, and molecular docking and molecular dynamics studies of Toll-like receptors (TLRs) 3, 4, and 9 confirmed that the vaccine construct would not lose its effectiveness in the long run. Along with suitable adjuvants comprising beta defensin-3, a pan-HLA DR-binding epitope (PADRE), and the C-terminal invasin sequence of Yersinia, the vaccine construct can simulate the innate response through appropriate TLR dockings and induce appropriate proinflammatory cytokines such as IFN-ɣ. Finally, codon optimization and in silico cloning of the adeno-based vaccines and pET28(a) plasmid were performed to efficiently express the vaccine constructs in human and mouse host cells.

Materials and methods

Data retrieval, sequence alignment, and conservancy analysis

To design effective vaccine candidates against HIV, we retrieved the full genomes of the main HIV subtypes and CRFs [B (55%), C (15%), A (7%), AE (7%), D (3%), G (3%), F (1%), AG (3%), BC (2%), O (2%), BF (1%), and CRF35-AD (1%)] from the LANL HIV sequence database (www.hiv.lanl.gov) on 4th June 2023. This database provides valuable data, namely, the geographic distribution of HIV-1 sequences and subtypes derived from published reports.

Using CLC-sequence viewer software (version CLC Genomics Workbench 20) [20], the amino acid sequences of two ORFs (Gag and Env) and nine genes (Pro, IN, RT, Tat, Nef, Rev, Vif, Vpr, and Vpu) were obtained from each HIV whole genome. The homology among the sequences was examined by CLC-sequence viewer software with the following parameters: gap extension cost: 1.0, gap opening cost: 10, and very accurate progressive alignment algorithm. This step was followed by the alignment of one hundred sequences of two ORFs and nine genes to generate consensus sequences, which were considered for analysis to design the vaccine construct. To identify the conserved domains of the consensus protein sequences, we used NCBI CDD-BLAST (https://www.ncbi.nlm.nih.gov/Structure/cdd/wrpsb.cgi).

In addition, two distinct datasets, the National Center for Biotechnology Information (NCBI) (https://www.ncbi.nlm.nih.gov/) and the European Nucleotide Archive (ENA) (https://www.ebi.ac.uk/ena/browser/home), were utilized to obtain 100 unique HIV whole genomes from NCBI and ENA that were not duplicated across the three datasets (LANL, NCBI, and ENA). Two new groups of 100 HIV-completed genomes were carefully constructed with similar subtypes, ensuring a comprehensive and representative analysis (Additional Tables 1 and 2). A secondary analysis of all of the other HIV-1 genome sequences was performed to determine how conserved the identified epitopes were representative across the HIV-1 genetic landscape. For this purpose, we downloaded the full genomes of all the subtypes and CRFs that were not included in our study (Additional Table 1) from the HIV LANL. The sequence of each epitope was subsequently compared with the sequences of all the HIV subtypes and CRF sequences.

We derived the consensus sequence from two ORFs and nine genes and identified their conserved domains. The final epitopes selected from the HIV whole genome obtained from the LANL were assessed in the two new consensus sequences generated from the NCBI and ENA databases.

Prediction of biophysical and biochemical features

The ProtParam tool (https://web.expasy.org/protparam/) [21, 22] was applied to determine the physicochemical properties of two ORFs and nine proteins. The number of amino acids, estimated half-life, molecular weight, theoretical isoelectric point (pI), aliphatic index, instability index, and grand average of hydropathicity (GRAVY) index were analyzed. The pKa of each amino acid present in the protein sequence determines its physiochemical properties [23].

Prediction and selection of linear B-cell epitopes

To increase the accuracy of B-cell epitope prediction, which accounts for specific humoral immune response stimulation, five methods were used, including the ABCpred server (https://webs.iiitd.edu.in/raghava/abcpred/ABC_submission.html) and four tools in the immune epitope database and analysis resource (IEDB) (http://tools.iedb.org/bcell/), comprising Bepipred V2, the Emini Surface Accessibility Prediction tool, the Karplus flexibility tool, and the Parker Hydrophilicity Prediction method.

The ABCpred server relies on an artificial neural network of 700 B-cell epitopes and 700 non-B-cell epitopes spanning up to 20 residues for training and testing purposes [24–26]. BepiPred was the second server, with a threshold of 1 [27], to analyze the data by integrating various parameters, including physicochemical properties, antigenicity, hydrophilicity, etc. [28]. The third server was the Emini Surface Accessibility tool, which determines which parts of a protein are likely to be exposed on the surface [29]. The fourth and fifth servers are the Karplus flexibility prediction method and the Parker method, which are commonly used for prediction and include flexibility and hydrophilicity, respectively [26]. The suggested B-cell epitopes were screened through the following filters: (1) the VaxiJen server (http://www.ddg-pharmfac.net/vaxijen/) [30, 31] to assess the antigenic score, and epitopes that could not meet the server threshold level (0.4) were discarded; (2) the AllerTOP v.2.0 server (http://www.ddg-pharmfac.net/AllerTOP/) was used to estimate the allergenicity of the selected epitopes [32, 33]; (3) the ToxinPred webserver (https://webs.iiitd.edu.in/raghava/toxinpred/multi_submit.php) was used to characterize the toxicity of the epitopes [34, 35]; (4) the TMHMM server (https://dtu.biolib.com/DeepTMHMM) determined the transmembrane topology of the epitopes [36, 37]; and (5) the PIR peptide matching program (https://research.bioinformatics.udel.edu/peptidematch/index.jsp) [38–40] selected the epitopes that were homologous to HIV genes.

Prediction and selection of the CD4 helper T lymphocyte (HTL) epitope

The IEDB histocompatibility complex (MHC) II binding server (http://tools.iedb.org/mhcii) applied the NetMHCIIpan-4.1 algorithm that utilizes artificial neural networks (ANNs) to predict peptide binding to known sequence MHC II molecules. Through training on a vast dataset with over 500,000 measurements of binding affinity (BA) and eluted ligand mass spectrometry (EL) data encompassing HLA-DR, HLA-DQ, HLA-DP human MHC class II isotypes, and mouse molecules (H-2), the coverage of the server has been extended. In our study, we inputted a single protein sequence in FASTA format to predict the epitopes via the NetMHCIIpan-4.1 algorithm to identify specific species/loci. If relevant, the α and β chains were chosen separately (H2-IAb, H2-IAd, H2-IEd), along with the selection of a 15-mer length, and then all percentile ranks were set. We subsequently selected all options with a percentile rank below 10 after submission at the end of the use of these alleles for screening [41, 42]. The VaxiJen v2.0, Immunogenicity (https://tools.iedb.org/immunogenicity/), AllerTOP v.2.0, ToxinPred, TMHMM-2.0, topology, and PIR peptide matching programs were subsequently utilized for filtration. Moreover, the qualified epitopes were screened through the IFNepitope webserver (http://crdd.osdd.net/raghava/ifnepitope/predict.php). This server is used to identify interferon-gamma (IFN-γ)-inducing epitopes. The selected epitopes were considered for cross-checking with the IEDB class II immunogenicity server for human leukocyte antigen (HLA) class II binding [43, 44]. Finally, epitopes with the most HLA class-II coverage were subjected to population coverage.

Prediction and selection of the CD8 + T-cell (CTL) epitope

The consensus sequences of two ORFs and nine proteins were subjected to the NetCTL 1.2 server (https://services.healthtech.dtu.dk/services/NetCTL-1.2/) with a threshold value of 0.5 and other default parameters, including a weight on TAP transport efficiency of 0.05 and a weight on C-terminal cleavage of 0.15, to obtain 9-mer CTL epitopes against HLA class I allele subgroups of 12 superfamilies (A1, A2, A3, A24, A26, B7, B8, B27, B39, B44, B58, and B62) [45, 46]. The epitopes that exhibited good binding affinity with human supertypes were screened through different filters: VaxiJen, AllerTOP, ToxinPred, TMHMM-2.0, and the PIR peptide matching program. The selected epitopes were cross-checked with two servers: the NetMHC 4 server (https://services.healthtech.dtu.dk/services/NetMHC-4.0/) for mouse alleles (H-2-Db, H-2-Dd, H-2-Kb, H-2-Kd, H-2-Kk, and H-2-Ld) [47] and the IEDB class I immunogenicity server for human HLA class-I binding (http://tools.immuneepitope.org/mhci/) [43]. The MHC-I binding prediction tool generates a percentile rank for each epitope‒allele complex to indicate affinity. A lower percentile rank indicates a stronger binding prediction, so a base value of 10 was set to evaluate binding to all MHC class I alleles [48, 49]. Finally, most HLA-containing epitopes were subjected to population coverage analysis, which was included in the human vaccine model.

Population coverage

The frequency of HLA alleles varies significantly across diverse ethnic groups. Hence, when designing and creating T-cell epitope-based diagnostics or vaccines, it is crucial to choose various epitopes that possess diverse HLA-binding specificities. This approach will result in enhanced coverage of the patient population, ensuring effectiveness and inclusivity [50]. The IEDB population coverage tool (http://tools.iedb.org/population/) was utilized to evaluate the global distribution of HIV-1 recognition of MHC class I and MHC class II alleles [50–52]. A list of CTL- and HTL-selected epitopes and identified alleles is given in Additional Tables 3 and 4.

Construction of a multiepitope subunit vaccine

In the final vaccine construct, the qualified epitopes of each ORF and protein that were located in conserved domains and overlapped with other epitopes, unless there were limited numbers of epitopes, were considered. At the N-terminal end of the vaccine construct, the beta defensin-3 adjuvant (GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK) was incorporated into the vaccine model to not only protect the construct from degradation [53] but also stimulate robust immune reactions, especially mucosal immune responses toward HIV and other viral infections [54]. This sequence is followed by the EAAAK linker and universal PADRE (AKFVAAWTLKAAA) to overcome the problems caused by highly polymorphic HLA class 2 alleles in the final vaccine construct [55]. GGGS linkers were used to join CTL epitopes, whereas GPGPG and KK linkers were used to join HTL and B-cell (BCL) epitopes, respectively. Finally, the C-terminal invasin sequence of Yersinia (TAKSKKFPSYTATYQF) was added to the C-terminus of the construct via the EGGE linker. Although the EAAAK linker can be characterized as a rigid linker in the final vaccine candidate, GGGS, GPGP, KK, and EGGE consequently provide flexibility for fusing the epitopes [56]. The abovementioned linkers were utilized to ensure the effective separation of individual epitopes [57]. Finally, the sequence of the vaccine model was screened through the VaxiJen server, AllerTOP v.2.0 server, ToxinPred2 webserver (https://webs.iiitd.edu.in/raghava/toxinpred2/batch.html), TMHMM server, and PIR peptide matching program [38, 39].

Prediction of physicochemical and immunogenic properties

The physicochemical properties of the vaccine construct were characterized via ProtParam, a tool available on the ExPASy server [22, 58]. Using this tool, various properties, including molecular weight, theoretical pI, half-life in mammalian reticulocytes, yeast, and Escherichia coli, the instability index, the extinction coefficient, the amino acid composition, the atomic composition and GRAVY, were evaluated. Furthermore, the antigenicity and allergenicity of the multiepitope vaccine construct were investigated via VaxiJen and AllerTOP, respectively (Additional Table 14).

Solubility of the antigenic fusion protein

The solubility of the chimeric vaccine was examined using the Protein-sol server (https://protein-sol.manchester.ac.uk/). The average solubility for the experimental dataset (PopAvrSol) is 0.45. Therefore, any scaled solubility value exceeding 0.45 is anticipated to indicate a higher solubility than the typical soluble E. coli protein from the experimental solubility dataset [59, 60].

Secondary structure prediction, tertiary structure (3D) modeling, refinement, and validation of the vaccine construct

The sequence of the vaccine was submitted to the Self-Optimized Prediction Method with Alignment (SOPMA) server (https://npsa-prabi.ibcp.fr/NPSA/npsa_sopma.html) to predict four conformational states, including beta sheets, bridges, turns, and coil helices [61, 62]. Another tool used to evaluate the secondary structure of vaccine constructs was RNAfold (http://rna.tbi.univie.ac.at/cgi-bin/RNAWebSuite/RNAfold.cgi) [16, 63]. To develop the tertiary structures of the vaccine constructs, the I-TASSER (https://zhanggroup.org/I-TASSER/), Robetta (https://robetta.bakerlab.org/), and AlphaFold (https://usegalaxy.eu/?tool_id=alphafold) servers were used to generate five models [64, 65], and the optimal crude 3D models of the vaccine sequence were subsequently submitted to the GalaxyWEB server (https://galaxy.seoklab.org/) to rebuild unreliable termini or loops of the initial model structures to generate five refined models [66, 67]. The GalaxyWEB server provides five models that are determined based on various parameters, such as GDT-HA, RMSD, MolProbity, Clash score, Poor rotamers, and Rama favored. These models are used for template selection, sequence alignment, model building, and refinement. However, the server cannot determine the best model among the five proposed models. Therefore, the ERRAT (http://services.mbi.ucla.edu/ERRAT) [68], ProSA-Web (https://prosa.services.came.sbg.ac.at/prosa.php) [69], and RAMPAGE (http://mordred.bioc.cam.ac.uk/~rappe r/rampa ge.php) [70, 71] online tools were utilized to identify the optimal model in this research. The ERRAT program calculates the overall quality factor on the basis of the number of nonbonded interactions between different atomic types within a specific distance (0.35 nm); typically, models with a quality factor above 85 are considered good. The RAMPAGE tool uses a Ramachandran plot to assess the stereochemical quality of a protein structure. A better model will have more residues in the favored region and fewer residues in the disallowed region of the plot. The Z score from the ProSA-Web server is an indicator of the overall quality of the model, where a positive Z score suggests potential issues or errors in the structure [14, 39, 72].

Disulfide engineering of the vaccine construct

Disulfide engineering is a biotechnological technique that involves mutation of a cysteine residue to create new disulfide bonds within a specific highly flexible protein region. Disulfide linkages exhibit remarkable stability and assist in the preservation of protein geometric conformations [73]. Disulfide engineering of the vaccine construct was carried out using disulfide via the Design 2 online tool (http://cptweb.cpt.wayne.edu/DbD2/). The server identifies the potential locations within the protein structure that have a greater likelihood of forming disulfide bonds [74].

Prediction of discontinuous B-cell epitopes

The ElliPro tool (http://tools.iedb.org/ellipro/) of the IEDB server [75, 76] suggested the presence of linear and conformational B-cell epitopes in the constructed conjugated vaccine with a screening threshold of 0.5. The tertiary structure of the validated vaccine construct was submitted to the server, and epitopes with scores greater than the threshold were considered linear or discontinuous B-cell epitopes [58].

Peptide‒protein molecular docking

The presentation of pathogen-derived peptides to T cells relies heavily on MHC molecules [39]. AutoDockVina software was used to assess the molecular docking process of the interaction performance of the anticipated epitopes (CTLs and HTLs) with their corresponding binding alleles [77]. To accomplish this, the protein database (PDB) website (https://www.rcsb.org/) was used to retrieve the PDB files of the most prevalent alleles (MHC molecules) (Additional Tables 3 and 4). To model the three-dimensional structure of T-cell epitopes as ligands, we utilized the PEPFOLD 4.0 server (https://mobyle2.rpbs.univ-paris-diderot.fr/cgi-bin/portal.py#forms::PEP-FOLD4) [78, 79].

Protein‒protein docking between TLR3, TLR4, and TLR9 and the vaccine construct

Establishing a stable connection between a potential vaccine and an immune receptor is crucial for triggering effective immune responses. TLRs not only play crucial roles in the initial defense against pathogens but also serve as vital links between innate and adaptive immunity [39]. In other words, TLR3 recognizes double-stranded RNA (dsRNA) and single-stranded RNA (ssRNA) [80, 81]. However, TLRs can also bind to polyproteins and epitopes [82–84]; for example, TLR3 serves as a receptor for the construction of a vaccine that is capable of identifying the virus [29, 85–88]. For this purpose, the vaccine includes a TLR3 agonist called β-defensin, which is attached to the N-terminus via an EAAAK linker [88], and TLR4 is capable of triggering immune responses against viruses by recognizing proteins on the surface of the virus [39]. Molecular docking is a computational method that can be used to evaluate the binding affinity between vaccine constructs and immune receptors, as well as the formation of interaction complexes [79]. Consequently, we utilized the ClusPro 2.0 online server (https://cluspro.bu.edu/login.php) [89] to carry out molecular docking of the vaccine constructs with TLRs (TLR3, TLR4, and TLR9). The PDB files for TLR3 (PDB ID: 1ZIW), TLR4 (PDB ID: 3FXI), and TLR9 (PDB ID: 3 WPB) were extracted from the RCSB database (https://www.rcsb.org/) [14]. In this study, molecular docking was used for blind docking.

Molecular dynamic simulation

Molecular dynamics (MD) simulation is widely acknowledged as a highly effective approach for the molecular examination of biological systems [90]. Here, the behavior of the designed vaccine against the TLR3, TLR4, and TLR9 systems was studied using Linux-based GROMACS software (http://www.mdtutorials.com/gmx/lysozyme/) [91]. During the initial phase of preparation, the vaccine-TLR complexes underwent the incorporation of OPLS-AA (Optimized Potential for Liquid Simulation) force field parameters. This step results in the generation of coordinate and topology files for the complex system. Afterward, the systems were solvated using the transferable intermolecular potential 3P (TIP3P) water model; then, the systems were neutralized with Cl- ions, ensuring that the topological and structural coordinates remained stable [39]. Subsequently, the process of energy minimization was conducted, resulting in the acquisition of the final structure through energy minimization (EM) [72]. The NVT ensemble equilibration lasted 100 ps and involved 50,000 steps to achieve the desired temperature. The NPT ensemble, with 50,000 steps, was then utilized to examine the density, potential, pressure, and temperature of the stabilized vaccine construct throughout the entire process. Following equilibration, MD simulations of 100 ns and 50,000,000 steps were conducted on the construct. The backbone’s root mean square deviation (RMSD) of energy was minimized after the MD simulation, and the results are presented in the form of graphs. Additionally, the radius of gyration, hydrogen bonds, and density plots were analyzed, as was the performance of the root mean square fluctuation (RMSF) protocol during the MD simulation.

Immune stimulation

To conduct an immune simulation analysis of the HIV-1-specific vaccine, we employed C-IMMSIM (https://kraken.iac.rm.cnr.it/C-IMMSIM/index.php?page=1) [92]. This tool uses the Miyazawa-Jernigan residue-residue potential to evaluate the strength of the interaction between a T-cell receptor and a specific peptide-HLA complex [93]. C-IMMSIM was utilized with its default settings [72], except for host HLA selection; specifically, HLA-A*0101, HLA-A*0301, HLA-B*1501, HLA-B*0801, HLA-DRB1*1101, and HLA-DRB1*0101 were chosen because of their higher genotypic frequencies in the global population, as determined by the IEDB analysis server.

Codon optimization and in silico cloning

Since the epitopes of the vaccine model were compatible with both the human and mouse immune systems, both eukaryotic and prokaryotic expression vectors were generated. For constructing the adenovirus-based vaccine, the Kozak sequence containing a start codon that controls the translation initiation was incorporated at the N-terminus end of the vaccine protein. The level of MMLV-RT protein expression was enhanced by codon optimization performed by the VectorBuilder server (https://en.vectorbuilder.com/tool/codon-optimization.html) for the Homo sapiens expression system [94]. The cleavage sites of two restriction enzymes (EcoRV and BglII) were removed from the optimized cDNA sequence. A highly efficient reverse-transcribed nucleotide sequence with a suitable CAI and GC content was inserted into the pAdTrack-CMV shuttle vector between the EcoRV and BglII restriction sites under the control of the CMV promoter using SnapGene v7.1.1 [95]. In addition, similar processes were performed for in silico cloning of the prokaryotic vaccine construct in the pET28(a) plasmid using the BamH1 and Xho1 restriction enzymes and codon optimization in the K12 strain of E. coli. The flowchart of the vaccine design is illustrated in Fig. 1.

Fig. 1 Overview of the flowchart of multiepitope vaccine design in this study

Results

Protein sequence retrieval and alignment

Up to June 2023, the frequency of subtypes and CRFs submitted to the LANL database and the accession numbers of 100 full-length HIV sequences of the most predominant subtypes and CRFs used in this study are presented in Additional Fig. 1 and Additional Table 5, respectively. The consensus sequences of Gag, Env, Pro, IN, RT, Tat, Nef, Rev, Vif, Vpr, and Vpu are displayed in Additional Table 6.

Identification of conserved domains and the biophysical and biochemical features of HIV genes

The conserved domains of each sequence are listed in Additional Table 7. Among the different epitopes that passed through the various filters, only those located in the conserved domains were qualified for consideration in the vaccine construct. The physicochemical properties (i.e., the aliphatic index, grand average hydropathicity, instability index, molecular weight, and theoretical pI) of all the consensus sequences determined with the ExPASy ProtParam tool are shown in Additional Table 8.

Linear BCL epitope prediction

Out of thousands of suggested epitopes, only a limited number with suitable features, such as antigenicity, topology, toxicity, and allergenicity, were selected (Additional Table 9). Finally, one epitope of each ORF and protein that overlapped with either other B-cell epitopes or CD8 and HTL epitopes was considered in the vaccine construct (Table 1). Additional Fig. 2 illustrates the predicted B-cell epitope of the Tat protein determined with the IEDB linear epitope tool.

Table 1 A list of B cell-selected epitopes of HIV-1 genes

Genes	Epitope	Software	Start	End	Score	VaxiJen
Score	Allergenicity	Toxicity	Topology (With or without signal sequence)	
Gag	IRLRPGG	Karplus	19	25	1.025	2.1646	Non- allergen	Non-toxin	Without	
Pro	IKIGGQL	Karplus	13	19	1.046	1.0806	Non- allergen	Non-toxin	Without	
RT	IPSINNE	Karplus	167	173	1.042	0.7476	Non- allergen	Non-toxin	Without	
IN	SGYIEAE	Parker	81	87	2.857	0.7208	Non- allergen	Non-toxin	Without	
Vif	SIEWRKR	Parker	86	92	1.486	3.4666	Non- allergen	Non-toxin	Without	
Vpr	CQHSRIG	Parker	76	82	2.557	1.4496	Non- allergen	Non-toxin	Without	
Tat	TKGLGIS	Parker	40	46	1.657	1.2613	Non- allergen	Non-toxin	Without	
Rev	PAEPVPL	Karplus	67	73	1.024	0.9032	Non- allergen	Non-toxin	Without	
Vpu	IDRIRER	Parker	43	49	1.029	0.6271	Non- allergen	Non-toxin	Without	
Env	HYCAPAG	Parker	206	212	1.943	1.0720	Non- allergen	Non-toxin	Without	
Nef	MRRTEPA	Karplus	20	26	1.05	1.5441	Non- allergen	Non-toxin	Without	

HTL epitope prediction

Epitopes that were proposed by both the IEDB MHC II and HLA binding webservers and were able to bind to at least one mouse H-2-I allele and one human allele were screened through a number of filters. The epitopes could bind to both human and mouse alleles simultaneously to induce immune responses in both mice and humans. Finally, only those epitopes that were antigenic, nonallergenic, nontoxic, and without signal sequences that can induce IFN-γ and Th1 humoral responses were considered in the final vaccine models (Table 2 and Additional Table 10); however, the Rev and Vpr proteins did not contain any subtitle epitopes, which might be due to the short length of these proteins.

Table 2 Potential antigenic and immunogenic HTL epitopes

Gene	Start	End	Epitope	Topology (With or Without signal sequence)	VaxiJen Score	Allergenicity	Toxicity	IFN-γ	Immunogenicity	
Gag	10	24	GGKLDRWEKIRLRPG	Without	0.4991	Non-Allergen	Non-Toxin	+	0.3008	
Pro	39	53	PGKWKPKMIGGIGGF	Without	1.0701	Non-Allergen	Non-Toxin	+	0.0796	
RT	158	172	DFRKYTAFTIPSINN	Without	0.6093	Non-Allergen	Non-Toxin	+	0.0955	
IN	25	39	DFNLPPVVAKEIVAS	Without	0.9722	Non-Allergen	Non-Toxin	+	0.1541	
Vif	84	98	GVSIEWRKRRYSTQV	Without	1.5905	Non-Allergen	Non-Toxin	+	0.1403	
Tat	43	57	LGISYGRKKRRQRRR	Without	1.2098	Non-Allergen	Non-Toxin	+	0.3977	
Vpu	24	38	TIVFIEYRKILRQRK	Without	0.5875	Non-Allergen	Non-Toxin	+	0.2951	
Env	204	218	PIHYCAPAGFAILKC	Without	0.4874	Non-Allergen	Non-Toxin	+	0.1947	
Nef	11	25	VGWPAVRERMRRTEP	Without	0.9814	Non-Allergen	Non-Toxin	+	0.3567	

CTL epitope prediction

Among the vast majority of epitopes that interacted with 12 MHC supertypes, a small percentage were immunogenic, antigenic, nontoxic, nonallergenic, and nonhomologous to the human proteome and exhibited appropriate topology (Table 3 and Additional Table 11). Again, epitopes located in conserved domains were considered in the final vaccine construct (Additional Table 4).

Table 3 Potential antigenic and immunogenic CTL epitopes

Gene Name	Start	End	Epitope	Topology (With or Without signal sequence)	VaxiJen score	Allergenicity	Toxicity	Immunogenicity	
Gag	31	39	LKHIVWASR	Without	1.7391	Non allergen	Non toxin	1.7391	
Pro	12	20	TIKIGGQLK	Without	1.1453	Non allergen	Non toxin	1.1453	
RT	171	179	NNETPGIRY	Without	0.4586	Non allergen	Non toxin	0.4586	
IN	96	104	ETAYFILKL	Without	0.5370	Non allergen	Non toxin	0.5370	
Vif	145	153	LQYLALTAL	Without	1.2523	Non allergen	Non toxin	1.2523	
Vpr	52	60	DTWAGVEAI	Without	0.5053	Non allergen	Non toxin	0.5053	
Tat	42	50	GLGISYGRK	Without	2.1524	Non allergen	Non toxin	2.1524	
Rev	65	73	GRPAEPVPL	Without	0.9323	Non allergen	Non toxin	0.9323	
Vpu	24	32	TIVFIEYRK	Without	1.7899	Non allergen	Non toxin	1.7899	
Env	669	677	GLRIVFAVL	Without	0.8764	Non allergen	Non toxin	0.8764	
Nef	188	196	RLAFRHMAR	Without	0.9852	Non allergen	Non toxin	0.9852	

Despite the diversity of the HIV sequence, the conserved domains of ORFs and genes were highly similar among the consensus sequences obtained from the first, second, and third databases (in all subtypes and CRFs). Furthermore, our results revealed that the sequences of the predicted epitopes were highly similar to the sequences of all the subtypes and CRFs. Our research revealed that a substantial proportion of the CD4, CD8, and B-cell epitopes selected for the final vaccine contract were either 100% identical or had only a few mismatches with each other (Additional Table 12).

Population coverage

The IEDB population coverage tool was utilized to analyze the population coverage of eleven CTL and nine HTL epitopes, along with their corresponding HLA alleles, across 16 and 8 different regions worldwide. European countries demonstrated the highest prevalence of the MHCI and II alleles, with 99.96% coverage for all the genes. Conversely, Central American countries had the lowest distribution (53.8%) of combined alleles across all the genes. Additionally, an examination of the effects of these epitopes on the population demonstrated that 95.04% of the global population (MHC class I and II combined) was covered. This information is visually represented in Fig. 2A-B and Additional Table 13. The findings on population coverage imply that the designed HIV-1 vaccine candidates possess the ability to fight the global prevalence of HIV infection.

Fig. 2 Percentage of the combined coverage of the selected CTL and HTL epitopes. A) Global population; B) dense population

Vaccine construction

A multiepitope vaccine was constructed with eleven BCLs, eleven CTLs, and nine HTLs, which were joined together on the basis of the genomic arrangement of the HIV proteins. We failed to find qualified HLA epitopes for both the Rev and Vpr genes. To separate each CTL, HTL, and BCL epitope from the other epitopes, we added the GGGS, GPGPG, and KK linkers, respectively. These linkers ensure the efficient presentation of epitopes and maximal immunity in the body. Three adjuvants were incorporated into the vaccine construct. The first was beta defensin-3, a TLR4 agonist that was added at the N-terminal end of the construct. The second adjuvant was the PADRE sequence, which was fused to beta-defensin-3 via the EAAAK linker. To ensure maximal MHC-II allele coverage and CTL response induction, the PADRE sequence, which was separated from CTL epitopes by a GGGS linker, was considered in the construction. The third one was the C-terminal invasin sequence of Yersinia, and the BCL epitopes were linked to it by an EGGE linker (Fig. 3A).

Fig. 3 Graphical map, tertiary structure, and ligand‒receptor docked complex of the HIV-vaccine construct. A) The vaccine constructs consisted of an adjuvant, as well as CTL, HTL, and BCL epitopes, arranged from left to right; B) Model-1 was constructed with I-TASEER software (protein modeling service) after refinement with the Galaxy Web server; C) Docked complex of the vaccine construct with C1) TLR-3, C2) TLR-4, and C3) TLR-9. The vaccine molecule is indicated in yellow, while TLR-3, TLR-4, and TLR-9 are indicated in blue. The lowest energy scores of the vaccine construct with other TLRs were − 1284.4 for TLR3, -1381.5 for TLR4, and − 1355.9 for TLR, according to the ClusPro server

On the basis of the diverse filters and servers, the sequence of the vaccine model (Additional Table 6) seems to be safe for in vitro and in vivo studies. The sequence of the vaccine model was antigenic, nontoxic, nonallergenic, and nonhomologous to the human proteome, without any signal sequence (Additional Table 14).

Secondary and tertiary structure prediction, refinement, and validation

The SOPMA server was used to define the secondary structures of the ultimately chosen vaccine construct. The results (Additional Table 15) demonstrated that the proposed vaccine sequence included 14.12% alpha helices, 51.89% coils, and 8.75% beta sheets. Furthermore, the RNAfold website calculates the free energy of the structures of the optimized sequences of both the human and mouse vaccines, as illustrated in Fig. 4A1-4. The energies of the secondary centroid structures of the human and mouse vaccines were − 494.20 and − 384.60 kcal/mol, respectively, whereas the MFEs of the constructs during production were − 594.40 and − 585.70 kcal/mol, respectively. The kilocalorie per mole is a measurement unit for energy per atom, molecule, or similar particle. It is equivalent to one kilocalorie of energy per mole of a substance, defined as 1000 thermochemical gram calories [96]. To generate the 3D vaccine model, the I-TASSER, Robetta, and AlphaFold servers produced a total of 15 vaccine construct models, and the reliability of each model in I-TASSER was estimated by means of the C-score. Consequently, the model that demonstrated the most positive C-score (-1.50) was ultimately selected for refinement (Additional Fig. 3).

To refine the selected model, we utilized the GalaxyRefine server (Fig. 3B), and the quality analysis of the ProSA web server revealed an enhanced Ramachandran plot, where the greatest residues were found in the most favored area (Additional Fig. 4A). The results from the validation of the three servers were compared, and it was found that the I-TASSER model generated was more reliable than the other two methods (Additional Table 16). Overall, the three-dimensional high-quality model was selected as the 3D structure of the vaccine.

Solubility of the vaccine

In our investigation, the solubility was 0.645, while its isoelectric point (PI) was 11.330. These findings demonstrated that the solubility of the fusion protein can be diminished through the inclusion of a linker between the antigenic compounds. The results are shown in Additional Fig. 4B.

Disulfide engineering of the vaccine construct

During vaccine protein disulfide engineering, amino acid pairs were specifically chosen based on having a bond energy less than 2.2 kcal/mol. The vaccine design identified six pairs of amino acids meeting these criteria: 45 Lys and 48 Ala, 163 Tyr and 218 Glu, 179 Lys and 230 Gly, 220 Ile and 242 Ser, 231 Asp and 234 Lys, 266 Gly and 314 Tyr. The amino acid pairs chosen were used to create a mutant version of the original vaccine with disulfide bonds in the DbD2 online server (see Additional Table 17). The design of the HIV vaccine aimed to incorporate six potential pairs of amino acid residues that could form disulfide bonds. Hence, it can be regarded as a highly stable construct for a vaccine.

Prediction of discontinuous B-bell epitopes

The presence of effective B-cell epitopes is vital in vaccine models for inducing humoral immunity against foreign pathogens [97]. ElliPro at the IEDB identified six epitopes with residues ranging from 3 to 79 in the vaccine construct and scores between 0.536 and 0.771 (Additional Table 18; Fig. 4B). The highest score was 0.735, with a residual position of 1–119 (Additional Fig. 5). In parallel, ten linear B-cell epitopes with residues ranging from 6 to 74 were confirmed in the vaccine, with scores ranging from 0.56 to 0.84 (Additional Table 19, Additional Fig. 6). Three linear epitopes of the vaccine construct overlapped with the discontinuous epitopes located in the vaccine model (Table 4).

Fig. 4 RNAfold results and the mapping of discontinuous B-cell epitopes on HIV vaccine constructs. (A) mRNA secondary structures in the human model (A1-2) and mouse model (A3-4). In general, the red color in the RNAfold software secondary structure figure usually denotes the highest probability of RNA base pairing, and the colors shifting from orange, yellow, green, blue, and violet to pink represent the probability of a reduction in base pairing within the secondary structure of the vaccine. (B) Mapping of discontinuous B-cell epitopes on the vaccine construct (a-f) is shown by the yellow region of the vaccine, which displays each discontinuous B-cell epitope containing residues 3 to 84 with score values ranging from 0.536 to 0.771

Table 4 Discontinuous epitopes found in vaccine construct overlapped with linear epitopes

Protein	Overlapped Discontinuous Epitopes	Final Linear B cell epitopes	Start and end positions in vaccine construct		
Pro	A: S396, A: R397, A: I398, A: G399, A: K400, A: K401, A: T402	IKIGGQL	396–402		
RT	A: L405, A: G406, A: I407, A: S408, A: K409, A: K410, A: P411	IPSINNE	405–411		
IN	A: P414, A: V415, A: P416, A: L417, A: K418, A: K419, A: I420	SGYIEAE	414–420		

Molecular docking of the T-cell epitopes with MHC molecules

In this investigation, we conducted a molecular docking process to examine the interactions between individual T-cell epitopes and their respective alleles, as outlined in Additional Tables 3 and 4. The results presented in Table 5 reveal that the binding energy between CTL epitopes and HLA I alleles varied from − 8.4 to -6.3 kcal/mol. In comparison, the binding energy range between the HTL epitopes and HLA II alleles was from − 7.3 to -5.1 kcal/mol, according to the AutoDock Vina docking data.

Table 5 Auto dock VINA results between CTL and HTL with the related alleles

	Gag	Pro	RT	IN	Vif	Vpr	Tat	Rev	Vpu	Env	Nef	
Binding Energy	CTL + HLA I	-8	-6.3	-7.8	-6.8	-8.2	-7.9	-6.8	-6.6	-6.5	-8.4	-6.5	
HTL + HLA II	-5.9	-7.3	-6.5	-6.3	-5.1	NA	-5.5	NA	-6.4	-6.8	-6.2	
NA: We did not find any suitable HTL epitopes for Vpr and Rev proteins

According to our data, the CTL epitope (GLRIVFAVL) of the envelope gene and the HTL epitope (PGKWKPKMIGGIGGF) of the protease gene had the highest binding energies when matched with the corresponding alleles (HLA-B*08:01 and HLA-DRB1*11:01).

Protein‒protein docking between TLRs and vaccine constructs

The interaction between TLRs and the vaccine construct was examined through protein‒protein docking utilizing ClusPro 2.0. For each docking, a total of 30 models were generated (Additional Fig. 7). From this pool, we selected the models that effectively occupied the receptor with the most favorable energy scores. The lowest energy scores achieved for docking between the vaccine construct and TLR3, TLR4, or TLR9 were − 1284.4, -1381.5, and − 1355.9, respectively (Additional Table 20). The docked complexes revealed that the designed vaccine constructs exhibited the strongest binding affinity for the three TLRs at the lowest energy levels (Fig. 3C1-3).

Molecular dynamic analysis

Energy minimization, density, pressure, temperature, potential energy, and radius of gyration calculations were performed for the HIV-1 vaccine construct. The radius of gyration provided evidence of the overall structural stability of the construct throughout the MD simulation (Fig. 5C). The RMSD and RMSF values were obtained by studying the trajectory generated after a 100 ns simulation. The designed vaccines with TLRs (TLR3, TLR4, and TLR9) exhibited RMSD values up to 0.78 nm, 0.98 nm, and 0.98 nm, respectively, indicating stability, with an average RMSD value of 0.73 nm for the vaccine during the simulation (Fig. 5B). The RMSF analysis confirmed that the overall structure of the protein remained stable throughout the MD simulation (Fig. 5A). This outcome suggested that the vaccine-TLR complex possesses considerable structural flexibility and stability, indicating a favorable response from the immune receptor.

Fig. 5 MD analysis of the TLR-3, TLR-4, and TLR-9 vaccine constructs. A) The RMSD of the docked complex exhibits a small deviation, reflecting the stable interaction between the vaccine construct and TLRs. B) The RMSF plot remained flat, reflecting the flexibility of the side chain of the docked protein complex. C) The radius of the gyration plot reveals a relatively flat curve, indicating the presence of a stable vaccine-TLR complex. In the plots, TLR3, TLR4, and TLR9 are indicated with blue, orange, and gray, respectively

Immune stimulation

The immune simulation results for the HIV-1 vaccine construct are shown in Fig. 6a-g. According to the in silico results, vaccine injection resulted in several immune responses, including the production of IgM and IgG, the levels of B-cell and Th-cell populations, the concentration of cytokines, and the generation of Ab titers, particularly IgM + IgG. Simultaneously, a significant quantity of the IgG1 antibody was also generated, while no detectable levels of IgG2 or IgG1 + IgG2 were detected (Fig. 6a). This decrease in antigen levels was caused by the overall increase in the counts of B cells and T cells (Fig. 6b). Moreover, there was a noteworthy increase in the population of T lymphocytes (Fig. 6c), total number of Th cells, and total number of memory Th cells (Fig. 6d), as did the total number of B cells. Furthermore, an increase in the population of active TCs per state was also observed (Fig. 6e). Moreover, the TC cell population per state (cells per mm3) was remarkably high, indicating heightened responsiveness to the in silico-developed multivalent vaccine candidate (Fig. 6f). On the other hand, the simulation plot of cytokines revealed significantly elevated levels of IFN-γ and a substantial increase in the production of IL-2, TGFβ, and IL-10. The production of IL-12 was relatively low (Fig. 6g), indicating the ability of the candidate vaccine to generate a conspicuous and suitable immune response in computational system. Hence, the final vaccine construct effectively triggered robust anti-HIV-1 immunity, which ultimately resulted in subsequent clearance of the antigen from the system.

Fig. 6 The immune simulation results obtained from C-IMMSIM after administering the vaccine construct were as follows: (a) The vaccine construct and immunocomplex trigger the production of various types of immunoglobulins. (b) Noticeable increase in the population of B cells, (c) significantly elevated population of active Th cells per state, (d) increased population of total Th cells, (d) increased population of active T cytotoxic lymphocytes per state, (f) elevated in the T cytotoxic (TC) cell population, and (g) elevated concentrations of cytokines and ILs. The inset plot shows the presence of a danger signal and the production of a substantial amount of the leukocyte growth factor IL-2

In silico cloning of the vaccine candidates

The CAI and GC content of the optimized cDNA from humans and the K12 strain of E. coli were 0.91 and 59.86% and 0.93 and 59.86%, respectively, indicating the efficient expression of cDNA sequences in humans and E. coli. These optimized sequences (Additional Table 21) were inserted under the CMV promoter in the pAdTrack-CMV vector and pET28(a) plasmid through SnapGene software. To construct the pAdTrack-CMV vector containing the HIV vaccine sequence, the restriction site of BglII was inserted at the 5’ end of the vaccine sequence, which was subsequently inserted with the Kozak sequence. TAA, as the stop codon, was added at the 3’ end of the optimized codon, which was followed by the restriction site of EcoRV (Fig. 7B). To prepare pET28(a) containing the sequence of the HIV vaccine construct, we added the Xho1 and BamH1 restriction sites to the C and N termini of the optimized sequences of the vaccine model, respectively (Fig. 7A).

Fig. 7 In silico cloning of the A) pET28 (a) plasmid and B) pAdTrack-CMV vector

Discussion

With the increasing occurrence of re-emerging and newly infectious diseases, medical researchers are continuously searching for effective and less expensive methods to treat infectious diseases. [98–102]. For example, vaccination is a method that protects people from contracting illness, leading to overall well-being and improved health [103, 104]. In recent years, multiepitope vaccines that can induce precise and robust immune responses have been proposed for many antigenic proteins [39, 105].

Invaluable research is revealing novel techniques to develop therapeutics against various human pathogens by utilizing bioinformatics methods. For instance, emerging pathogens such as henipavirus [106], monkeypox [107], and SARS-CoV-2 [108], as well as drug-resistant zoonotic pathogens such as Proteus penneri (P. penneri) [109] and Brucella melitensis [110], for which specific vaccines are lacking or in need of enhancement, have been identified. This new paradigm of vaccine design promises shorter lead times, the preselection of peptide antivirals to prevent allergenic reactions, stability against mutational changes, and community-specific vaccine development.

In the case of HIV, multiepitope vaccines, particularly in the case of HIV, are limited by their ability to trigger an immune system against a few genotypes. For example, in a study conducted by Pandey et al., the designed vaccine elicited immunity only against HIV subtypes C and B [25].

The inefficacy of HIV vaccines is related to their inability to induce helper T-cell and cellular responses even in trials of the in silico vaccine EP HIV-1090 [13], their inability to produce vaccines against rapidly mutating HIV infection [25], their inability to produce broadly neutralizing antibodies, as suggested in three multiepitope vaccine trials in BALB/c mice [111], or their failure to activate the desired innate immune response and induce appropriate cytokines. To the best of our knowledge, only one invaluable report has described the design of an in silico vaccine against the whole HIV genome. In that report, the research group retrieved several HIV gene sequences from LANL regardless of prioritizing any HIV subtypes or CRFs. They performed several significant analyses and reported that both vaccine models were promising, but the vaccine construct with an adjuvant demonstrated better docking results and stability than those without an adjuvant [72]. Moreover, the epitopes were chosen from the conserved region of each protein or CRF. Upon investigating the full sequences of various HIV subtypes and CRFs, these identified epitopes were determined to be representative of the genetic diversity of HIV-1. As a result, the identified epitopes in the suggested vaccine model are highly conserved and can be representative across the HIV-1 genetic landscape, which can be effective for all HIV subtypes as well as CRFs to a significant extent.

The current in silico research designed distinctive vaccine models since the final epitopes are located in conserved domains of HIV genes that confer both cellular and humoral immune responses in mice and humans. Moreover, they targeted all the main HIV subtypes and CRFs, and the efficacy, stability, and toxicity of the vaccines were determined by different servers and tools.

HIV-1 is known for its high genetic diversity; hence, the protein sequences of the strains of HIV can differ significantly. Therefore, the various HIV ORFs and proteins from the main subtypes and CRFs can improve the immunogenicity of the vaccine construct [112]. The HIV polyproteins and proteins that were analyzed in this report are essential for virus production and the detrimental effects of HIV infection in humans [113]; accordingly, such important proteins and polyproteins should be targeted in a vaccine model to completely suppress HIV infection [114]. Additionally, the final epitopes were selected from the conserved domains of all the proteins to improve the efficiency of the vaccine construct. The incorporation of highly conserved epitopes may elicit stronger and broader immune coverage against the main subtypes [115]. The epitopes included in the in silico study produce neutralizing antibodies against all HIV genes and induce appropriate IFN-ɣ and innate immune responses through interactions with TLR-3, TLR-4, and TLR-9.

B-cell epitopes play crucial roles in the development of an immune response that can resist viral infections. These epitopes have unique characteristics that enable B cells to identify and activate immune responses to a particular viral infection [116]. Linear BCL epitopes were produced and screened using multiple methods and filters, and this vaccine model has the potential to induce an effective immune response against HIV infection in computational systems.

One of the critical steps in triggering the immune response and developing memory cells against diseases is the presentation of antigens to CTLs through MHC-I/HLAI. The MHC-I/HLAI epitopes must possess substantial immunogenicity to activate CD8 + T lymphocytes. CTL cells are the main component of the MHC-I-mediated immune response and identify and kill damaged, virus-infected, or cancerous cells through the epitope presented by the MHC-I/HLAI molecule on the cell surface [117]. Since CTLs target various HIV proteins, all the proteins were screened to determine the immunogenic CD8 + T-cell epitopes. The HLA-I and HLA-II binding prediction tool generates a percentile rank as an affinity indicator for epitope-allele complexes. An indicator of percentile rank ≤ 1 (IC50 values < 50 nM) is considered a high-affinity peptide sequence, while intermediate-affinity peptide sequences show a percentile rank ≤ 10 (IC50 values < 500 nM) [118]. Significantly, peptides with a percentile rank of 10 or higher did not bind effectively [119]. Here, we set the base value of the percentile rank at 10 and 2 to evaluate epitope binding to all HLA class-I and class-II alleles. Additional Tables 3 and 4 show the selected epitopes incorporated in the vaccine construct that bind to both mouse and human alleles.

In this in silico report, potential HTL epitopes that induce IFN-ɣ were screened to trigger strong HTL immune responses through vaccination. A number of factors play a role in the outcome of infectious diseases and create a suitable response to a vaccine. These parameters can act at the virologic level, the physiology of the host, or at the molecular level [103, 120–125]. HTLs are also important key immune cells that acquire Th1 or Th2 phenotypes and stimulate immune responses, which activate macrophages, natural killer cells, and CD8 + T cells [29, 126, 127]. Furthermore, HTLs induce potent humoral and cellular responses by promoting the optimal expansion of CD8 + T cells and effective maintenance of CD8 + T cells [128]; hence, a clinical trial proposed that the CD4 + T-cell population is a potential vaccine candidate for eliciting robust immune responses against HIV infection [129]. Using advanced computational biology, the identification of the MHC-T cells that most strongly interact with the HLA complex is possible.

In the present study, distinctive filters were employed to screen all the primary epitopes. The ToxinPred server was used to check the toxicity of the peptide; from our data, the vaccine construct and final epitopes were safe and nontoxic. The other filter was VaxiJen v2.0, which indicates the ability of an antigen to induce an immune response to epitopes that are higher than the threshold of antigens in nature [31]. The antigenicity of the finalized epitopes and vaccine construct sequence were suitable for both in vivo and in vitro studies. The other factor that was assessed by filtration was immunogenicity, which refers to the ability of antigens to produce an immune response without binding to T cells. Therefore, both immunogenic and antigenic features are necessary for the efficacy of a vaccine [115]. Other characteristics of both the epitopes and the vaccine models that were estimated were nonallergenicity. Foreign antigenic substances trigger an immune response that leads to an allergenic reaction; therefore, safe human vaccines should be nonallergic [130]. Another quality that was screened was the presence of transmembrane helices and signal peptides in the epitopes according to the DeepTMHMM server. Those epitopes that consisted of either a transmembrane helix or signal peptide were excluded from the qualified epitope [131]. Interestingly, some of the epitopes chosen (PAEPVPL and IRLRPGG) in our research were found to be similar to those identified in previous studies, both in vivo and in vitro, which demonstrated effective inhibition of the virus [132, 133].

Population coverage analysis of the CTL and HTL epitopes demonstrated a coverage rate of 95.04% within the global population when considering both MHC Classes I and II (class combined). These findings suggest that our subunit vaccine, which consists of 20 epitopes, can provide coverage across a vast portion of the human population. According to our findings, the coverage in terms of geographical region was also exceptionally high, ranging from 94.79 to 99.96% for the vast majority of regions when the epitope set was considered, except for the Central American region, which presented a coverage rate of approximately 54%. The presence of outlier populations can be attributed to the limited knowledge regarding experimentally identified epitopes of HLA class I and II alleles, as well as the absence of detailed HLA typing in the allele frequencies of the populations included in the Allele Frequency Net Database. This discrepancy arises because the IEDB calculates population coverage based on HLA alleles that are typed to four digits, such as HLA A*01:01 [134].

Following the acquisition of all necessary criteria, 31 epitopes were joined together with different linkers. The application of the EAAAK linker in the vaccine construct guarantees the in vivo separation of epitopes in the natural environment [57, 135]. In addition, the adjuvant was joined to the multiepitope vaccine by the EAAAK linker to reduce the chance of interaction among functional domains [136]. A GGGS linker was used to separate CTL epitopes from individual CTL epitopes, as was the PADRE sequence. The KK linker joins BCL epitopes to conserve self-governing immunogenic responses [137]. Along with the advantages of a multiepitope subunit vaccine, appropriate adjuvants have been added to the construct to stimulate the immune response and overcome the low immunogenicity of such a vaccine [138–140]. It was revealed that defensin peptides play a crucial role as mucosal adjuvants in mouse models. Furthermore, a synthetic defensin adjuvant was added to the vaccine, resulting in increased cellular immunogenicity of the HIV peptide and a robust proliferative response [141]. The PADRE sequence is an adjuvant that was also used in a vaccine model to increase the stability of the construct and maximize the efficacy and potency of subunit vaccines that lead to better CTL responses [142, 143]. Moreover, the invasin peptide was used in combination with a vaccine construct to enhance the immune response efficiency of human adenovirus-based vaccines [144]. To recognize mRNA via ribosomes for stable expression of vaccine constructs in human cells, the Kozak sequence is recommended to be incorporated upstream of optimized cDNA [145]. Here, the Kozak sequence was also included in the vaccine model to improve the expression of the vaccine protein in human cells. According to the physicochemical parameters of the designed vaccine, these properties were desirable in the vaccine model.

The examination of the Ramachandran plot and various parameters for assessing the quality of the 3D model of the vaccine construct indicated that the refined 3D model of the final HIV vaccine construct was of favorable quality. Moreover, the results of the secondary and tertiary structure analyses revealed the high antigenic potential for the development of vaccines.

The Disulfide by Design 2.0 online tool predicted 53 pairs of amino acid residues with the ability to potentially create a disulfide bond. Indeed, disulfide bonds play a crucial role in stabilizing the geometric conformation of the sequence protein of a vaccine [146].

Molecular docking analysis demonstrated that the HIV-1 vaccine construct had a strong affinity for TLRs (TLR3, TLR4, and TLR9), confirming that the human and mouse immune systems can effectively detect the multiepitope vaccine and trigger constant and strong immune responses in an in silico system. Previous research has indicated that TLRs play an essential role in the initiation of innate immune responses because they possess the ability to identify pathogens and trigger the development of the adaptive immune system [147]. For instance, TLR4 recognizes viral structural proteins and stimulates the production of inflammatory cytokines, whereas TLR3 initiates the activation of dendritic cells mediated by HIV-1 [79]. According to previous reports, TLRs (2, 3, 4, 5, 8, and 9) can be activated by HIV, initiating downstream pathways that trigger the production of proinflammatory cytokines to combat HIV infection [14].

Codon optimization was performed in human and E. coli K12 hosts to improve transcriptional and translational efficiency. We selected the adenovirus and pET28a vectors to express the final vaccine protein in both prokaryotic and eukaryotic systems. Due to the degeneracy of the codons, each amino acid may match up to codons, and the choices of synonymous codon pairs are not the same in various species. In other words, different organisms and species prefer to use one or several specific synonymous codons called optimal codons [148].

MD simulation analysis confirmed the stability of the vaccine-TLR complex under diverse environmental conditions, including alterations in pressure and temperature. The preliminary assessment of the trajectory, including the computation of the RMSD, RMSF, radius of gyration, and hydrogen bonds, all concurred with the exceptional stability exhibited by the vaccine-TLR complexes within a biological environment. Additionally, compared to vaccine-receptor complexes, the TLR4 vaccine construct appears to be more stable when subjected to natural conditions.

Finally, the outcomes of the immune simulation acquired from the CIMMSIM interface revealed a decrease in the persistence of the elevated antigen after five days owing to the exponential production of IgM + IgG and IgM, which diminished over approximately 35 days. Moreover, the vaccine was found to increase the populations of Th cells, memory cells, and IL-2 + cells. Furthermore, we observed an increase in the number of dendritic cells, macrophages, and NK cells during immune stimulation with the designed vaccine. The immune simulation results confirmed that the vaccine effectively stimulated both innate and adaptive immune responses in our computational system.

Similar to other reports [29, 45], the main focus of this report was to develop a multivalent epitope-based vaccine to generate memory cells and induce chemokines upon exposure in both humans and mice, which was verified using a molecular simulation method. Consequently, epitopes with the ability to bind to both mouse and human alleles were chosen to induce immunogenicity in both species. Epitope selection from human epitopes does not necessarily result in stimulation of the immune system in mice, and vice versa. The recommended vaccine was tested for thermostability, stability, hydrophilicity, antigenicity, and non-allergenicity by immunoinformatic methods. In conclusion, the proposed vaccine models may be promising vaccine candidates for controlling HIV infection. In addition, 100 genomes are not representative of worldwide infections and thus HIV diversity; moreover, many recombinant forms are lacking, and drawing significant conclusions about HTL and CD8 + epitopes may not be applicable to all circulating subtypes and CRFs. Therefore, the primary steps of the methods included retrieving the HIV full genome, generating the consensus sequences of ORFs and genes and finding the conserved domains, which were subsequently repeated for 2 other sets of 100 HIV whole genomes obtained from two other datasets, NCBI and ENA. The three sets of HIV whole genomes were not redundant across the dataset but had similar subtypes to determine whether the epitopes predicted from the HIV genomes obtained from the LANA were confirmed. There were some variations in the consensus sequences; however, the conserved domains were remarkably similar across the consensus sequences obtained from different databases. The study revealed that a majority of the CD4, CD8, and B-cell epitopes identified for the vaccine contract displayed either complete similarity or minor discrepancies with each other. The challenge in eliminating HIV may not be linked to the variety in the HIV genome but rather to the integration of HIV into the host genome, which results in the persistence of the virus, the clonal expansion of infected cells, and the presence of long-lasting viral reservoirs that hinder eradication efforts.

The limitations of designing vaccines using bioinformatic tools are associated with the accuracy, suitability, and robustness of the bioinformatics software, tools, and online web servers used for each analysis and prediction. The suggested vaccine models need to be experimentally verified in the laboratory to ensure their safety and immunogenicity. Moreover, mRNA vaccines utilize modern technology, and the potential long-term side effects remain uncertain.

Since the onset of the SARS-CoV-2 pandemic, there has been a significant emphasis on utilizing mRNA as a vehicle for providing instructions for the synthesis of target proteins within host cells. A notable benefit of this approach is the ability to easily modify mRNA vaccines to target different diseases by altering the specific coding sequence for various proteins. Consequently, this adaptability makes mRNA vaccines particularly promising for advancing research on HIV vaccines. Future studies should consider the following levels of research: increasing the number of full-length HIV genomes with a balanced representation of subtypes and CRFs, assessing the effectiveness of the vaccine constructs on various strains of the HIV virus, enhancing the development of the proposed vaccine constructs in laboratory settings, and investigating the efficacy of the vaccine through various phases of clinical trials.

Conclusions

The AIDS epidemic caused by HIV has been a global public health problem for more than 40 years, resulting in approximately 40 million deaths. There are two strategies to control this epidemic: treatment, for which many advances have been made, and vaccination, for which there is still no effective vaccine. Therefore, for the first time, vaccine models that may target major HIV subtypes and CRFs were designed using various novel immunoinformatic methods to help control HIV infection. The proposed vaccine constructs contained B and T-cell epitopes, which were characterized by high antigenicity, immunogenicity, nonallergenicity, nontoxicity, conservancy, nonhomology with the human proteome, and good binding affinity with their corresponding HLA alleles and TLR3, 4, and 9, with excellent population coverage. All the selected epitopes were located within conserved domains of two ORFs (Gag and Env) and nine HIV proteins (Pro, IN, RT, Tat, Nef, Rev, Vif, Vpr, and Vpu). The designed vaccine contained qualified epitopes and suitable adjuvants that can activate both humoral and cell-mediated immunity against HIV-1, which was confirmed by the immune stimulation method. The high expression rate of the vaccine models in human cells and E. coli bacteria was confirmed by performing codon optimization. The vaccine constructs showed good binding affinity for the immune receptors TLR3, TLR4, and TLR9. Finally, vaccine models are proposed as potential targets for in vitro and in vivo investigations of HIV infection.

Electronic supplementary material

Below is the link to the electronic supplementary material.

Supplementary Material 1

Supplementary Material 2

Supplementary Material 3

Supplementary Material 4

Supplementary Material 5

Supplementary Material 6

Supplementary Material 7

Supplementary Material 8

Acknowledgements

The authors would like to thank Shiraz University of Medical Sciences, Shiraz, Iran, and the Center for Development of Clinical Research of Nemazee Hospital and Dr. Nasrin Shokrpour for editorial assistance. The authors would like to thank Dr. Behzad Dehghani, Dr. Peyman Bemani, and Dr. Azra Kenarkouhi for their invaluable consultation in data analysis.

Author contributions

Conceptualization, AH., NKH., SHF.; methodology, FGH., NKH., SHA., MN.; software, YGH., NKH., AH.; validation, SHF., NKH., and SHA.; formal analysis, MN.; FGH. YGH.; Investigation; FGH., SHF., NKH.; resources, AH.; data curation, FGH.; writing—original draft preparation, AH.; SHA., NKH., writing—review, and editing; SHF.; visualization, NKH.; supervision, AH., SHF.; project administration, AH.; funding acquisition, AH.

Funding

This research was funded by Shiraz University of Medical Sciences, Shiraz, Iran (grant number 29468).

Data availability

This study’s data generated and analyzed has been incorporated into this submitted article.

Declarations

Ethics approval and consent to participate

Not applicable.

Consent for publication

Not applicable.

Competing interests

The authors declare no competing interests.

Publisher’s note

Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Change history

9/20/2024

A Correction to this paper has been published: 10.1186/s12879-024-09951-4
==== Refs
References

1. Hashempour A Moayedi J Musavi Z Ghasabi F Halaji M Hasanshahi Z Nazarinia MA First report of HHV-8 viral load and seroprevalence of major blood-borne viruses in Iranian patients with systemic sclerosis Multiple Scler Relat Disorders 2021 51 102872 10.1016/j.msard.2021.102872
Hashempour A, Moayedi J, Musavi Z, Ghasabi F, Halaji M, Hasanshahi Z, Nazarinia MA. First report of HHV-8 viral load and seroprevalence of major blood-borne viruses in Iranian patients with systemic sclerosis. Multiple Scler Relat Disorders. 2021;51:102872.
2. Hashempour T Bamdad T Bergamini A Lavergne JP Haj-Sheykholeslami A Brakier-Gingras L Ajorloo M Merat S F protein increases CD4 + CD25 + T cell population in patients with chronic hepatitis C Pathogens Disease 2015 73 4 ftv022 10.1093/femspd/ftv022 25862675
Hashempour T, Bamdad T, Bergamini A, Lavergne JP, Haj-Sheykholeslami A, Brakier-Gingras L, Ajorloo M, Merat S. F protein increases CD4 + CD25 + T cell population in patients with chronic hepatitis C. Pathogens Disease. 2015;73(4):ftv022.25862675
3. Halaji M, Hashempour T, Moayedi J, Pouladfar GR, Khansarinejad B, Khashei R, Moattari A, Musavi Z, Ghassabi F, Pirbonyeh N. Viral etiology of acute respiratory infections in children in Southern Iran. Rev Soc Bras Med Trop 2019, 52.
4. Hashempoor T, Alborzi AM, Moayedi J, Ajorloo M, Bamdad T, Sharifi AH, Lavergne JP, Haj-sheykholeslami A, Merat S. A decline in anti-core + 1 antibody titer occurs in successful treatment of patients infected with hepatitis C virus. Jundishapur J Microbiol 2018, 11(2).
5. Dehghani B Hashempour T Hasanshahi Z Interaction of human herpesvirus 8 viral interleukin-6 with human interleukin-6 receptor using in silico approach: the potential role in HHV-8 pathogenesis Curr Proteomics 2020 17 2 107 16 10.2174/1570164616666190626151949
Dehghani B, Hashempour T, Hasanshahi Z. Interaction of human herpesvirus 8 viral interleukin-6 with human interleukin-6 receptor using in silico approach: the potential role in HHV-8 pathogenesis. Curr Proteomics. 2020;17(2):107–16.
6. Dehghani B Hashempour T Hasanshahi Z Moayedi J Bioinformatics analysis of domain 1 of HCV-core protein: Iran Int J Pept Res Ther 2020 26 303 20 10.1007/s10989-019-09838-y 32435167
Dehghani B, Hashempour T, Hasanshahi Z, Moayedi J. Bioinformatics analysis of domain 1 of HCV-core protein: Iran. Int J Pept Res Ther. 2020;26:303–20.32435167
7. Ghassabi F Hashempour T Moghadami M Davarpanah M Kalani M Chatrabnous N Halaji M Shahraki H Hadi N Bacterial etiology and antibiotic resistance pattern of septicemia in HIV and non-HIV patients admitted to tertiary care hospitals, Shiraz, South of Iran Cell Mol Biol 2017 63 9 115 21 10.14715/cmb/2017.63.9.20 28980931
Ghassabi F, Hashempour T, Moghadami M, Davarpanah M, Kalani M, Chatrabnous N, Halaji M, Shahraki H, Hadi N. Bacterial etiology and antibiotic resistance pattern of septicemia in HIV and non-HIV patients admitted to tertiary care hospitals, Shiraz, South of Iran. Cell Mol Biol. 2017;63(9):115–21.28980931
8. Jewell BL Mudimu E Stover J Ten Brink D Phillips AN Smith JA Martin-Hughes R Teng Y Glaubius R Mahiane SG Potential effects of disruption to HIV programmes in sub-saharan Africa caused by COVID-19: results from multiple mathematical models Lancet HIV 2020 7 9 e629 40 10.1016/S2352-3018(20)30211-3 32771089
Jewell BL, Mudimu E, Stover J, Ten Brink D, Phillips AN, Smith JA, Martin-Hughes R, Teng Y, Glaubius R, Mahiane SG. Potential effects of disruption to HIV programmes in sub-saharan Africa caused by COVID-19: results from multiple mathematical models. Lancet HIV. 2020;7(9):e629–40.32771089
9. Martinez-Steele E Awasana AA Corrah T Sabally S van der Sande M Jaye A Togun T Sarge-Njie R McConkey SJ Whittle H Is HIV-2-induced AIDS different from HIV-1-associated AIDS? Data from a west African clinic Aids 2007 21 3 317 24 10.1097/QAD.0b013e328011d7ab 17255738
Martinez-Steele E, Awasana AA, Corrah T, Sabally S, van der Sande M, Jaye A, Togun T, Sarge-Njie R, McConkey SJ, Whittle H. Is HIV-2-induced AIDS different from HIV-1-associated AIDS? Data from a west African clinic. Aids. 2007;21(3):317–24.17255738
10. Organization WH Policy brief: update of recommendations on first-and second-line antiretroviral regimens 2019 In World Health Organization
Organization WH. Policy brief: update of recommendations on first-and second-line antiretroviral regimens. In.: World Health Organization; 2019.
11. Burton DR Advancing an HIV vaccine; advancing vaccinology Nat Rev Immunol 2019 19 2 77 8 10.1038/s41577-018-0103-6 30560910
Burton DR. Advancing an HIV vaccine; advancing vaccinology. Nat Rev Immunol. 2019;19(2):77–8.30560910
12. Tough DF Deciphering the relationship between central and effector memory CD8 + T cells Trends Immunol 2003 24 8 404 7 10.1016/S1471-4906(03)00169-8 12909449
Tough DF. Deciphering the relationship between central and effector memory CD8 + T cells. Trends Immunol. 2003;24(8):404–7.12909449
13. Gorse GJ Baden LR Wecker M Newman MJ Ferrari G Weinhold KJ Livingston BD Villafana TL Li H Noonan E Safety and immunogenicity of cytotoxic T-lymphocyte poly-epitope, DNA plasmid (EP HIV-1090) vaccine in healthy, human immunodeficiency virus type 1 (HIV-1)-uninfected adults Vaccine 2008 26 2 215 23 10.1016/j.vaccine.2007.10.061 18055072
Gorse GJ, Baden LR, Wecker M, Newman MJ, Ferrari G, Weinhold KJ, Livingston BD, Villafana TL, Li H, Noonan E. Safety and immunogenicity of cytotoxic T-lymphocyte poly-epitope, DNA plasmid (EP HIV-1090) vaccine in healthy, human immunodeficiency virus type 1 (HIV-1)-uninfected adults. Vaccine. 2008;26(2):215–23.18055072
14. Akbari E Kardani K Namvar A Ajdary S Ardakani EM Khalaj V Bolhassani A In silico design and in vitro expression of novel multiepitope DNA constructs based on HIV-1 proteins and Hsp70 T-cell epitopes Biotechnol Lett 2021 43 8 1513 50 10.1007/s10529-021-03143-9 33987776
Akbari E, Kardani K, Namvar A, Ajdary S, Ardakani EM, Khalaj V, Bolhassani A. In silico design and in vitro expression of novel multiepitope DNA constructs based on HIV-1 proteins and Hsp70 T-cell epitopes. Biotechnol Lett. 2021;43(8):1513–50.33987776
15. Pavlakis GN Felber BK A new step towards an HIV/AIDS vaccine Lancet 2018 392 10143 192 4 10.1016/S0140-6736(18)31548-4 30047374
Pavlakis GN, Felber BK. A new step towards an HIV/AIDS vaccine. Lancet. 2018;392(10143):192–4.30047374
16. Naveed M Ali U Aziz T Rasool MJ Ijaz A Alharbi M Alharbi ME Alshammari A Alasmari AF A reverse vaccinology approach to design an mRNA-based vaccine to provoke a robust immune response against HIV-1 Acta Biochim Pol 2023 70 2 407 18 37329562
Naveed M, Ali U, Aziz T, Rasool MJ, Ijaz A, Alharbi M, Alharbi ME, Alshammari A, Alasmari AF. A reverse vaccinology approach to design an mRNA-based vaccine to provoke a robust immune response against HIV-1. Acta Biochim Pol. 2023;70(2):407–18.37329562
17. Zahroh H, Ma’rup A, Tambunan USF, Parikesit AA. Immunoinformatics approach in designing epitope-based vaccine against meningitis-inducing bacteria (Streptococcus pneumoniae, Neisseria meningitidis, and Haemophilus influenzae type b). Drug target insights 2016, 10:DTI. S38458.
18. Chiarella P Massi E De Robertis M Fazio VM Signori E Recent advances in epitope design for immunotherapy of cancer Recent Pat Anti-cancer Drug Discov 2009 4 3 227 40 10.2174/157489209789206922
Chiarella P, Massi E, De Robertis M, Fazio VM, Signori E. Recent advances in epitope design for immunotherapy of cancer. Recent Pat Anti-cancer Drug Discov. 2009;4(3):227–40.
19. Slingluff CL Jr The present and future of peptide vaccines for cancer: single or multiple, long or short, alone or in combination? Cancer J (Sudbury Mass) 2011 17 5 343 10.1097/PPO.0b013e318233e5b2
Slingluff CL Jr. The present and future of peptide vaccines for cancer: single or multiple, long or short, alone or in combination? Cancer J (Sudbury Mass). 2011;17(5):343.
20. Hashempour T Dehghani B Musavi Z Moayedi J Hasanshahi Z Sarvari J Hosseini SY Hosseini E Moeini M Merat S Impact of IL28 genotypes and modeling the interactions of HCV core protein on treatment of hepatitis C Interdisciplinary Sciences: Comput Life Sci 2020 12 4 424 37
Hashempour T, Dehghani B, Musavi Z, Moayedi J, Hasanshahi Z, Sarvari J, Hosseini SY, Hosseini E, Moeini M, Merat S. Impact of IL28 genotypes and modeling the interactions of HCV core protein on treatment of hepatitis C. Interdisciplinary Sciences: Comput Life Sci. 2020;12(4):424–37.
21. Hashempour T Dehghani B Mousavi Z Akbari T Hasanshahi Z Moayedi J Yahaghi M Davarpanah MA Association of mutations in the NS5A-PKRBD region and IFNL4 genotypes with hepatitis C interferon responsiveness and its functional and structural analysis Curr Proteomics 2021 18 1 38 49 10.2174/18756247MTAz4NTEh0
Hashempour T, Dehghani B, Mousavi Z, Akbari T, Hasanshahi Z, Moayedi J, Yahaghi M, Davarpanah MA. Association of mutations in the NS5A-PKRBD region and IFNL4 genotypes with hepatitis C interferon responsiveness and its functional and structural analysis. Curr Proteomics. 2021;18(1):38–49.
22. Gasteiger E, Hoogland C, Gattiker A, Duvaud Se, Wilkins MR, Appel RD, Bairoch A. Protein identification and analysis tools on the ExPASy server. Springer; 2005.
23. Saha S Raghava GPS AlgPred: prediction of allergenic proteins and mapping of IgE epitopes Nucleic Acids Res 2006 34 suppl2 W202 9 10.1093/nar/gkl343 16844994
Saha S, Raghava GPS. AlgPred: prediction of allergenic proteins and mapping of IgE epitopes. Nucleic Acids Res. 2006;34(suppl2):W202–9.16844994
24. Kharisma VD Ansori ANM Posa GAV Rizky WC Permana S Parikesit AA Conserved B-cell epitope identification of envelope glycoprotein (GP120) HIV-1 to develop multi-strain vaccine candidate through bioinformatics approach Jurnal Teknologi Laboratorium 2021 10 1 06 13 10.29238/teknolabjournal.v10i1.274
Kharisma VD, Ansori ANM, Posa GAV, Rizky WC, Permana S, Parikesit AA. Conserved B-cell epitope identification of envelope glycoprotein (GP120) HIV-1 to develop multi-strain vaccine candidate through bioinformatics approach. Jurnal Teknologi Laboratorium. 2021;10(1):06–13.
25. Pandey RK Ojha R Aathmanathan VS Krishnan M Prajapati VK Immunoinformatics approaches to design a novel multi-epitope subunit vaccine against HIV infection Vaccine 2018 36 17 2262 72 10.1016/j.vaccine.2018.03.042 29571972
Pandey RK, Ojha R, Aathmanathan VS, Krishnan M, Prajapati VK. Immunoinformatics approaches to design a novel multi-epitope subunit vaccine against HIV infection. Vaccine. 2018;36(17):2262–72.29571972
26. Saha S Raghava GPS Prediction of continuous B-cell epitopes in an antigen using recurrent neural network Proteins Struct Funct Bioinform 2006 65 1 40 8 10.1002/prot.21078
Saha S, Raghava GPS. Prediction of continuous B-cell epitopes in an antigen using recurrent neural network. Proteins Struct Funct Bioinform. 2006;65(1):40–8.
27. Larsen JEP Lund O Nielsen M Improved method for predicting linear B-cell epitopes Immunome Res 2006 2 1 1 7 10.1186/1745-7580-2-2 16426456
Larsen JEP, Lund O, Nielsen M. Improved method for predicting linear B-cell epitopes. Immunome Res. 2006;2(1):1–7.16426456
28. Gao J, Kurgan L. Computational prediction of B cell epitopes from antigen sequences. Immunoinformatics 2014:197–215.
29. Khan MT Islam R Jerin TJ Mahmud A Khatun S Kobir A Islam MN Akter A Mondal SI Immunoinformatics and molecular dynamics approaches: next generation vaccine design against West Nile virus PLoS ONE 2021 16 6 e0253393 10.1371/journal.pone.0253393 34138958
Khan MT, Islam R, Jerin TJ, Mahmud A, Khatun S, Kobir A, Islam MN, Akter A, Mondal SI. Immunoinformatics and molecular dynamics approaches: next generation vaccine design against West Nile virus. PLoS ONE. 2021;16(6):e0253393.34138958
30. Musavi Z Hashempour T Moayedi J Dehghani B Ghassabi F Hallaji M Hosseini SY Yaghoubi R Gholami S Dehyadegari MA Antibody development to HCV alternate reading frame protein in liver transplant candidate and its computational analysis Curr Proteomics 2020 17 2 154 70 10.2174/1570164617666190822103329
Musavi Z, Hashempour T, Moayedi J, Dehghani B, Ghassabi F, Hallaji M, Hosseini SY, Yaghoubi R, Gholami S, Dehyadegari MA. Antibody development to HCV alternate reading frame protein in liver transplant candidate and its computational analysis. Curr Proteomics. 2020;17(2):154–70.
31. Doytchinova IA Flower DR VaxiJen: a server for prediction of protective antigens, tumour antigens and subunit vaccines BMC Bioinformatics 2007 8 1 1 7 10.1186/1471-2105-8-4 17199892
Doytchinova IA, Flower DR. VaxiJen: a server for prediction of protective antigens, tumour antigens and subunit vaccines. BMC Bioinformatics. 2007;8(1):1–7.17199892
32. Liang M, Hong W, Shao J. Bioinformatics-based Prediction of Character of Envelope Glycoprotein and Analysis of Epitopes of B-and T-cell of gp120. Asian J Complement Altern Med 2023:27.
33. Dimitrov I, Flower DR, Doytchinova I. AllerTOP-a server for in silico prediction of allergens. In: BMC bioinformatics: 2013: BioMed Central; 2013: 1–9.
34. Bemani P Mohammadi M In silico prediction and evaluation of human parainfluenza Virus-3 CD4 + T cell epitopes Curr Comput-Aided Drug Design 2023 19 3 163 75 10.2174/1573409919666221205122633
Bemani P, Mohammadi M. In silico prediction and evaluation of human parainfluenza Virus-3 CD4 + T cell epitopes. Curr Comput-Aided Drug Design. 2023;19(3):163–75.
35. Gupta S Kapoor P Chaudhary K Gautam A Kumar R Raghava GP Peptide toxicity prediction Comput Peptidology 2015 143 157
Gupta S, Kapoor P, Chaudhary K, Gautam A, Kumar R, Raghava GP. Peptide toxicity prediction. Comput Peptidology. 2015;143:157.
36. Shafaghi M Bahadori Z Madanchi H Ranjbar MM Shabani AA Mousavi SF Immunoinformatics-aided design of a new multi-epitope vaccine adjuvanted with domain 4 of pneumolysin against Streptococcus pneumoniae strains BMC Bioinformatics 2023 24 1 1 27 10.1186/s12859-023-05175-6 36597019
Shafaghi M, Bahadori Z, Madanchi H, Ranjbar MM, Shabani AA, Mousavi SF. Immunoinformatics-aided design of a new multi-epitope vaccine adjuvanted with domain 4 of pneumolysin against Streptococcus pneumoniae strains. BMC Bioinformatics. 2023;24(1):1–27.36597019
37. Käll L Krogh A Sonnhammer EL Advantages of combined transmembrane topology and signal peptide prediction—the Phobius web server Nucleic Acids Res 2007 35 suppl2 W429 32 10.1093/nar/gkm256 17483518
Käll L, Krogh A, Sonnhammer EL. Advantages of combined transmembrane topology and signal peptide prediction—the Phobius web server. Nucleic Acids Res. 2007;35(suppl2):W429–32.17483518
38. Mahmoudvand S Esmaeili Gouvarchin Ghaleh H Jalilian FA Farzanehpour M Dorostkar R Design of a multi-epitope‐based vaccine consisted of immunodominant epitopes of structural proteins of SARS‐CoV‐2 using immunoinformatics approach Biotechnol Appl Chem 2023 70 3 1189 205
Mahmoudvand S, Esmaeili Gouvarchin Ghaleh H, Jalilian FA, Farzanehpour M, Dorostkar R. Design of a multi-epitope‐based vaccine consisted of immunodominant epitopes of structural proteins of SARS‐CoV‐2 using immunoinformatics approach. Biotechnol Appl Chem. 2023;70(3):1189–205.
39. Tan C Zhu F Pan P Wu A Li C Development of multi-epitope vaccines against the monkeypox virus based on envelope proteins using immunoinformatics approaches Front Immunol 2023 14 1112816 10.3389/fimmu.2023.1112816 36993967
Tan C, Zhu F, Pan P, Wu A, Li C. Development of multi-epitope vaccines against the monkeypox virus based on envelope proteins using immunoinformatics approaches. Front Immunol. 2023;14:1112816.36993967
40. Barker WC Garavelli JS Huang H McGarvey PB Orcutt BC Srinivasarao GY Xiao C Yeh L-SL Ledley RS Janda JF The protein information resource (PIR) Nucleic Acids Res 2000 28 1 41 4 10.1093/nar/28.1.41 10592177
Barker WC, Garavelli JS, Huang H, McGarvey PB, Orcutt BC, Srinivasarao GY, Xiao C, Yeh L-SL, Ledley RS, Janda JF. The protein information resource (PIR). Nucleic Acids Res. 2000;28(1):41–4.10592177
41. Reynisson B Barra C Kaabinejadian S Hildebrand WH Peters B Nielsen M Improved prediction of MHC II antigen presentation through integration and motif deconvolution of mass spectrometry MHC eluted ligand data J Proteome Res 2020 19 6 2304 15 10.1021/acs.jproteome.9b00874 32308001
Reynisson B, Barra C, Kaabinejadian S, Hildebrand WH, Peters B, Nielsen M. Improved prediction of MHC II antigen presentation through integration and motif deconvolution of mass spectrometry MHC eluted ligand data. J Proteome Res. 2020;19(6):2304–15.32308001
42. Wang P Sidney J Dow C Mothé B Sette A Peters B A systematic assessment of MHC class II peptide binding predictions and evaluation of a consensus approach PLoS Comput Biol 2008 4 4 e1000048 10.1371/journal.pcbi.1000048 18389056
Wang P, Sidney J, Dow C, Mothé B, Sette A, Peters B. A systematic assessment of MHC class II peptide binding predictions and evaluation of a consensus approach. PLoS Comput Biol. 2008;4(4):e1000048.18389056
43. Dehghani B Hashempour T Hasanshahi Z Using immunoinformatics and structural approaches to design a novel HHV8 vaccine Int J Pept Res Ther 2020 26 321 31 10.1007/s10989-019-09839-x
Dehghani B, Hashempour T, Hasanshahi Z. Using immunoinformatics and structural approaches to design a novel HHV8 vaccine. Int J Pept Res Ther. 2020;26:321–31.
44. Bui H-H Sidney J Peters B Sathiamurthy M Sinichi A Purton K-A Mothé BR Chisari FV Watkins DI Sette A Automated generation and evaluation of specific MHC binding predictive tools: ARB matrix applications Immunogenetics 2005 57 304 14 10.1007/s00251-005-0798-y 15868141
Bui H-H, Sidney J, Peters B, Sathiamurthy M, Sinichi A, Purton K-A, Mothé BR, Chisari FV, Watkins DI, Sette A. Automated generation and evaluation of specific MHC binding predictive tools: ARB matrix applications. Immunogenetics. 2005;57:304–14.15868141
45. Khan MT Islam MJ Parihar A Islam R Jerin TJ Dhote R Ali MA Laura FK Halim MA Immunoinformatics and molecular modeling approach to design universal multi-epitope vaccine for SARS-CoV-2 Inf Med Unlocked 2021 24 100578 10.1016/j.imu.2021.100578
Khan MT, Islam MJ, Parihar A, Islam R, Jerin TJ, Dhote R, Ali MA, Laura FK, Halim MA. Immunoinformatics and molecular modeling approach to design universal multi-epitope vaccine for SARS-CoV-2. Inf Med Unlocked. 2021;24:100578.
46. Larsen MV Lundegaard C Lamberth K Buus S Lund O Nielsen M Large-scale validation of methods for cytotoxic T-lymphocyte epitope prediction BMC Bioinformatics 2007 8 1 12 10.1186/1471-2105-8-424 17199892
Larsen MV, Lundegaard C, Lamberth K, Buus S, Lund O, Nielsen M. Large-scale validation of methods for cytotoxic T-lymphocyte epitope prediction. BMC Bioinformatics. 2007;8:1–12.17199892
47. Nielsen M Lundegaard C Worning P Lauemøller SL Lamberth K Buus S Brunak S Lund O Reliable prediction of T-cell epitopes using neural networks with novel sequence representations Protein Sci 2003 12 5 1007 17 10.1110/ps.0239403 12717023
Nielsen M, Lundegaard C, Worning P, Lauemøller SL, Lamberth K, Buus S, Brunak S, Lund O. Reliable prediction of T-cell epitopes using neural networks with novel sequence representations. Protein Sci. 2003;12(5):1007–17.12717023
48. Hoque H, Islam R, Ghosh S, Rahaman MM, Jewel NA, Miah MA. Implementation of in silico methods to predict common epitopes for vaccine development against Chikungunya and Mayaro viruses. Heliyon 2021, 7(3).
49. Trolle T McMurtrey CP Sidney J Bardet W Osborn SC Kaever T Sette A Hildebrand WH Nielsen M Peters B The length distribution of class I–restricted T cell epitopes is determined by both peptide supply and MHC allele–specific binding preference J Immunol 2016 196 4 1480 7 10.4049/jimmunol.1501721 26783342
Trolle T, McMurtrey CP, Sidney J, Bardet W, Osborn SC, Kaever T, Sette A, Hildebrand WH, Nielsen M, Peters B. The length distribution of class I–restricted T cell epitopes is determined by both peptide supply and MHC allele–specific binding preference. J Immunol. 2016;196(4):1480–7.26783342
50. Bui H-H Sidney J Dinh K Southwood S Newman MJ Sette A Predicting population coverage of T-cell epitope-based diagnostics and vaccines BMC Bioinformatics 2006 7 1 1 5 10.1186/1471-2105-7-153 16393334
Bui H-H, Sidney J, Dinh K, Southwood S, Newman MJ, Sette A. Predicting population coverage of T-cell epitope-based diagnostics and vaccines. BMC Bioinformatics. 2006;7(1):1–5.16393334
51. Liang C Bencurova E Psota E Neurgaonkar P Prelog M Scheller C Dandekar T Population-predicted MHC class II Epitope presentation of SARS-CoV-2 structural proteins correlates to the case fatality rates of COVID-19 in different countries Int J Mol Sci 2021 22 5 2630 10.3390/ijms22052630 33807854
Liang C, Bencurova E, Psota E, Neurgaonkar P, Prelog M, Scheller C, Dandekar T. Population-predicted MHC class II Epitope presentation of SARS-CoV-2 structural proteins correlates to the case fatality rates of COVID-19 in different countries. Int J Mol Sci. 2021;22(5):2630.33807854
52. Islam MSB Miah M Hossain ME Kibria KK A conserved multi-epitope-based vaccine designed by targeting hemagglutinin protein of highly pathogenic avian H5 influenza viruses 3 Biotech 2020 10 1 16 10.1007/s13205-020-02544-3 35822774
Islam MSB, Miah M, Hossain ME, Kibria KK. A conserved multi-epitope-based vaccine designed by targeting hemagglutinin protein of highly pathogenic avian H5 influenza viruses. 3 Biotech. 2020;10:1–16.35822774
53. Rahmani A Baee M Rostamtabar M Karkhah A Alizadeh S Tourani M Nouri HR Development of a conserved chimeric vaccine based on helper T-cell and CTL epitopes for induction of strong immune response against Schistosoma mansoni using immunoinformatics approaches Int J Biol Macromol 2019 141 125 36 10.1016/j.ijbiomac.2019.08.259 31479669
Rahmani A, Baee M, Rostamtabar M, Karkhah A, Alizadeh S, Tourani M, Nouri HR. Development of a conserved chimeric vaccine based on helper T-cell and CTL epitopes for induction of strong immune response against Schistosoma mansoni using immunoinformatics approaches. Int J Biol Macromol. 2019;141:125–36.31479669
54. Manalu RT Setyaningsih EP Peptide based Hepatitis C Vaccine Design from RNA-dependent RNA polymerase (RdRp) NS5B: Immunoinformatics Approach J Res Pharm Sci 2023 9 3 31 9
Manalu RT, Setyaningsih EP. Peptide based Hepatitis C Vaccine Design from RNA-dependent RNA polymerase (RdRp) NS5B: Immunoinformatics Approach. J Res Pharm Sci. 2023;9(3):31–9.
55. Ahmed N Rabaan AA Alwashmi AS Albayat H Mashraqi MM Alshehri AA Garout M Abduljabbar WA Yusof NY Yean CY Immunoinformatic execution and design of an Anti-epstein–Barr Virus Vaccine with multiple epitopes triggering Innate and Adaptive Immune responses Microorganisms 2023 11 10 2448 10.3390/microorganisms11102448 37894106
Ahmed N, Rabaan AA, Alwashmi AS, Albayat H, Mashraqi MM, Alshehri AA, Garout M, Abduljabbar WA, Yusof NY, Yean CY. Immunoinformatic execution and design of an Anti-epstein–Barr Virus Vaccine with multiple epitopes triggering Innate and Adaptive Immune responses. Microorganisms. 2023;11(10):2448.37894106
56. Chen X Zaro JL Shen W-C Fusion protein linkers: property, design and functionality Adv Drug Deliv Rev 2013 65 10 1357 69 10.1016/j.addr.2012.09.039 23026637
Chen X, Zaro JL, Shen W-C. Fusion protein linkers: property, design and functionality. Adv Drug Deliv Rev. 2013;65(10):1357–69.23026637
57. Pandey RK Sundar S Prajapati VK Differential expression of miRNA regulates T cell differentiation and plasticity during visceral leishmaniasis infection Front Microbiol 2016 7 206 10.3389/fmicb.2016.00206 26941729
Pandey RK, Sundar S, Prajapati VK. Differential expression of miRNA regulates T cell differentiation and plasticity during visceral leishmaniasis infection. Front Microbiol. 2016;7:206.26941729
58. Dehghani B Hasanshahi Z Hashempour T Motamedifar M The possible regions to design human papilloma viruses vaccine in Iranian L1 protein Biologia 2020 75 749 59 10.2478/s11756-019-00386-w 32435064
Dehghani B, Hasanshahi Z, Hashempour T, Motamedifar M. The possible regions to design human papilloma viruses vaccine in Iranian L1 protein. Biologia. 2020;75:749–59.32435064
59. Niwa T Ying B-W Saito K Jin W Takada S Ueda T Taguchi H Bimodal protein solubility distribution revealed by an aggregation analysis of the entire ensemble of Escherichia coli proteins Proc Natl Acad Sci 2009 106 11 4201 6 10.1073/pnas.0811922106 19251648
Niwa T, Ying B-W, Saito K, Jin W, Takada S, Ueda T, Taguchi H. Bimodal protein solubility distribution revealed by an aggregation analysis of the entire ensemble of Escherichia coli proteins. Proc Natl Acad Sci. 2009;106(11):4201–6.19251648
60. Jafari D Malih S Gomari MM Safari M Jafari R Farajollahi MM Designing a chimeric subunit vaccine for influenza virus, based on HA2, M2e and CTxB: a bioinformatics study BMC Mol Cell Biology 2020 21 1 13 10.1186/s12860-020-00334-6
Jafari D, Malih S, Gomari MM, Safari M, Jafari R, Farajollahi MM. Designing a chimeric subunit vaccine for influenza virus, based on HA2, M2e and CTxB: a bioinformatics study. BMC Mol Cell Biology. 2020;21:1–13.
61. Hashempour T Dehghani B Mousavi Z Yahaghi M Hasanshahi Z Moayedi J Akbari T Davarpanah MA Evaluating drug resistant mutations to HCV NS3 protease inhibitors in Iranian Naïve patients Int J Pept Res Ther 2020 26 1699 710 10.1007/s10989-019-09957-6
Hashempour T, Dehghani B, Mousavi Z, Yahaghi M, Hasanshahi Z, Moayedi J, Akbari T, Davarpanah MA. Evaluating drug resistant mutations to HCV NS3 protease inhibitors in Iranian Naïve patients. Int J Pept Res Ther. 2020;26:1699–710.
62. Geourjon C Deleage G SOPMA: significant improvements in protein secondary structure prediction by consensus prediction from multiple alignments Bioinformatics 1995 11 6 681 4 10.1093/bioinformatics/11.6.681
Geourjon C, Deleage G. SOPMA: significant improvements in protein secondary structure prediction by consensus prediction from multiple alignments. Bioinformatics. 1995;11(6):681–4.
63. Denman RB Using RNAFOLD to predict the activity of small catalytic RNAs Biotechniques 1993 15 6 1090 5 8292343
Denman RB. Using RNAFOLD to predict the activity of small catalytic RNAs. Biotechniques. 1993;15(6):1090–5.8292343
64. Hasanshahi Z Hashempour A Ghasabi F Moayedi J Musavi Z Dehghani B Sharafi H Joulaei H First report on molecular docking analysis and drug resistance substitutions to approved HCV NS5A and NS5B inhibitors amongst Iranian patients BMC Gastroenterol 2021 21 1 1 14 10.1186/s12876-021-01988-y 33407176
Hasanshahi Z, Hashempour A, Ghasabi F, Moayedi J, Musavi Z, Dehghani B, Sharafi H, Joulaei H. First report on molecular docking analysis and drug resistance substitutions to approved HCV NS5A and NS5B inhibitors amongst Iranian patients. BMC Gastroenterol. 2021;21(1):1–14.33407176
65. Zhang Y I-TASSER server for protein 3D structure prediction BMC Bioinformatics 2008 9 1 8 10.1186/1471-2105-9-40 18173834
Zhang Y. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics. 2008;9:1–8.18173834
66. Ghasabi F Hashempour A Khodadad N Bemani S Keshani P Shekiba MJ Hasanshahi Z First report of computational protein–ligand docking to evaluate susceptibility to HIV integrase inhibitors in HIV-infected Iranian patients Biochem Biophys Rep 2022 30 101254 35368742
Ghasabi F, Hashempour A, Khodadad N, Bemani S, Keshani P, Shekiba MJ, Hasanshahi Z. First report of computational protein–ligand docking to evaluate susceptibility to HIV integrase inhibitors in HIV-infected Iranian patients. Biochem Biophys Rep. 2022;30:101254.35368742
67. Ko J Park H Heo L Seok C GalaxyWEB server for protein structure prediction and refinement Nucleic Acids Res 2012 40 W1 W294 7 10.1093/nar/gks493 22649060
Ko J, Park H, Heo L, Seok C. GalaxyWEB server for protein structure prediction and refinement. Nucleic Acids Res. 2012;40(W1):W294–7.22649060
68. Colovos C Yeates TO Verification of protein structures: patterns of nonbonded atomic interactions Protein Sci 1993 2 9 1511 9 10.1002/pro.5560020916 8401235
Colovos C, Yeates TO. Verification of protein structures: patterns of nonbonded atomic interactions. Protein Sci. 1993;2(9):1511–9.8401235
69. Wiederstein M Sippl MJ ProSA-web: interactive web service for the recognition of errors in three-dimensional structures of proteins Nucleic Acids Res 2007 35 suppl2 W407 10 10.1093/nar/gkm290 17517781
Wiederstein M, Sippl MJ. ProSA-web: interactive web service for the recognition of errors in three-dimensional structures of proteins. Nucleic Acids Res. 2007;35(suppl2):W407–10.17517781
70. Dehghani B Hasanshahi Z Hashempour T HIV capsid and protease, new targets of melittin Int J Pept Res Ther 2020 26 2057 65 10.1007/s10989-019-10002-9
Dehghani B, Hasanshahi Z, Hashempour T. HIV capsid and protease, new targets of melittin. Int J Pept Res Ther. 2020;26:2057–65.
71. Lovell SC Davis IW De Arendall PI III Word JM Prisant MG Richardson JS Richardson DC Structure validation by Cα geometry: ϕ, ψ and Cβ deviation Proteins Struct Funct Bioinform 2003 50 3 437 50 10.1002/prot.10286
Lovell SC, Davis IW, De Arendall PI III, Word JM, Prisant MG, Richardson JS, Richardson DC. Structure validation by Cα geometry: ϕ, ψ and Cβ deviation. Proteins Struct Funct Bioinform. 2003;50(3):437–50.
72. Sher H Sharif H Zaheer T Khan SA Ali A Javed H Javed A Employing computational tools to design a multi-epitope vaccine targeting human immunodeficiency virus-1 (HIV-1) BMC Genomics 2023 24 1 1 22 10.1186/s12864-023-09330-4 36593441
Sher H, Sharif H, Zaheer T, Khan SA, Ali A, Javed H, Javed A. Employing computational tools to design a multi-epitope vaccine targeting human immunodeficiency virus-1 (HIV-1). BMC Genomics. 2023;24(1):1–22.36593441
73. Dey J, Mahapatra SR, Singh PK, Prabhuswamimath SC, Misra N, Suar M. Designing of multi-epitope peptide vaccine against Acinetobacter baumannii through combined immunoinformatics and protein interaction–based approaches. Immunol Res 2023:1–24.
74. Craig DB Dombkowski AA Disulfide by Design 2.0: a web-based tool for disulfide engineering in proteins BMC Bioinformatics 2013 14 1 1 7 10.1186/1471-2105-14-S19-S1 23323762
Craig DB, Dombkowski AA. Disulfide by Design 2.0: a web-based tool for disulfide engineering in proteins. BMC Bioinformatics. 2013;14(1):1–7.23323762
75. Srivastava K Srivastava V Prediction of Conformational and Linear B-Cell epitopes on Envelop protein of Zika Virus using Immunoinformatics Approach Int J Pept Res Ther 2023 29 1 17 10.1007/s10989-022-10486-y 36683612
Srivastava K, Srivastava V. Prediction of Conformational and Linear B-Cell epitopes on Envelop protein of Zika Virus using Immunoinformatics Approach. Int J Pept Res Ther. 2023;29(1):17.36683612
76. Ponomarenko J Bui H-H Li W Fusseder N Bourne PE Sette A Peters B ElliPro: a new structure-based tool for the prediction of antibody epitopes BMC Bioinformatics 2008 9 1 8 10.1186/1471-2105-9-514 18173834
Ponomarenko J, Bui H-H, Li W, Fusseder N, Bourne PE, Sette A, Peters B. ElliPro: a new structure-based tool for the prediction of antibody epitopes. BMC Bioinformatics. 2008;9:1–8.18173834
77. Trott O Olson AJ AutoDock Vina: improving the speed and accuracy of docking with a new scoring function, efficient optimization, and multithreading J Comput Chem 2010 31 2 455 61 10.1002/jcc.21334 19499576
Trott O, Olson AJ. AutoDock Vina: improving the speed and accuracy of docking with a new scoring function, efficient optimization, and multithreading. J Comput Chem. 2010;31(2):455–61.19499576
78. Pommier Y Johnson AA Marchand C Integrase inhibitors to treat HIV/AIDS Nat Rev Drug Discovery 2005 4 3 236 48 10.1038/nrd1660 15729361
Pommier Y, Johnson AA, Marchand C. Integrase inhibitors to treat HIV/AIDS. Nat Rev Drug Discovery. 2005;4(3):236–48.15729361
79. Abdulla F Adhikari UK Uddin MK Exploring T B-cell epitopes and designing multi-epitope subunit vaccine targeting integration step of HIV-1 lifecycle using immunoinformatics approach Microb Pathog 2019 137 103791 10.1016/j.micpath.2019.103791 31606417
Abdulla F, Adhikari UK, Uddin MK, Exploring T. B-cell epitopes and designing multi-epitope subunit vaccine targeting integration step of HIV-1 lifecycle using immunoinformatics approach. Microb Pathog. 2019;137:103791.31606417
80. Tatematsu M Nishikawa F Seya T Matsumoto M Toll-like receptor 3 recognizes incomplete stem structures in single-stranded viral RNA Nat Commun 2013 4 1 1833 10.1038/ncomms2857 23673618
Tatematsu M, Nishikawa F, Seya T, Matsumoto M. Toll-like receptor 3 recognizes incomplete stem structures in single-stranded viral RNA. Nat Commun. 2013;4(1):1833.23673618
81. Dela Justina V Giachini FR Priviero F Webb RC Double-stranded RNA and toll-like receptor activation: a novel mechanism for blood pressure regulation Clin Sci 2020 134 2 303 13 10.1042/CS20190913
Dela Justina V, Giachini FR, Priviero F, Webb RC. Double-stranded RNA and toll-like receptor activation: a novel mechanism for blood pressure regulation. Clin Sci. 2020;134(2):303–13.
82. Rafi MO Al-Khafaji K Sarker MT Taskin-Tok T Rana AS Rahman MS Design of a multi-epitope vaccine against SARS-CoV-2: immunoinformatic and computational methods RSC Adv 2022 12 7 4288 310 10.1039/D1RA06532G 35425433
Rafi MO, Al-Khafaji K, Sarker MT, Taskin-Tok T, Rana AS, Rahman MS. Design of a multi-epitope vaccine against SARS-CoV-2: immunoinformatic and computational methods. RSC Adv. 2022;12(7):4288–310.35425433
83. Sartorius R Trovato M Manco R D’Apice L De Berardinis P Exploiting viral sensing mediated by toll-like receptors to design innovative vaccines npj Vaccines 2021 6 1 127 10.1038/s41541-021-00391-8 34711839
Sartorius R, Trovato M, Manco R, D’Apice L, De Berardinis P. Exploiting viral sensing mediated by toll-like receptors to design innovative vaccines. npj Vaccines. 2021;6(1):127.34711839
84. Sameer AS, Nissar S. Toll-like receptors (TLRs): structure, functions, signaling, and role of their polymorphisms in colorectal cancer susceptibility. BioMed Research International 2021, 2021.
85. Farias MVN Lendez PA Marin M Quintana S Martínez-Cuesta L Ceriani MC Dolcini GL Toll-like receptors, IFN-γ and IL-12 expression in bovine leukemia virus-infected animals with low or high proviral load Res Vet Sci 2016 107 190 5 10.1016/j.rvsc.2016.06.016 27473994
Farias MVN, Lendez PA, Marin M, Quintana S, Martínez-Cuesta L, Ceriani MC, Dolcini GL. Toll-like receptors, IFN-γ and IL-12 expression in bovine leukemia virus-infected animals with low or high proviral load. Res Vet Sci. 2016;107:190–5.27473994
86. Tariq MH Bhatti R Ali NF Ashfaq UA Shahid F Almatroudi A Khurshid M Rational design of chimeric multiepitope based vaccine (MEBV) against human T-cell lymphotropic virus type 1: an integrated vaccine informatics and molecular docking based approach PLoS ONE 2021 16 10 e0258443 10.1371/journal.pone.0258443 34705829
Tariq MH, Bhatti R, Ali NF, Ashfaq UA, Shahid F, Almatroudi A, Khurshid M. Rational design of chimeric multiepitope based vaccine (MEBV) against human T-cell lymphotropic virus type 1: an integrated vaccine informatics and molecular docking based approach. PLoS ONE. 2021;16(10):e0258443.34705829
87. Adhikari UK, Tayebi M, Rahman MM. Immunoinformatics approach for epitope-based peptide vaccine design and active site prediction against polyprotein of emerging oropouche virus. Journal of immunology research 2018, 2018.
88. Samad A Meghla NS Nain Z Karpiński TM Rahman MS Immune epitopes identification and designing of a multi-epitope vaccine against bovine leukemia virus: a molecular dynamics and immune simulation approaches Cancer Immunol Immunother 2022 71 10 2535 48 10.1007/s00262-022-03181-w 35294591
Samad A, Meghla NS, Nain Z, Karpiński TM, Rahman MS. Immune epitopes identification and designing of a multi-epitope vaccine against bovine leukemia virus: a molecular dynamics and immune simulation approaches. Cancer Immunol Immunother. 2022;71(10):2535–48.35294591
89. Kozakov D Beglov D Bohnuud T Mottarella SE Xia B Hall DR Vajda S How good is automated protein docking? Proteins Struct Funct Bioinform 2013 81 12 2159 66 10.1002/prot.24403
Kozakov D, Beglov D, Bohnuud T, Mottarella SE, Xia B, Hall DR, Vajda S. How good is automated protein docking? Proteins Struct Funct Bioinform. 2013;81(12):2159–66.
90. Weatherhead JE Miller VE Garcia MN Hasbun R Salazar L Dimachkie MM Murray KO Long-term neurological outcomes in West Nile virus–infected patients: an observational study Am J Trop Med Hyg 2015 92 5 1006 10.4269/ajtmh.14-0616 25802426
Weatherhead JE, Miller VE, Garcia MN, Hasbun R, Salazar L, Dimachkie MM, Murray KO. Long-term neurological outcomes in West Nile virus–infected patients: an observational study. Am J Trop Med Hyg. 2015;92(5):1006.25802426
91. Bekker H, Berendsen H, Dijkstra E, Achterop S, Vondrumen Rv, Vanderspoel D, Sijbers A, Keegstra H, Renardus M. Gromacs-a parallel computer for molecular-dynamics simulations. In: 4th international conference on computational physics (PC 92): 1993: World Scientific Publishing; 1993: 252–256.
92. Rapin N Lund O Bernaschi M Castiglione F Computational immunology meets bioinformatics: the use of prediction tools for molecular binding in the simulation of the immune system PLoS ONE 2010 5 4 e9862 10.1371/journal.pone.0009862 20419125
Rapin N, Lund O, Bernaschi M, Castiglione F. Computational immunology meets bioinformatics: the use of prediction tools for molecular binding in the simulation of the immune system. PLoS ONE. 2010;5(4):e9862.20419125
93. Sana M Javed A Jamal SB Junaid M Faheem M Development of multivalent vaccine targeting M segment of Crimean Congo Hemorrhagic Fever Virus (CCHFV) using immunoinformatic approaches Saudi J Biol Sci 2022 29 4 2372 88 10.1016/j.sjbs.2021.12.004 35531180
Sana M, Javed A, Jamal SB, Junaid M, Faheem M. Development of multivalent vaccine targeting M segment of Crimean Congo Hemorrhagic Fever Virus (CCHFV) using immunoinformatic approaches. Saudi J Biol Sci. 2022;29(4):2372–88.35531180
94. Narayanan S Koppaka L Edala N Loritz D Daley R Adaptive interface for personalizing information seeking CyberPsychology Behav 2004 7 6 683 8 10.1089/cpb.2004.7.683
Narayanan S, Koppaka L, Edala N, Loritz D, Daley R. Adaptive interface for personalizing information seeking. CyberPsychology Behav. 2004;7(6):683–8.
95. Korf I Gene finding in novel genomes BMC Bioinformatics 2004 5 1 1 9 10.1186/1471-2105-5-59 14706121
Korf I. Gene finding in novel genomes. BMC Bioinformatics. 2004;5(1):1–9.14706121
96. Bach RD. General and theoretical aspects of the peroxide group. PATAI’S Chem Funct Groups 2009.
97. Elalouf A Kedarya T Elalouf H Rosenfeld A Computational design and evaluation of mRNA-and protein-based conjugate vaccines for influenza A and SARS-CoV-2 viruses J Genetic Eng Biotechnol 2023 21 1 120 10.1186/s43141-023-00574-x
Elalouf A, Kedarya T, Elalouf H, Rosenfeld A. Computational design and evaluation of mRNA-and protein-based conjugate vaccines for influenza A and SARS-CoV-2 viruses. J Genetic Eng Biotechnol. 2023;21(1):120.
98. Falahi S Sayyadi H Abdoli A Kenarkoohi A Mohammadi S The prevalence of human bocavirus in < 2-year-old children with acute bronchiolitis New Microbes New Infections 2020 37 100736 10.1016/j.nmni.2020.100736 32983545
Falahi S, Sayyadi H, Abdoli A, Kenarkoohi A, Mohammadi S. The prevalence of human bocavirus in < 2-year-old children with acute bronchiolitis. New Microbes New Infections. 2020;37:100736.32983545
99. Mirrnejad R Fallahi S Kiani J Jeddi F Khoobdel M Jonaidi N Alaeddini F Epidemic assessment of bacterial agents in osteomyelitis and their antibiotic resistance pattern determination J Biol Sci 2008 8 2 478 81 10.3923/jbs.2008.478.481
Mirrnejad R, Fallahi S, Kiani J, Jeddi F, Khoobdel M, Jonaidi N, Alaeddini F. Epidemic assessment of bacterial agents in osteomyelitis and their antibiotic resistance pattern determination. J Biol Sci. 2008;8(2):478–81.
100. Ravanshad M, Sabahi F, Falahi S, KENAR KA, AMINI BOS, Hosseini SY, RIAHI MH, Khanizade S. Prediction of hepatitis B virus lamivudine resistance based on YMDD sequence data using an artificial neural network model. 2011.
101. Kenarkoohi A Soleimani M Bamdad T Soleimanjahi H Estiri H Razavi-Nikoo MH Efficient lentiviral transduction of adipose tissue-derived mouse mesenchymal stem cells and assessment of their penetration in female mice cervical tumor model Iran J cancer Prev 2014 7 4 225 25628843
Kenarkoohi A, Soleimani M, Bamdad T, Soleimanjahi H, Estiri H, Razavi-Nikoo MH. Efficient lentiviral transduction of adipose tissue-derived mouse mesenchymal stem cells and assessment of their penetration in female mice cervical tumor model. Iran J cancer Prev. 2014;7(4):225.25628843
102. Kenarkoohi A Bamdad T Soleimani M Soleimanjahi H Fallah A Falahi S HSV-TK expressing mesenchymal stem cells exert inhibitory effect on cervical cancer model Int J Mol Cell Med 2020 9 2 146 32934952
Kenarkoohi A, Bamdad T, Soleimani M, Soleimanjahi H, Fallah A, Falahi S. HSV-TK expressing mesenchymal stem cells exert inhibitory effect on cervical cancer model. Int J Mol Cell Med. 2020;9(2):146.32934952
103. Hashempour Ava KN, Ziaei Reza R, Behzad G, Farzaneh F, Shahab K, Azra. Nejabat Maryam, Davarpanah Mohammad Ali Predictors of Antiretroviral Treatment failure to the First Line Therapy: a cross-sectional study among Iranian HIV-positive adults 2023.
104. Dehghani B Hashempour T Musavi Z Hasanshahi Z Moayedi J Merat S Assessment of New E2 protein Domain Interaction with PKR protein to Control IFN Signaling Curr Proteomics 2021 18 4 536 48 10.2174/1570164617999201006194657
Dehghani B, Hashempour T, Musavi Z, Hasanshahi Z, Moayedi J, Merat S. Assessment of New E2 protein Domain Interaction with PKR protein to Control IFN Signaling. Curr Proteomics. 2021;18(4):536–48.
105. Vartak A Sucheck SJ Recent advances in subunit vaccine carriers Vaccines 2016 4 2 12 10.3390/vaccines4020012 27104575
Vartak A, Sucheck SJ. Recent advances in subunit vaccine carriers. Vaccines. 2016;4(2):12.27104575
106. Ahmad S, Nazarian S, Alizadeh A, Pashapour Hajialilou M, Tahmasebian S, Alharbi M, Alasmari AF, Shojaeian A, Ghatrehsamani M, Irfan M. Computational design of a multi-epitope vaccine candidate against Langya henipavirus using surface proteins. J Biomol Struct Dynamics 2023:1–18.
107. Sanami S Nazarian S Ahmad S Raeisi E Tahir ul Qamar M Tahmasebian S Pazoki-Toroudi H Fazeli M Ghatreh Samani M In silico design and immunoinformatics analysis of a universal multi-epitope vaccine against monkeypox virus PLoS ONE 2023 18 5 e0286224 10.1371/journal.pone.0286224 37220125
Sanami S, Nazarian S, Ahmad S, Raeisi E, Tahir ul Qamar M, Tahmasebian S, Pazoki-Toroudi H, Fazeli M, Ghatreh Samani M. In silico design and immunoinformatics analysis of a universal multi-epitope vaccine against monkeypox virus. PLoS ONE. 2023;18(5):e0286224.37220125
108. Farhani I Yamchi A Madanchi H Khazaei V Behrouzikhah M Abbasi H Salehi M Moradi N Sanami S Designing a multi-epitope vaccine against the SARS-CoV-2 variant based on an Immunoinformatics Approach Curr Comput-Aided Drug Design 2024 20 3 274 90 10.2174/1573409919666230612125440
Farhani I, Yamchi A, Madanchi H, Khazaei V, Behrouzikhah M, Abbasi H, Salehi M, Moradi N, Sanami S. Designing a multi-epitope vaccine against the SARS-CoV-2 variant based on an Immunoinformatics Approach. Curr Comput-Aided Drug Design. 2024;20(3):274–90.
109. Malik M Khan S Ullah A Hassan M Haq Mu, Ahmad S Al-Harbi AI Sanami S Abideen SA Irfan M Proteome-wide screening of potential vaccine targets against brucella melitensis Vaccines 2023 11 2 263 10.3390/vaccines11020263 36851141
Malik M, Khan S, Ullah A, Hassan M, Haq Mu, Ahmad S, Al-Harbi AI, Sanami S, Abideen SA, Irfan M. Proteome-wide screening of potential vaccine targets against brucella melitensis. Vaccines. 2023;11(2):263.36851141
110. Ullah A, Rehman B, Khan S, Almanaa TN, Waheed Y, Hassan M, Naz T, ul Haq M, Muhammad R, Sanami S. An in Silico multi-epitopes Vaccine Ensemble and characterization against nosocomial Proteus penneri. Mol Biotechnol 2023:1–16.
111. Yang Y Sun W Guo J Zhao G Sun S Yu H Guo Y Li J Jin X Du L In silico design of a DNA-based HIV-1 multi-epitope vaccine for Chinese populations Hum Vaccines Immunotherapeutics 2015 11 3 795 805 10.1080/21645515.2015.1012017
Yang Y, Sun W, Guo J, Zhao G, Sun S, Yu H, Guo Y, Li J, Jin X, Du L. In silico design of a DNA-based HIV-1 multi-epitope vaccine for Chinese populations. Hum Vaccines Immunotherapeutics. 2015;11(3):795–805.
112. McBurney SP Ross TM Viral sequence diversity: challenges for AIDS vaccine designs Expert Rev Vaccines 2008 7 9 1405 17 10.1586/14760584.7.9.1405 18980542
McBurney SP, Ross TM. Viral sequence diversity: challenges for AIDS vaccine designs. Expert Rev Vaccines. 2008;7(9):1405–17.18980542
113. McElrath MJ Haynes BF Induction of immunity to human immunodeficiency virus type-1 by vaccination Immunity 2010 33 4 542 54 10.1016/j.immuni.2010.09.011 21029964
McElrath MJ, Haynes BF. Induction of immunity to human immunodeficiency virus type-1 by vaccination. Immunity. 2010;33(4):542–54.21029964
114. Freed EO HIV-1 replication Somat Cell Mol Genet 2001 26 13 33 10.1023/A:1021070512287 12465460
Freed EO. HIV-1 replication. Somat Cell Mol Genet. 2001;26:13–33.12465460
115. Bui H-H Sidney J Li W Fusseder N Sette A Development of an epitope conservancy analysis tool to facilitate the design of epitope-based diagnostics and vaccines BMC Bioinformatics 2007 8 1 6 10.1186/1471-2105-8-361 17199892
Bui H-H, Sidney J, Li W, Fusseder N, Sette A. Development of an epitope conservancy analysis tool to facilitate the design of epitope-based diagnostics and vaccines. BMC Bioinformatics. 2007;8:1–6.17199892
116. Bhattacharya K Shamkh IM Khan MS Lotfy MM Nzeyimana JB Abutayeh RF Hamdy NM Hamza D Chanu NR Khanal P Multi-epitope vaccine design against monkeypox virus via reverse vaccinology method exploiting immunoinformatic and bioinformatic approaches Vaccines 2022 10 12 2010 10.3390/vaccines10122010 36560421
Bhattacharya K, Shamkh IM, Khan MS, Lotfy MM, Nzeyimana JB, Abutayeh RF, Hamdy NM, Hamza D, Chanu NR, Khanal P. Multi-epitope vaccine design against monkeypox virus via reverse vaccinology method exploiting immunoinformatic and bioinformatic approaches. Vaccines. 2022;10(12):2010.36560421
117. Kakakhel S Ahmad A Mahdi WA Alshehri S Aiman S Begum S Shams S Kamal M Imran M Shakeel F Annotation of potential vaccine targets and Designing of mRNA-Based Multi-epitope Vaccine against Lumpy skin Disease Virus via Reverse Vaccinology and Agent-based modeling Bioengineering 2023 10 4 430 10.3390/bioengineering10040430 37106617
Kakakhel S, Ahmad A, Mahdi WA, Alshehri S, Aiman S, Begum S, Shams S, Kamal M, Imran M, Shakeel F. Annotation of potential vaccine targets and Designing of mRNA-Based Multi-epitope Vaccine against Lumpy skin Disease Virus via Reverse Vaccinology and Agent-based modeling. Bioengineering. 2023;10(4):430.37106617
118. Mobini S Chizari M Mafakher L Rismani E Rismani E Computational design of a novel VLP-based vaccine for hepatitis B virus Front Immunol 2020 11 548897 10.3389/fimmu.2020.02074
Mobini S, Chizari M, Mafakher L, Rismani E, Rismani E. Computational design of a novel VLP-based vaccine for hepatitis B virus. Front Immunol. 2020;11:548897.
119. Koşaloğlu-Yalçın Z Lanka M Frentzen A Logandha Ramamoorthy Premlal A Sidney J Vaughan K Greenbaum J Robbins P Gartner J Sette A Predicting T cell recognition of MHC class I restricted neoepitopes Oncoimmunology 2018 7 11 e1492508 10.1080/2162402X.2018.1492508 30377561
Koşaloğlu-Yalçın Z, Lanka M, Frentzen A, Logandha Ramamoorthy Premlal A, Sidney J, Vaughan K, Greenbaum J, Robbins P, Gartner J, Sette A. Predicting T cell recognition of MHC class I restricted neoepitopes. Oncoimmunology. 2018;7(11):e1492508.30377561
120. Falahi S Kenarkoohi A Host factors and vaccine efficacy: implications for COVID-19 vaccines J Med Virol 2022 94 4 1330 5 10.1002/jmv.27485 34845730
Falahi S, Kenarkoohi A. Host factors and vaccine efficacy: implications for COVID-19 vaccines. J Med Virol. 2022;94(4):1330–5.34845730
121. Rayatdoost E Rahmanian M Sanie MS Rahmanian J Matin S Kalani N Kenarkoohi A Falahi S Abdoli A Focus: vaccines: sufficient sleep, Time of Vaccination, and Vaccine Efficacy: a systematic review of the current evidence and a proposal for COVID-19 vaccination Yale J Biol Med 2022 95 2 221 35782481
Rayatdoost E, Rahmanian M, Sanie MS, Rahmanian J, Matin S, Kalani N, Kenarkoohi A, Falahi S, Abdoli A. Focus: vaccines: sufficient sleep, Time of Vaccination, and Vaccine Efficacy: a systematic review of the current evidence and a proposal for COVID-19 vaccination. Yale J Biol Med. 2022;95(2):221.35782481
122. Ahmadi I, Estabraghnia Babaki H, Maleki M, Jarineshin H, Kaffashian MR, Hassaniazad M, Kenarkoohi A, Ghanbarnejad A, Falahi S, Kazemi Jahromi M. Changes in Physiological Levels of Cortisol and Adrenocorticotropic Hormone upon Hospitalization Can Predict SARS-CoV-2 Mortality: A Cohort Study. International Journal of Endocrinology 2022, 2022.
123. Falahi S Mohamadi J Sayyadi H Pakzad I Rashidi A Naserifar R Abdi J Kenarkoohi A COVID-19 vaccination, peltzman effect and possible increase in highrisk behaviors: a growing concern related to risk compensation and reduced compliance to public health protective measures after vaccines rollout Infect Disorders-Drug Targets (Formerly Curr Drug Targets-Infectious Disorders) 2022 22 8 8 12
Falahi S, Mohamadi J, Sayyadi H, Pakzad I, Rashidi A, Naserifar R, Abdi J, Kenarkoohi A. COVID-19 vaccination, peltzman effect and possible increase in highrisk behaviors: a growing concern related to risk compensation and reduced compliance to public health protective measures after vaccines rollout. Infect Disorders-Drug Targets (Formerly Curr Drug Targets-Infectious Disorders). 2022;22(8):8–12.
124. Falahi S Sayyadi H Kenarkoohi A Immunogenicity of COVID-19 mRNA vaccines in hemodialysis patients: systematic review and meta‐analysis Health Sci Rep 2022 5 6 e874 10.1002/hsr2.874 36210877
Falahi S, Sayyadi H, Kenarkoohi A. Immunogenicity of COVID-19 mRNA vaccines in hemodialysis patients: systematic review and meta‐analysis. Health Sci Rep. 2022;5(6):e874.36210877
125. Vastani ZF, Ahmadi A, Abounoori M, Ardeshiri MR, Masoumi E, Ahmadi I, Davodian A, Kaffashian M, Kenarkoohi A, Falahi S. Interleukin-29 profiles in COVID‐19 patients: Survival is associated with IL‐29 levels. Health Sci Rep 2022, 5(2).
126. Mosmann T Coffman R TH1 and TH2 cells: different patterns of lymphokine secretion lead to different functional properties Annu Rev Immunol 1989 7 1 145 73 10.1146/annurev.iy.07.040189.001045 2523712
Mosmann T, Coffman R. TH1 and TH2 cells: different patterns of lymphokine secretion lead to different functional properties. Annu Rev Immunol. 1989;7(1):145–73.2523712
127. Reinherz EL, Schlossman SF. The differentiation and function of human T lymphocytes. 1980.
128. Venet A, Gomard E, Levy J-P. Human T cell responses to HIV. Viruses Cell Immune Response 1993:165–200.
129. Oyarzún P Kobe B Recombinant and epitope-based vaccines on the road to the market and implications for vaccine design and production Hum Vaccines Immunotherapeutics 2016 12 3 763 7 10.1080/21645515.2015.1094595
Oyarzún P, Kobe B. Recombinant and epitope-based vaccines on the road to the market and implications for vaccine design and production. Hum Vaccines Immunotherapeutics. 2016;12(3):763–7.
130. Pandey RK Bhatt TK Prajapati VK Novel immunoinformatics approaches to design multi-epitope subunit vaccine for malaria by investigating anopheles salivary protein Sci Rep 2018 8 1 1125 10.1038/s41598-018-19456-1 29348555
Pandey RK, Bhatt TK, Prajapati VK. Novel immunoinformatics approaches to design multi-epitope subunit vaccine for malaria by investigating anopheles salivary protein. Sci Rep. 2018;8(1):1125.29348555
131. Zeba A, Sekar K, Ganjiwale A. M protein from Dengue virus oligomerizes to pentameric channel protein: in silico analysis study. Genomics Inf 2023, 21(3).
132. Akbari E, Ajdari S, Mirabzadeh Ardakani E, Agi E, Khalaj V, Bolhassani AJJMM, Diseases I. Expression of a Novel HIV-1 Gag-Pol-Env-Nef-Rev Multi-epitope Construct in Escherichia coli. 2021, 9(2):62–70.
133. Lubong Sabado R, Kavanagh DG, Kaufmann DE, Fru K, Babcock E, Rosenberg E, Walker B, Lifson J, Bhardwaj N. Larsson MJPo: in vitro priming recapitulates in vivo HIV-1 specific t cell responses, revealing rapid loss of virus reactive CD4 + T cells in acute HIV-1 infection. 2009, 4(1):e4256.
134. Daniel M Liang B Luo M Assessment of the population coverage of an HIV-1 vaccine targeting sequences surrounding the viral protease cleavage sites in Gag, Pol, or all 12 protease cleavage sites Vaccine 2021 39 19 2676 83 10.1016/j.vaccine.2021.03.068 33863573
Daniel M, Liang B, Luo M. Assessment of the population coverage of an HIV-1 vaccine targeting sequences surrounding the viral protease cleavage sites in Gag, Pol, or all 12 protease cleavage sites. Vaccine. 2021;39(19):2676–83.33863573
135. Hajighahramani N Nezafat N Eslami M Negahdaripour M Rahmatabadi SS Ghasemi Y Immunoinformatics analysis and in silico designing of a novel multi-epitope peptide vaccine against Staphylococcus aureus Infect Genet Evol 2017 48 83 94 10.1016/j.meegid.2016.12.010 27989662
Hajighahramani N, Nezafat N, Eslami M, Negahdaripour M, Rahmatabadi SS, Ghasemi Y. Immunoinformatics analysis and in silico designing of a novel multi-epitope peptide vaccine against Staphylococcus aureus. Infect Genet Evol. 2017;48:83–94.27989662
136. Arai R Ueda H Kitayama A Kamiya N Nagamune T Design of the linkers which effectively separate domains of a bifunctional fusion protein Protein Eng 2001 14 8 529 32 10.1093/protein/14.8.529 11579220
Arai R, Ueda H, Kitayama A, Kamiya N, Nagamune T. Design of the linkers which effectively separate domains of a bifunctional fusion protein. Protein Eng. 2001;14(8):529–32.11579220
137. Ashgar SS, Faidah H, Bantun F, Jalal NA, Qusty NF, Darwish A, Haque S, Janahi EM. Integrated immunoinformatics and subtractive proteomics approach for multi-epitope vaccine designing to combat S. pneumoniae TIGR4. Front Mol Biosci 2023, 10.
138. De Groot AS, Moise L, McMurry JA, Martin W. Epitope-based immunome-derived vaccines: a strategy for improved design and safety. Clin Appl Immunomics 2009:39–69.
139. Farhadi T Ovchinnikov RS Ranjbar MM In silico designing of some agonists of toll-like receptor 5 as a novel vaccine adjuvant candidates Netw Model Anal Health Inf Bioinf 2016 5 1 10
Farhadi T, Ovchinnikov RS, Ranjbar MM. In silico designing of some agonists of toll-like receptor 5 as a novel vaccine adjuvant candidates. Netw Model Anal Health Inf Bioinf. 2016;5:1–10.
140. Liu X Wetzler LM Massari P The PorB porin from commensal Neisseria lactamica induces Th1 and Th2 immune responses to ovalbumin in mice and is a potential immune adjuvant Vaccine 2008 26 6 786 96 10.1016/j.vaccine.2007.11.080 18191311
Liu X, Wetzler LM, Massari P. The PorB porin from commensal Neisseria lactamica induces Th1 and Th2 immune responses to ovalbumin in mice and is a potential immune adjuvant. Vaccine. 2008;26(6):786–96.18191311
141. Ella KM Mohan VK Coronavirus vaccine: light at the end of the tunnel Indian Pediatr 2020 57 407 10 10.1007/s13312-020-1812-z 32291382
Ella KM, Mohan VK. Coronavirus vaccine: light at the end of the tunnel. Indian Pediatr. 2020;57:407–10.32291382
142. Ghaffari-Nazari H Tavakkol-Afshari J Jaafari MR Tahaghoghi-Hajghorbani S Masoumi E Jalali SA Improving multi-epitope long peptide vaccine potency by using a strategy that enhances CD4 + T help in BALB/c mice PLoS ONE 2015 10 11 e0142563 10.1371/journal.pone.0142563 26556756
Ghaffari-Nazari H, Tavakkol-Afshari J, Jaafari MR, Tahaghoghi-Hajghorbani S, Masoumi E, Jalali SA. Improving multi-epitope long peptide vaccine potency by using a strategy that enhances CD4 + T help in BALB/c mice. PLoS ONE. 2015;10(11):e0142563.26556756
143. Wu C-Y Monie A Pang X Hung C-F Wu T Improving therapeutic HPV peptide-based vaccine potency by enhancing CD4 + T help and dendritic cell activation J Biomed Sci 2010 17 1 1 10 10.1186/1423-0127-17-S1-S1 20055990
Wu C-Y, Monie A, Pang X, Hung C-F, Wu T. Improving therapeutic HPV peptide-based vaccine potency by enhancing CD4 + T help and dendritic cell activation. J Biomed Sci. 2010;17(1):1–10.20055990
144. Li H Ning P Lin Z Liang W Kang K He L Zhang Y Co-expression of the C-terminal domain of Yersinia enterocolitica invasin enhances the efficacy of classical swine-fever-vectored vaccine based on human adenovirus J Biosci 2015 40 79 90 10.1007/s12038-014-9495-z 25740144
Li H, Ning P, Lin Z, Liang W, Kang K, He L, Zhang Y. Co-expression of the C-terminal domain of Yersinia enterocolitica invasin enhances the efficacy of classical swine-fever-vectored vaccine based on human adenovirus. J Biosci. 2015;40:79–90.25740144
145. Ólafsdóttir G Svansson V Ingvarsson S Marti E Torsteinsdóttir S In vitro analysis of expression vectors for DNA vaccination of horses: the effect of a kozak sequence Acta Vet Scand 2008 50 1 1 7 10.1186/1751-0147-50-44 18171479
Ólafsdóttir G, Svansson V, Ingvarsson S, Marti E, Torsteinsdóttir S. In vitro analysis of expression vectors for DNA vaccination of horses: the effect of a kozak sequence. Acta Vet Scand. 2008;50(1):1–7.18171479
146. Khoo K, Norton RS. Role of disulfide bonds in peptide and protein conformation. Amino acids, peptides and proteins in organic chemistry: analysis and function of amino acids and peptides. edn.: Wiley-VCH Verlag GmbH & Co. KGaA; 2011. pp. 395–417.
147. Martinsen JT Gunst JD Højen JF Tolstrup M Søgaard OS The use of toll-like receptor agonists in HIV-1 cure strategies Front Immunol 2020 11 1112 10.3389/fimmu.2020.01112 32595636
Martinsen JT, Gunst JD, Højen JF, Tolstrup M, Søgaard OS. The use of toll-like receptor agonists in HIV-1 cure strategies. Front Immunol. 2020;11:1112.32595636
148. Fu H Liang Y Zhong X Pan Z Huang L Zhang H Xu Y Zhou W Liu Z Codon optimization with deep learning to enhance protein expression Sci Rep 2020 10 1 17617 10.1038/s41598-020-74091-z 33077783
Fu H, Liang Y, Zhong X, Pan Z, Huang L, Zhang H, Xu Y, Zhou W, Liu Z. Codon optimization with deep learning to enhance protein expression. Sci Rep. 2020;10(1):17617.33077783
