
==== Front
J Nanobiotechnology
J Nanobiotechnology
Journal of Nanobiotechnology
1477-3155
BioMed Central London

2746
10.1186/s12951-024-02746-4
Review
Non-viral approaches in CAR-NK cell engineering: connecting natural killer cell biology and gene delivery
McErlean Emma M. e.mcerlean@qub.ac.uk

1
McCarthy Helen O. 123
1 https://ror.org/00hswnk62 grid.4777.3 0000 0004 0374 7521 School of Pharmacy, Queen’s University of Belfast, 97 Lisburn Road, Belfast, BT9 7BL UK
2 https://ror.org/04a1a1e81 grid.15596.3e 0000 0001 0238 0260 School of Chemical Sciences, Dublin City University, Collins Avenue, Dublin 9, Ireland
3 https://ror.org/04a1a1e81 grid.15596.3e 0000 0001 0238 0260 Biodesign Europe, Dublin City University, Dublin 9, Ireland
10 9 2024
10 9 2024
2024
22 55218 12 2023
2 8 2024
© The Author(s) 2024
2024
https://creativecommons.org/licenses/by/4.0/ Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
Natural Killer (NK) cells are exciting candidates for cancer immunotherapy with potent innate cytotoxicity and distinct advantages over T cells for Chimeric Antigen Receptor (CAR) therapy. Concerns regarding the safety, cost, and scalability of viral vectors has ignited research into non-viral alternatives for gene delivery. This review comprehensively analyses recent advancements and challenges with non-viral genetic modification of NK cells for allogeneic CAR-NK therapies. Non-viral alternatives including electroporation and multifunctional nanoparticles are interrogated with respect to CAR expression and translational responses. Crucially, the link between NK cell biology and design of drug delivery technologies are made, which is essential for development of future non-viral approaches. This review provides valuable insights into the current state of non-viral CAR-NK cell engineering, aimed at realising the full potential of NK cell-based immunotherapies.

Graphical Abstract

Non-viral production of “off-the-shelf” CAR-NK cells. 1. NK cells may be purified from donor blood, differentiated from stem cells or produced from immortalised cell lines in the lab. 2. NK-specific CAR design modified from CAR-T designs to include NK transmembrane domains (NKG2D, NKp44), co-stimulatory receptors (e.g., DAP10, 2B4) and NK cell receptors (NKG2D). 3. Non-viral genetic modification of NK cells can include delivery of CAR construct via DNA or mRNA, and knock-in/out of specific genes using gene editing tools (e.g., CRISPR Cas9, transposons). This requires a gene delivery method which may include electroporation, lipid and multifunctional nanoparticles and cell penetrating peptides. The resultant CAR-NK cells are then expanded in vitro and may be delivered as an "off-the-shelf" product to treat multiple patients.

Keywords

Cancer immunotherapy
Cell therapies
Non-viral gene delivery
Nanoparticles
Drug delivery technologies
Natural killer cells
NK-specific CAR design
CAR-NK engineering
issue-copyright-statement© BioMed Central Ltd., part of Springer Nature 2024
==== Body
pmcIntroduction to CAR Therapies

Chimeric antigen receptor (CAR) therapy is a type of adoptive cell therapy where T cells, dendritic cells, macrophages, or natural killer (NK) cells are genetically engineered to recognise and eliminate cancer cells [1, 2]. CAR-T therapy is the most well established and involves modifying a patient's own T cells ex vivo to express a CAR that recognises a tumour associated antigen (TAA) on the surface of cancer cells, such as CD19 which is expressed on many B-cell lymphoma and leukaemia. The CAR-T cells are then expanded and reinfused back into the patient to target and kill tumour cells expressing the specific TAA antigen [3]. The first CAR-T therapy was approved by the U.S. Food and Drug Administration (FDA) in 2017, with a further five products approved by 2022; targeting CD19+ malignancies including leukaemia and lymphoma, or B-cell maturation antigen (BCMA) expressing multiple myeloma (summarised in Table 1) [4–7].Table 1 Details of commercially available CAR-T cell products, all of which utilise second-generation CAR design.

Product	Year of approval by FDA	Indication	Cost per treatment (USD $)	Domain structure of CAR construct	Viral vector	Source	
Antigen binding domain	Hinge region	Trans-membrane region	Co-stimulatory domain	T cell activation domain	
Tisagenlecleucel (Kymriah) from Novartis	2017	Adults with relapsed or refractory (r/r) follicular lymphoma after two or more lines of therapy	$475,000	Anti-CD19 scFV	CD8α	CD8α	4-1BB	CD3ζ	Lentivirus	[12, 13]	
Axicabtagene ciloleucel (Yescarta) from Kite Pharma Inc.	2017	Adults with r/r large B-cell lymphoma (LBCL) after first-line chemoimmunotherapy.	$373,000	Anti-CD19 scFV	CD28	CD28	CD28	CD3ζ	γ retrovirus	[13, 14]	
Brexucabtagene autoleucel (Tecartus) from Kite Pharma Inc.	2020	Adults with r/r mantle cell lymphoma (MCL), (r/r) B-cell precursor acute lymphoblastic leukaemia (ALL)	$373,000	Anti-CD19 scFV	CD28	CD28	CD28	CD3ζ	γ retrovirus	[15]	
Idecabtagene vicleucel (Abecma) from Celgene Corporation, (Bristol-Myers Squibb)	2021	Adults with r/r multiple myeloma after four or more prior lines of therapy including an immunomodulatory agent, a proteasome inhibitor, and an anti-CD38 monoclonal antibody.	$419,000	Anti-BCMA scFv	CD8α	CD8α	4-1BB	CD3ζ	Lentivirus	[7, 16, 17]	
Lisocabtagene maraleucel (Breyanzi) from Juno Therapeutics (Bristol-Myers Squibb)	2022	Adults with LBCL	$410,000	Anti-CD19 scFV	IgI4	CD28	4-1BB	CD3ζ	Lentivirus	[18]	
Ciltacabtagene autoleucel (Carvykti) from Janssen Biotech Inc.	2022	Adults with r/r multiple myeloma after four or more prior lines of therapy, including a proteasome inhibitor, an immunomodulatory agent, and an anti-CD38 monoclonal antibody.	$465,000	Anti-BCMA scFv	CD8α	CD8α	4-1BB	CD3ζ	Lentivirus	[7, 19]	

The basic CAR structure (Fig. 1) mimics the T cell receptor activation and comprises several parts: an extracellular domain which recognises the specific antigen on the surface of cancer cells; a transmembrane domain which is critical for sending signals to the intracellular domain, activating the CAR-T cell to proliferate and survive [8]. CAR-T construct design has progressed through several generations as highlighted in Fig. 1. Commercial CAR-T cell products currently utilise second generation CAR designs, which have an additional costimulatory domain (CD28 or 4-1BB) to enhance T cell proliferation, persistence, and cytotoxicity (Table 1). Choice of costimulatory domains can significantly impact in vivo persistence; CD28-based CAR T cells persist around 30 days, compared to 4-1BB CAR T cells which may exceed 4 years in some patients [9–11].Fig. 1 Schematic detailing the progression of CAR-T construct design elements. First generation CARs which consisted of a single-chain variable fragment (scFv) antigen recognition domain, transmembrane domain, and an intracellular T-cell activation domain derived from CD3 zeta chain (CD3ζ) progressed to second generation CAR designs, which have an additional costimulatory domain (CD28 or 4-1BB) that enhances T cell proliferation and cytotoxicity, utilised by commercial products. Further third generation CAR constructs incorporate two distinct costimulatory domains (e.g., CD28 and 4-1BB). “Armoured” fourth generation CARs (also referred to as T-cells redirected for universal cytokine-mediated killing (TRUCKs)) incorporate inducible expression components such as cytokines (e.g., IL-12) which can increase activation of CAR-T cells and tumour killing and fifth generation or “next generation” CARs contain a truncated interleukin-2 (IL-2) receptor β chain (IL-2Rβ) with a binding site for the transcription factor STAT3 to fully exploit CAR activation signals via JAK-STAT3/5 signalling; enhancing T cell activation, proliferation and persistence. Created with BioRender.com

Haematological malignancies including leukemia, lymphoma and multiple myeloma have been the main target of CAR-T therapies thus far, with impressive treatment outcomes. Between 2015 and 2017, the phase ll ELIANA clinical trial of tisagenlecleucel, with a cohort consisting of 75 paediatric patients with refractory or relapsed B cell acute lymphoblastic leukaemia (ALL), resulted in an overall remission rate of 81% at three months [20]. However, 73% experienced severe adverse events, with 47% developing severe cytokine release syndrome (CRS). Safety issues with CAR-T therapies are a major concern with patients suffering from toxicities including CRS and tumour lysis syndrome, neurotoxicity, and a risk of graft-versus-host disease (GVHD). In addition, treatment of solid tumours with CAR-T therapy has proven more difficult due to tumour heterogeneity, infiltration and immune evasion in the tumour microenvironment (TME) [21]. There are also extremely high costs associated with autologous cell therapies, with CAR-T therapies ranging from $373,000—$475,000 per treatment, and further costs associated with leukapheresis, lymphodepletion therapy, and adverse effects of CAR-T immunotherapy. For example, total costs of treatment with tisagenlecleucel per patient treated are reported to range from $478,777 for those without CRS to $531,823 for those with severe CRS, due to further treatment and hospital care requirements including intensive care treatment in some cases [13]. Consequently, the development of alternatives which are safer is warranted, to reduce the risk of complications for patients, but also help to reduce costs in terms of manufacturing and costs associated with hospital treatment required to manage severe side effects. Once such alternative is the use of Natural Killer (NK) cells for CAR therapies, which have the potential to overcome some of the problems with CAR-T therapies [22].

Natural killer (NK) cells

NK cells are highly cytotoxic immune effectors, defined as CD56+ CD3– lymphocytes, capable of exerting natural cytotoxicity and antibody-dependent cellular cytotoxicity (ADCC) [23]. They play an important role in cancer surveillance with the unique ability of spontaneous cytotoxicity against cancer cells, without prior exposure or stimulation by other immune cells owing to a unique repertoire of activating receptors [24]. NK cells may identify abnormal cells through downregulation of human leukocyte antigen (HLA), synonymous with major histocompatibility complex (MHC), which are normally expressed on healthy cells, or upregulation of stress-induced ligands, such as major histocompatibility complex class 1 chain-related protein A and B (MICA, MICB). Upon recognition of a target cell, NK cells are activated through a complex signalling pathway involving a variety of receptors, co-receptors and intracellular proteins including natural cytotoxicity receptors (NCRs), Killer Ig-like receptors (KIRs), NKG2D and DNAM-1 [25–27]. Numerous NK activating and inhibitory receptors act in synergy to provide a mechanism of self-regulation to prevent damage to healthy cells which is summarised in Fig. 2 with more detail in Table 2.Fig. 2 Simplified schematic of commonly expressed NK cell A activating and B inhibitory receptors and corresponding ligands. NK receptors act in synergy to provide a mechanism of self-regulation to prevent damage to healthy cells and may identify abnormal cells through downregulation of human leukocyte antigens (HLA) synonymous with major histocompatibility complex (MHC), or upregulation of stress-induced ligands, such as major histocompatibility complex class 1 chain-related protein A and B (MICA, MICB). Upon recognition of a target cell, NK cells are activated through a complex signalling pathway involving a variety of receptors, co-receptors and intracellular proteins including natural cytotoxicity receptors (NCRs), Killer Ig-like receptors (KIRs), NKG2D and DNAM-1. Created with BioRender.com

Table 2 Summary of the main activating and inhibitory NK cell receptors which contribute to NK cytotoxic activity

Receptor family classification	Receptor name	Receptor activity	Ligand	Detail	Source	
Killer Ig-like receptors (KIRs)	KIR2DL1, KIR2DL2/3, KIR2DL4, KIR2DL5, KIR3DL1, KIR3DL2,

KIR3DL3

	Inhibitory receptors	KIR2DL1 ligand HLA-C, group 2,

KIR2DL2/3 ligand HLA-C, group 1 HLA-B, HLA-C (low affinity),

KIR2DL4 ligand HLA-G,

KIR3DL1 ligand HLA-Bw4,

KIR3DL2 ligand HLA-A3, HLA-A11, HLA-F

	Inhibitory isoforms outweigh activating ones in the affinity to HLA class I ligands

KIRs are expressed at later stages in mature NK cells. Carry immunoreceptor tyrosine-based inhibitory motifs (ITIM) in the cytoplasmic domains. Provide inhibitory signalling for NK cells when interacting with their ligands (e.g., certain HLA-A, B, or C allotypes for inhibitor KIRs)

	[27]	
KIR2DS1, KIR2DS2, KIR2DS3, KIR2DS4, KIR2DS5, KIR3DS1	Activating receptors	KIR2DS1 ligand HLA-C,

KIR2DS2 ligand HLA-C, KIR2DS3, KIR2DS4 ligand HLA-C, HLA-A, HLA-F,

KIR2DS5 ligand HLA-C,

KIR3DS1 ligand HLA-F, HLA-B

	All activating KIRs require DAP12 association	[27]	
C-Type Lectin Family	NKG2A (CD159a) (Complex: NKG2A/CD94)	Inhibitory receptor	HLA-E	Expressed in earlier stages of NK cell differentiation (immature NK cells), prevent killing of healthy cells.

Carry immunoreceptor ITIM motifs in their cytoplasmic domains.

Provide inhibitory signalling for NK cells when interacting with their ligands (e.g., HLA-E for CD94/NKG2A).

NKG2A forms complexes with CD94 and through the ITIM motif transduces inhibitory signals. Has a higher affinity to HLA-E ligands than the CD94/NKG2C (activating) complex.

	[21]	
NKG2C (NKG2C/CD94)	Activating receptor	HLA-E	Expressed in earlier stages of NK cell differentiation (immature NK cells). Forms complexes with CD94 and associates with DAP12 for an activating signal transduction. Has a lower affinity to HLA-E ligands than the CD94/NKG2A (inhibitory receptor).		
NKG2D (CD314) (﻿KLRK1)	Activating receptor	MICA, MICB, ULBP-1-6	Also known as KLRK1 (killer cell lectin-like receptor subfamily k, member 1).

Recognises/binds to “kill me” stress signals expressed on tumour cells: Major histocompatibility complex class 1 chain-related protein A and B (MICA, MICB) and (UL16 binding protein) ULBP-1 - ULBP-6.

Activating receptor responsible for provoking caspase-mediated apoptosis.

	[26]	
NKp80 (KLRF1)	Activating receptor	Activation inducted C-Type Lectin (AICL), also known as CLEC2B	AICL is preferentially expressed on the surface of myeloid cells. The NKp80/AICL interaction promotes myeloid cell killing and stimulates IFN-γ cytokine release from NK cells and TNF from myeloid cells.

It cooperates in the NK-mediated killing of phytohemagglutinin (PHA)-stimulated blast cells but not of various tumour cells.

	[25]	
Natural Cytotoxicity Receptors (NCRs)	NKp30 (NCR3) (CD337)	Activating receptor	Viral hemagglutinin (HA), Heparan sulfate (HS), glycosaminoglycans (GAGs), ﻿pp65, B7-H6, galectin-3, BAG6, ﻿(DBL)-1a domain of Plasmodium falciparum erythrocyte membrane protein-1,

B7-H6 immunoligand on tumour cells

	Play a major role in tumour cell recognition and killing. Recognise a diverse set of viral, oncogenic, or stress-induced ligands.

Recruit immunoreceptor tyrosine-based activation motif (ITAM)-bearing adapter molecules DAP12, CD3z or FcRIg, which in turn initiate activation signalling cascades.

NKp30 recognises B7-H6 immunoligand. B7-H6 also has links with programmed cell death protein (PD-1) - implications for immune checkpoint inhibitors.

Expressed constitutively on mature, resting or activated NK cells and some populations of T cells. Downregulated on memory-like NK cells.

	[21, 28, 29]	
NKp44 (NCR2) (CD336)	Activating receptor	HA, HS, GAGs, Platelet-derived growth factor-DD (﻿PDGF-DD), Exon 21 specific mixed lineage leukaemia protein-5 (21spe-MLL5), proliferating cell nuclear antigen (PCNA), Syndecan-4, Nidogen-1	Found only on activated NK cells. Associates with the DAP12 homodimer for cytokine release ignition.		
NKp46 (NCR1) (CD335)	Activating receptor	HA, HS, GAGs, Complement factor P, (DBL)-1a domain of Plasmodium falciparum erythrocyte membrane protein-1, vimentin	Uniquely expressed on NK cells. Triggers cytotoxic reaction upon activation.		
Co-receptors	2B4 (CD244)	Activating receptor	CD48	The 2B4 receptor (SLAMF4, CD244) is a member of the signalling lymphocyte activation molecule (SLAM), which is a part of the immunoglobulin (Ig) superfamily.

Interacts with CD48 (SLAMF2) and has an activating function that increases cytolytic function in NK cells

CD48 is a glycophosphatidylinositol (GPI)-linked member of the CD2 family and is expressed on all hematopoietic cells e.g. melanoma cells

Evidence suggests activation of 2B4 is dependent upon simultaneous engagement of a main activating receptor e.g. NCRs

	[30]	
DNAM-1	Activating receptor	CD112, CD155	Recognition of CD112 (Nectin-2) and CD155 (Poliovirus receptor PVR) on tumour cells. Expressed on NK cells, T cells and monocytes. Signalling promotes cellular adhesion, actin and granule polarisation.		
Immune checkpoint markers	CD96	Activating	CD155	Interacts with CD155 on tumour cells	[28]	
TIGIT (T-cell immunoglobulin and ITIM domain)	Inhibitory	CD112, CD113, CD155	Interacts with CD155 and CD112 on tumour cells.

NK cells with low levels of TIGIT expression show higher cytokine secretion capability, degranulation activity, and cytotoxic potential than NK cells with high levels of TIGIT expression

	[31, 32]	
PD-1	Inhibitory	PDL-1, PDL-2	Expressed on various immune cells. Binds to ligands present across multiple cancer types leading to NK cell exhaustion and cancer immune escape. Most abundantly expressed by mature NK cells	[29]	

Inhibitory receptors recognise HLA molecules, enabling NK cells to distinguish between normal and abnormal cells. When the balance tips in favour of activating receptors, cytotoxic granules are released containing perforin and granzyme B to cause direct killing through caspase-mediated apoptosis of the target cells [33]. NK cells also express death receptors, such as FasL, TRAIL and tumour necrosis factor-alpha (TNF-α) receptors, to induce apoptosis in target cells expressing the corresponding receptor [34, 35]. A variety of cytokines and chemokines are produced, such as interferon-gamma (IFN-γ) and TNF-α, causing activation of other immune cells including dendritic cells, macrophages and T cells, and promoting inflammation [31, 36, 37]. Furthermore, NK cells are capable of ADCC through recognition of target cells coated with antibodies. Mature NK cells express the CD16 receptor (also named FcγRIIIA) which recognises the Fc fragments of an immunoglobulin G (IgG) bound to an epitope on the surface of a target cell [25]. Following interaction with IgG coated cells, immunoreceptor tyrosine-based activation motif (ITAM)-containing subunits of CD16 connect the receptor to intracellular signal transduction pathways which triggers reorganisation of actin and microtubules to enable ADCC. This culminates in release of cytotoxic granules containing perforin and granzyme, engagement of FasL and TRAIL death receptors and release of cytokines and chemokines which promote further recruitment of a variety of immune cells [38]. The expression of CD16 is pivotal for NK cell ADCC function and is expressed on more mature NK cells. CD16 expression is therefore used in the nomenclature to classify the maturation state of NK cells. Human NK cells are conventionally sub-divided into two major subsets: CD56brightCD16dim/− and more mature CD56dimCD16+. The CD56dim subset are more predominant in peripheral blood, while CD56bright are more abundant in tissues. CD56bright NK cells are regarded as immature, expressing NKG2A but not KIRs. They are poorly cytolytic, secrete cytokines IFN-γ, GM-CSF, and proliferate in response to IL-2 or IL-15. Conversely, CD56dim are regarded as mature, express NKG2A and/or KIR receptors and have strong cytolytic activity and cytokine secretion upon activation. The most mature, terminally differentiated NK cells are classified as CD56dim KIRpos CD57pos CD16bright (Fig. 3) [23, 39]. The mature CD56dimCD16+ subset is ideal for cancer therapy due to strong cytolytic activity and ADCC capacity. Consequently, adoptive immunotherapy with NK cells has emerged as a promising treatment option and research is focusing on investigating ways to harness the power of NK cells for use in cancer immunotherapy, such as CAR-NK cell therapy.Fig. 3 NK cell maturation and interaction with other immune cells. A Changing receptor status according to maturation state of NK cells from immature CD56bright/CD16− cells to mature CD56dim/CD16+ and terminally differentiated NK cells which also may be described as “memory-like” NK cells. B NK cell signalling and interaction with myeloid cells and target cells following activation. NK cells mediate cytotoxicity against target cells via direct killing (activating receptors including NKG2D, NKp30, NKp44, NKp46, KIRs), apoptosis (TRAIL and FasL death receptors) and/or ADCC (CD16) and produce inflammatory cytokines and chemokines which stimulate and recruit other immune cells. Created with BioRender.com

[FIGURE 3].

Advantages of CAR-NK therapies

NK cells have several potential advantages over T-cells for CAR therapies including enhanced safety profile, potential for allogeneic therapy and wider target specificity through CAR-dependent and CAR-independent cancer cell targeting. CAR-Ts secrete a range of cytokines including IL-1, IL-2, IL6, TNF-α, MCP1, IL8, IL10, IL-15. These cytokines, and in particular the pro-inflammatory TNF-α, IL-1 and IL-6, are reported to be responsible for the severe side effects associated with CAR-T therapies including neurotoxicity and CRS [40]. In contrast, a different cytokine profile is associated with CAR-NK, which secrete IFN-γ and GM-CSF [41]. Indeed, no increase in inflammatory cytokines were detected over baseline following administration of CAR-NK cells in patients with CD19+ lymphoid tumours [42]. This difference in cytokine release profile is proposed as one reason for the enhanced safety profile with NK cells resulting in less toxicity and reduced cytokine storm occurrence. Although it is important to note these conclusions are based on only a small number of clinical CAR-NK studies with limited patient numbers, compared to numerous large CAR-T clinical studies, and no direct comparison has yet been carried out between CAR-T and CAR-NK therapies. Another potential safety advantage with CAR-NK cells is the reduced risk of on-target, off-tumour toxicity which has been associated with CAR-T cells [43]. All cells, malignant and non-malignant, such as CD19+ B cells, which express the CAR-target antigen may be targeted by CAR-T cells. The inhibitory receptors on NK cells may act as a safety switch if non-malignant cells are recognised by the CAR antigen. NK inhibitory signals would be initiated by recognition of non-malignant cells, preventing off-tumour toxicity [44].

The potential for allogeneic application of NK cells lies in the low risk of GVHD following CAR-NK cell therapy. In the case of T cells, with their highly variable αβ T-cell receptors (TCRs), donor T cells bind with HLA class I molecules widely expressed on recipient tissue cells. Following infusion of donor T cells, the TCR recognises the HLA as foreign, initiating an immune response against recipient cells, causing an alloreaction leading to GVHD [45]. In comparison, NK activity is not dependent on HLA I recognition, allowing NK cells to target malignant cells which often lose their HLA l receptor as a means of immune evasion [5]. As a result, the risk of GVHD is low with NK cell therapies [46], and studies on NK cells have produced promising results in relation to safety.

Due to the improved safety profile and lower risk of GVHD, there is potential for the development of an “off-the-shelf” CAR-NK product [47], which could be transformative for the field. Although autologous NK cell therapies are under investigation, allogeneic NK cells may be more effective than autologous NK therapies, overcoming issues with exhausted NK cells from immunosuppressed patients [48]. Allogeneic donor NK cells can be grown in large batches, facilitating more efficient quality control testing, transfection, and infusion [49]; allowing for treatment of multiple patients from the same batch which could negate the need for specialist centres. In contrast, T cells used in current CAR therapy are typically derived from the patient's own cells, which can be time-consuming and costly to harvest and engineer. Autologous CAR-T therapy can cost up to $475,000 USD per treatment, due to CAR-T therapy being labour intensive, difficult to scale and prone to failure [13]. In comparison, the cost of a cycle of an allogeneic “off-the-shelf” NK-92 treatment could be less than $20,000 USD, making it a much more cost-effective option [50, 51]. It is important to note that such costs savings are only achievable when engineered allogeneic NK-cell products are shared among multiple patients. Furthermore, efforts to produce allogeneic T cells are ongoing and could also serve to overcome the problems encountered with autologous T cell engineering.

CAR-NK therapies may have potential in treatment of solid tumours. CAR-T therapies have produced disappointing treatment outcomes in solid tumours due to barriers such as tumour heterogeneity, immunosuppressive tumour microenvironment (TME), insufficient trafficking and infiltration, and toxicities [21]. CAR-NK cells have been investigated in a wide range of solid tumours such as glioblastoma, small-cell lung, breast, prostate, ovarian, colorectal and pancreatic cancer, and it is proposed that the natural properties of NK cells may be beneficial in treating solid cancers [52]. In contrast to lymphomas with stable overexpression of B-cell antigens, solid tumours often have variable antigen surface expression levels and heterogeneity within tumours and between primary and metastatic tissue makes successful treatment difficult with a single CAR target [53]. In addition to any CAR modification, NK cells have the potential to recognise heterogenous tumour cells via multiple activating and inhibitory receptors despite the diminished or absent expression of HLA-I molecules. The presence of activating signals, such as NKG2D, allow NK cells to exert their cytotoxicity directly against transformed cells which lack the specific CAR antigen and would otherwise be left untouched by CAR-T cells and is often the case in the heterogenous solid tumour environment. This is a distinct advantage over CAR-T cells which are only active against cells expressing the CAR antigen and allows NK cells to target a wider cancer cell population. Indeed, even without the addition of CAR-antigens, unmodified NK cells have been utilised to target cancer cells and have shown early signs of their effectiveness in clinical trials [54]. Furthermore, in addition to their direct cytotoxic effects against cancer cells, NK cells are also important for recruiting conventional type 1 dendritic cells (cDC1) and subsequently CD8+ T cells which would promote the cancer immunity cycle activation, with the potential of overcoming the immunosuppressive TME [55].

Current state of CAR-NK therapy development

Currently there are no approved NK cell-based products on the market, but the number of clinical trials investigating NK cell therapies has exploded since 2016, with nearly 60 trials initiated by May 2023 [48]. The field is still only recently emerging, with the large majority of trials at phase I or II and still ongoing, thus results are not fully reported yet. However, early data has been promising and suggests that CAR-NK cell therapy is safe and has the potential to be an effective treatment for cancer, although significant clinical effects have yet to be reported. A range of antigens and malignancies are targeted but a significant number of CAR-NK trials focus on targeting CD19 for haematological cancers, which has been a successful target of CAR-T therapy.

One example of CAR-NK cells targeting CD19, is the phase I/II clinical trial investigating the safety and efficacy of CD19-targeted CAR-NK cells in patients with relapsed or refractory CD19+ B-lymphoid malignancies including ALL, chronic lymphocytic leukaemia (CLL) and non-Hodgkin’s lymphoma (NCT03056339) [42, 56]. HLA-mismatched NK cells derived from cord blood were co-cultured with K562 feeder cells and IL-2 and transduced on Day 6 with a retroviral vector expressing anti-CD19 CAR, IL-15 to enhance in vivo expansion and persistence of CAR-NK cells and inducible Cas9 as a safety switch to trigger apoptosis of CAR-NK cells in the event of unacceptable toxic effects. Following expansion, the CAR-NK cells were harvested for fresh infusion on Day 15 and administered to 37 patients with relapsed or refractory CD19+ cancers including non-Hodgkin’s lymphoma and CLL. Clinical responses to therapy were based on the 2018 criteria of the International Workshop on CLL (iwCLL) and the 2014 Lugano classification for non-Hodgkin’s lymphoma [57, 58]. The 1-year overall survival was 68% with progression-free survival reported as 32%. Importantly, no significant toxicities occurred including CRS, neurotoxicity or GVHD, and there was no increase in the levels of inflammatory cytokines including IL-6. The promising clinical outcome and safety profile highlights the potential of CAR-NK therapy as an allogeneic therapy which could be developed into an “off-the-shelf” product.

The potential for CAR-NK cell therapies to treat solid tumours has driven investigation in this area and several clinical trials are ongoing in glioblastoma, small-cell lung, breast, prostate, ovarian, colorectal and pancreatic cancer [43, 52]. Many of these studies are in the very early stages and still recruiting patients, so results have not been fully reported yet. Recently, Burger et al. published the results of the first clinical trial to explore adoptive CAR-NK cell therapy in glioblastoma patients; a phase I trial investigating intracranial injection of human epidermal growth factor receptor 2 (HER2)-targeted CAR-NK cells during relapse surgery in 9 patients with recurrent HER2+ glioblastoma (NCT03383978) [59]. This study investigated lentivirally transduced NK-92 cells expressing a CAR comprising a HER2-specific scFv antibody, a CD8a α hinge regions and CD28 and CD3ς signalling domains. Following injection of the CAR-NK cells into the margins of the surgical cavity during surgery, five patients showed stable disease that lasted 7 – 37 weeks. Four patients had progressive disease and pseudo-progression was found at injection sites in two patients, suggestive of a treatment-induced immune response. For all patients, median progression-free survival was 7 weeks, and median overall survival was 31 weeks. Furthermore, there were no dose-limiting toxicities, and none of the patients developed CRS or immune effector cell-associated neurotoxicity syndrome. This study demonstrated the feasibility and safety of CAR-NK cells for treatment of glioblastoma. Although this was a very invasive study requiring injection of the CAR-NK cells during surgery, further studies are required to assess the ability of CAR-NK cells to target and infiltrate solid tumours following IV infusion. It is hoped that these promising results will also be replicated in other solid tumour types, in which early stage clinical trials are underway.

CAR-NK production considerations

Despite the promising safety and therapeutic outcomes, CAR-NK therapies are still in their infancy and much work is to be done before they are approved for use in the clinic. Some considerations that need to be addressed if the potential of CAR-NK therapies is to be realised include the source of NK cells, CAR construct design and genetic modification methods for NK cells.

Allogeneic NK cell sources

Allogeneic NK cells may be obtained from several sources including peripheral blood (PB), umbilical cord blood (CB), inducible pluripotent stem cells (iPSCs) and immortalised cell lines. Each of these sources have unique considerations for expansion and genetic modification and all are currently under clinical investigation.

NK cells derived from peripheral blood (PB) and cord blood (CB)

Primary NK cell may be derived from PB or CB sources. PB NK cells are the most accessible method of obtaining NK cells for CAR therapy and are widely utilised for NK cell applications. However, cell proliferation can be low with a short cell survival time [60]. Approximately, 85–95% of PB NK cells are CD56dimCD16high which are highly cytotoxic, but less proliferative than their cytokine producing CD56bright counterparts (5–15% of PB NKs) [61]. In comparison, CB-derived NK cells may be more easily obtained due to routine banking, and are more proliferative than PB NK cells, allowing for ease of expansion in vitro. However, CB NKs are phenotypically and functionally immature and may not be as cytotoxic are NKs derived from other sources [62–64].

Following isolation of NK from PB or CB, expansion is required for creation of allogeneic doses which has proven challenging due to the large number of NK cells required for therapeutic doses. Expansion protocols may be classified as feeder-cell-based or feeder-free systems. Co-culture with feeder cells (e.g. Epstein-Barr Virus transformed lymphoblastic cell lines (EBV-LCL)) which present ligands to NK cells, stimulates activation and expansion of NK cells to large numbers relatively quickly (within a few weeks). However, the use of feeder cells is associated with safety and regulatory concerns including the potential for residual viable feeder cells in the final NK cell product [64]. Consequently, feeder-free expansion methods using cytokines and antibodies to stimulate NK cells have been developed. Cytokines including IL-2 and IL-15 are potent NK cell stimulants, but a range of cytokine combinations including IL-15, IL-21, IL-12, IL-18 and IL-27 have shown promise for NK expansion [65]. While feeder-free systems avoid the safety concerns associated with feeder cells, the resultant NK yields are lower. A combination of feeder cells genetically modified to express stimulating cytokines has resulted in highly cytotoxic and proliferative NK cells. For example, K562 feeder cells genetically modified to express membrane-bound IL-15 and 41BB ligand (K562mbIL12-41BBL) results in large scale expansion of PB NK cells within 10 days of culturing in gas-permeable static cell culture flasks (G-REX) [66]. Another factor which can impact on the potency of NK cells is cryopreservation. NK cells derived from PB or CB sources may be cryopreserved before expansion or in the case of “off-the-shelf” products, storage may be required before infusion into patients. This can have detrimental effects on NK proliferation and cytotoxic functionality. Potential solutions to this include preparation of excess cells to allow for loss following cryopreservation or stimulation with cytokines such as with IL-2 immediately after thawing or pretreatment with IL-15 and IL-18 to enhance viability after cryopreservation [64, 67]. Furthermore, in the context of non-viral genetic engineering methods, PB and CB NK cells remain difficult to manipulate compared to iPSCs and cell lines.

Factors relating to the culture and expansion of NK cells may impact on transfection rates including activation state of NK cells, timing of transfection during expansion, method of expansion (feeder or feeder-free methods) and cryopreservation. Viral transduction rates are enhanced in NK cells which have been expanded (activated) ex vivo, with lower transduction observed in resting primary NK cells [68]. Standard protocols for large scale expansion of NK cells require an initial expansion before viral transduction, which is then followed by a second stage of expansion [66]. This protocol of sequential primary expansion, genetic editing and secondary expansion is also required for electroporation, and the method and timing of expansion based on feeder-cells or feeder-free systems may also impact transfection rates. Feeder cells may enhance genetic editing via induction of cell division and feeder stimulation may support NK cell recovery following ex vivo manipulation [69]. For example, Pomeroy et al. observed highest transposition of TcBuster following electroporation on Day 4 of co-culture of PB NK cells with K562-mbIL-21-41BB feeder cells. The ratios of feeder cells to NK were also adjusted depending on the stage of protocol (2:1 feeder:NK prior to electroporation, 5:1 48 h after electroporation or 1:1 for all subsequent expansions) [70]. Similarly, Gurney et al. used EBV-LCLs (10:1 feeder:NK ratio) to activate NK cells in the presence of IL-2 and IL-21. NK cells were electroporated on Day 4 and rested for 48 h in presence of IL-15 before restimulating with feeder cells [71]. Further expansion was carried out up to Day 25 with variation in the expansion of cells observed between donors. This highlights the complexity of optimisation required for genetic engineering and expansion of NK cells and a wide range of factors may impact the transduction/transfection rates, with no standard protocols established yet. Further research is required to elucidate optimal conditions and it may be necessary to tailor conditions depending on the gene delivery method.

iPSC derived NK cells

An alternative to the issues with primary PB and CB derived NK cells is iPSCs, which offer an unlimited source to produce homogenous NK cells and can be genetically modified and expanded on a large scale [64]. iPSC-derived CAR-NK cells can be generated from a single iPSC line and then differentiated and expanded into a universal cell product, with potential for an “off-the-shelf” therapy. In December 2021 a Fate Therapeutics press release detailed promising interim clinical data on a phase I study investigating “off-the-shelf” iPSC derived CAR-NK cells expressing CD19, termed FT596, for treatment of relapsed/refractory B-cell Lymphoma (NCT04245722) [72, 73]. FT596 iPSC CAR-NK cells were engineered to express a high affinity non-cleavable variant of CD16 for enhanced ADCC; a membrane-bound IL-15/IL-15R fusion protein to support in vivo persistence; and an NK cell optimised anti-CD19 CAR for direct tumour targeting [74]. It was reported that 10 of 11 patients treated with a second FT596 cycle continued in ongoing response, with three patients in ongoing complete response at ≥ 6 months follow-up. Furthermore, FT596 treatment regimens were well-tolerated with no dose-limiting toxicities, such as neurotoxicity or GVHD, although there were two low-grade adverse events of CRS reported in the FT596 single-dose escalation cohort which resolved without intensive care treatment. This early data highlights the potential for iPSC CAR-NK therapy, but further studies and optimisation will need be completed before such treatment is rolled out at a larger scale in the clinic.

One issue with iPSC NKs is the requirement for highly specialised culture conditions, where iPSCs are differentiated into CD34+ hematopoietic progenitor cells before further differentiation into NK cells. Well established protocols for producing NK cells from iPSC can take 4–5 months, although more recently a new method has been developed with reduced processing time of around 2 months [75]. Controlled differentiation of iPSCs is a labour-intensive manufacturing process requiring genetic engineering and cell culture expertise, which could be problematic for large scale manufacture of an “off-the-shelf” product which is financially viable and accessible to a broader patient population [74, 76]. In addition, major concerns exist regarding the risk of genetic mutations with iPSCs, particularly when long culture periods are required. Furthermore, there is a risk of potential tumorigenicity from undifferentiated iPSCs [77]. Therefore, there is a need to develop robust quality testing on iPSC-derived cells including screening for any genetic alterations which may have occurred during culturing.

NK cell lines

To date there are 10 immortalised model NK cell lines, including NK-92, KHYG-1, NKL and YT, which have been established from NK/T lymphoma patients and are used pre-clinically for the development of CAR therapies [48]. NK cell lines are highly cytotoxic toward malignant cells and have an advantage of being more easily genetically modified and expanded than NK cells from primary PB or CB sources [78–81]. Although it is important to note NK cells lines are known to be more difficult to culture than other types of cell lines, due to high sensitivity to changes in culture conditions and generally require addition of cytokines IL-2 or IL-15 to support proliferation. NK cell lines also require irradiation prior to transfer to patients due to their malignant nature, which can be detrimental to the survival and cytotoxic effects of the transfused NK cells [82]. Nevertheless, NK-92 cells have gained FDA approval for clinical use and by 2021 were the most frequently used source of engineered NK therapies in clinical trials (43% of trials), followed by PB NKs (21%), iPSCs (17%), and CB NKs (13%) [48, 83].

NK-92 cells were derived from a 50-year-old male patient in 1994 with non-Hodgkin’s lymphoma and are considered an NK-like cell line due to expression of CD56 and many major NK activating receptors including NKp30, NKp46, 2B4, NKG2D and CD28. Conversely, NK-92 cells lack almost all the KIR receptors and express few inhibitory receptors (NKGA/B, low levels of KIR2DL4, ILT-2) and do not express the CD16 receptor responsible for ADCC. The strong cytotoxic activity of NK-92 cells can be attributed to this receptor expression profile which triggers perforin-granzyme cytotoxic pathways when activated in addition to death receptor cytotoxic pathways lead by FasL, TRAIL, tumor necrosis factor-like weak inducer of apoptosis (TWEAK) and TNF-α [84, 85].

Several derivative cell lines have been developed to overcome limitations with native NK-92 cells and move towards the development of “off-the-shelf” CAR-NK cells. NK-92MI were engineered to produce IL-2, negating the need for supplementary IL-2 [86]. A first-in-man clinical trial (NCT02944162) of NK-92MI expressing a CD33 CAR in patients with relapsed and refractory acute myeloid leukaemia (AML) demonstrated the clinical safety profile of these cells. NK-92MI cells were lentivirally transduced with a CAR CD33.CD28.41BB.CD3z construct, expanded and co-irradiated (10 Gy) prior to infusion. Following infusion of up to 5 × 109 cells per patient, no significant adverse effects were observed although one patient experienced grade I CRS. One of the three patients treated did not respond to the treatment, while two of the three responded, but relapsed after 1 month and 4 months [87]. Although this was a small study with a limited number of patients, it was useful for demonstrating the positive safety profile of CAR-MI cells, but treatment outcomes were underwhelming.

Further optimisation of the NK-92 cell line resulted in production of high affinity NK-92 (haNKs) which express the CD16 receptor, increasing the ADCC activity [88]. Targeted affinity NK-92 (taNK) have been modified to target specific tumour cell ligands and furthermore t-haNKs combine all these features to express high affinity CD16, secrete IL-2 and recognise specific tumour ligands such as PD-L1 [89–91]. The potential of t-haNKs for treatment of characteristically difficult-to-treat pancreatic cancer was highlighted following the phase II QUILT 88 trial (NCT04390399) investigating ImmunityBio’s Nant Cancer Vaccine, comprising a combination of PD-L1 targeting t-haNK cells with an IL-15 receptor agonist Anktiva (N-803), aldoxorubicin, an albumin-modulated agent, plus low-dose chemotherapy in treatment of pancreatic cancer [92]. Following combination therapy overall survival for third, fourth- and fifth-line patients was 5.8 months, which was nearly double that of the historical survival of 3 months, and serious adverse effects were uncommon at 8%. With many more trials ongoing on CAR-expressing NK-92 cells investigating treatment of both haematological and solid tumours using a range of cancer targets including CD19, MUC-1, HER2, ROBO1 and PD-L1 [48], these early positive results may be an indication of the future potential of CAR-NK therapies exploiting NK-92 cells.

The KHYG-1 cell line has been shown to be more potently cytotoxic than NK-92 cells [93]. This suggests this cell line could also have therapeutic application as an “off-the-shelf” CAR-NK therapy as reported in a proof-of-concept study by Stikvoort et al. [94]. KHYG-1 cells were retrovirally transduced with a CD38-CAR containing a CD28 costimulatory domain and produced effective CD38-dependent cytotoxicity towards CD38high multiple myeloma (MM) cell lines (UM9 and THP-1) and primary MM cells derived from patients. Furthermore, CD38-CAR KHYG-1 cells significantly slowed the growth of UM9 tumours in a xenograft model with a humanized bone marrow-like niche. RAG2–/–γc–/– mice implanted with luciferase expressing UM9 MM tumours were treated with multiple i.v. injections of CD38-CAR KHYG-1 cells and at 20 days post treatment, only a fourfold increase in bioluminescence was detected in CD38-CAR KHYG-1 treated mice compared to 24-fold increase in the untreated cohort. This study highlights the potential for KHYG-1 cells to be developed into CAR-NK cells in a similar fashion to NK-92 cells, but further investigation is required to assess this in humans as results in mouse models do not always translate to humans.

NK cells lines which are derived from malignant sources require irradiation before clinical application, which can impact on proliferation and persistence in vivo. For example, NK-92 cells have a short lifespan in vivo, typically two days after initial infusion [95], which can be advantageous in terms of reducing side effects when compared to CAR-T therapies which can circulate for months or years after infusion. However, this short lifespan may result in inferior therapeutic outcomes and the requirement for multiple treatments. Already, NK-92 cells have been engineered to express IL-2 which enhances in vivo expansion, but more sophisticated engineering is required to combat NK exhaustion in the TME, particularly for treatment of solid tumours. KHYG-1 cells strongly express the inhibitory receptor NKG2A and when co-cultured with MM cells were found to express high levels of PD-1 [94]. This could be a major stumbling block in the development of CAR-NK therapies and will need to be addressed before such therapies are successful.

CAR construct design for NK cells

Initial CAR-NK studies adopted the CAR-T backbone which had been designed to mimic the T-cell receptor. However, NK cytotoxicity is regulated by a distinct set of activating and inhibitory receptors which can be incorporated into CAR design to engage native NK receptors and exploit NK functionality. CAR-NK cells may be engineered to optimise NK cell effector functions by expressing an antigen-specific CAR molecule which incorporates NK-specific transmembrane signalling domains along with co-stimulatory receptors (e.g., NKG2D, DNAM-1, 2B4, CD28 or 4-1BB). These are designed to enhance NK cell activation upon recognition of tumour antigens and improve persistence, cytotoxicity, and cytokine production capabilities of CAR-NK cells (Fig. 4) [96–98].Fig. 4 Schematic comparing CAR construct design elements for CAR-T and CAR-NK therapy. Initial studies investigating CAR-NK cells used the same constructs used for third generation CAR-T therapies, which are designed to mimic the T cell receptor. NK specific CAR constructs have since been developed to incorporate NK transmembrane signalling domains along with co-stimulatory receptors (e.g., DAP10, 2B4, CD28 or 4-1BB), to enhance NK cell effector functions. The activating receptor NKG2D has also been incorporated into NK-specific CAR constructs; although not a classical “CAR” as NKG2D is not an scFv, but they are referred to as CARs in the literature. Created with BioRender.com

Li et al. screened several CAR constructs optimised for activity in NK cells comprising various combinations of the transmembrane and co-stimulatory domains [73]. Activity of iPSC-NK cells expressing a CAR targeting mesothelin comprising a NKG2D transmembrane domain, 2B4 co-stimulatory domain, and CD3ζ signalling domain (termed CAR-iPSC-NK) were compared to a T-cell based CAR comprising two CD28 domains with 4-1BB (CD137) and CD3ζ (termed T-CAR-NK) in a luciferase-expressing A1847 ovarian cancer xenograft model. CAR-iPSC-NK resulted in significantly reduced tumour burden following bioluminescent imaging and improved survival when compared to the T-CAR-NK treatment group. Furthermore, following a comparison of CAR expressing primary T cells, survival was improved with 80% survival at day 70 in the CAR-iPSC-NK group compared to 20% survival in T-CAR group. Importantly, the T-CAR group exhibited evidence of severe side effects including significant weight loss (> 50%, n = 2 on days 23 and 39), severe visceral haemorrhage and ischemia, enlarged spleen and evidence of pathogenic damage to internal organs including liver, lungs, kidneys, and gut. In comparison, no such effects were observed in the CAR-iPSC-NK treatment group.

We know that NKG2D is a major activating receptor responsible for provoking caspase-mediated apoptosis following recognition of “kill me” stress signals expressed on tumour cells namely MICA, MICB and UL16 binding protein (ULBP-1 and ULBP-6) [26]. Exploiting NKG2D could enhance NK antitumour cytotoxicity. Xiao et al. report a small clinical trial investigating PBMC-derived NK cells expressing NKG2D fused to DAP12 co-stimulatory domain which was delivered by intraperitoneal (i.p.) infusion to three patients with metastatic colorectal cancer (NCT03415100) [99]. The authors report reduction of ascites generation and marked decrease in tumour cells in ascites samples in two of the three patients, and in the third patient rapid tumour regression in the liver region was observed with ultrasound and complete metabolic response confirmed by PET-CT scanning. All three patients were reported to have stable disease and importantly, no dose-limiting toxicities or GVHD were observed. Although the CAR constructs used in this study had a first-generation design with only one intracellular domain, it paves the way for further development of next generation CAR constructs bearing NKG2D receptors. This highlights the importance of careful NK-specific CAR construct design to maximise CAR-NK therapeutic effect and reduce side effects when compared to CAR-T constructs, and there is still a considerable number of NK receptors, co-stimulatory domains, and combinations of each to be explored.

Genetic modification methods for CAR-NK manufacture

For large scale manufacture of an “off-the-shelf” CAR-NK product, the method used to genetically engineer the NK cells is an important consideration which can impact on production time, costs, and scalability. Ideally, the method of transfection for the creation of CARs should be efficient, scalable, and non-immunogenetic [100–102]. Currently, the majority of CAR therapies are engineered using viral vectors, which produce stable gene expression and higher transduction rates than non-viral methods [78]. NK cells are exceptionally challenging to transduce, particularly primary PB and CB NK cells, even with viral vectors which are usually very efficient at transducing a wide range of cells; owing to high expression of immune receptors, such as pattern recognition receptors (PRRs), which trigger apoptosis of NK cells following viral transduction [68, 103, 104]. Consequently, viral vectors commonly used in genetic editing for CAR-T production such as the vesicular-stomatitis-virus-G protein (VSV-G) lentivirus have reduced transduction rates (< 10% transduction efficiency) in NK cells. In the case of VSV-G, this is reportedly due to low expression of the low-density lipoprotein receptor on NK cells, required for VSV-G cellular entry [96].

The baboon envelope pseudotyped lentiviral vector (BaEV-LV), which binds to sodium-dependent neutral amino acid transporter (ASCT1 and ASCT2) for cellular entry, has been reported to produce enhanced transduction of 23% in freshly isolated human NK cells with a sustained transgene expression for at least 21 days [105]. For ex vivo genetic engineering, stable expression with lentiviral vectors is an important consideration, as cells are engineered to permanently express the transgene and then expanded before infusion into a patient [102]. However, viral vectors have significant disadvantages including safety concerns regarding mutagenesis, toxicity, immunogenicity; expensive time-consuming production which is in addition to the lengthy NK cell expansion protocols; and limited capacity for nucleic acids carriage which can be problematic when delivering larger 3rd, 4th and 5th generation CAR constructs [102, 106, 107]. For example, a 2nd generation CAR construct for lentiviral production could be around 10 kbp, with this increasing towards 20 kbp constructs as more components are added in for later generations [108]. Consequently, there is a need to develop safer, more efficient non-viral genetic modification methods for CAR-NK production.

Gene editing tools for CAR-NK cells

Developments in genetic editing tools such as DNA transposons and Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) technologies have provided an alternative non-viral method of stable transgene expression. Transposon systems are a class of genetic elements with the ability to move or ‘transpose’ from one location to another within the genome via a ‘cut-and-paste’ mechanism, making them a powerful tool for genetic engineering [109]. The most promising transposons for gene therapy are derived from Sleeping Beauty (SB) and piggyBac (PB) systems [110]. Transposon systems comprise a two-component system with the transposon containing the gene of interest usually in plasmid form and the corresponding transposase enzyme which may be in the form of the protein or mRNA encoding the transposase protein. The transposon is flanked by specific DNA sequences known as inverted terminal repeats (ITRs) which are recognised by transposase. Upon recognition of the ITR, the transposase cuts out the transposon which is then inserted at a new genomic location [109]. Despite the potential of transposons systems for stable gene delivery, no transposon system has made it to the clinic yet due to concerns over unintended genomic disruptions or insertional mutagenesis and immunogenicity leading to difficulties gaining regulatory approval. Recent refinements in production of mini-circle vectors, developed for SB systems, which have minimal expression cassettes and lack the bacterial plasmid backbone, have helped to overcome issues including variable transfection efficiency and toxicity to host cells, associated with plasmid DNA vectors,and when paired with mRNA transposase has helped advance transposons towards the clinic [111]. The TcBuster transposon system from BioTechne is an example which has been developed specifically for CAR-T and CAR-NK production. It comprises a nanoplasmid containing a gene expression cassette paired with mRNA encoding the transposase enzyme. TcBuster delivered a CD19-CAR construct which also expressed EGFP to primary human PB NK and T cells successfully, resulting in CAR expressing NK and T cells which produced significantly more cytokines (IFNγ, TNFα and CD107a degranulation marker) than CAR-negative controls and efficiently killed target CD19 expressing Raji cells [70]. As of November 2023, seven clinical trials investigating CAR-T cells utilising transposon systems are registered on clinicaltrials.gov, indicating the potential for this technology to be applied in CAR-NK production [109].

CRISPR are classes of repeated DNA sequences that act in coordination with CRISPR-associated (Cas) genes. CRISPR technology comprises three main components: crispr-RNA which is complementary to the target gene; the Cas nuclease protein which is an enzyme guided by the crispr-RNA to the specific location on the DNA where it acts like molecular scissors to cut the DNA; and tracer-RNA which helps in processing and binding of the crispr-RNA and Cas nuclease [112]. CRISPR technology has been employed to enhance the cytotoxicity of the NK-92 cell line which has less potent immune functions when compared to primary NK cells [113]. CRISPR engineering with Cas9 ribonucleoproteins (RNP) complexes targeting CD96 and KLRC1 (encoding NKG2A) was delivered by nucleofection to successfully knockout inhibitory CD96 and NKG2A receptors resulting in 2.8% of edited NK-92 cells expressing these receptors compared to 92.5% unedited parental cells. In addition, the authors knocked-in a fluorescent mCherry gene and replaced a silenced promoter to reactivate endogenous CD16 and DNAM-1. The resultant CRISPR-engineered NK-92 cells demonstrated markedly enhanced cytotoxicity compared to unedited NK-92 cells and could mediate ADCC (via CD16) against a range of cancer cell lines including MDA-MB-231 and BT-474 breast cancer cells. This study highlights the potential for CRISPR in engineering to exploit the various NK activating and inhibitory receptors for therapeutic benefit.

Transposons and CRISPR technology may also be used concomitantly to combine powerful genetic editing activity. Indeed, a combination of transposon engineering and CRISPR/Cas9 genome editing was used to generate potent CAR-NK cells expressing the myeloid associated antigen CLL-1 in PB NK cells [71]. The TcBuster transposon system delivered the CLL-1 CAR construct, while CRISPR/Cas9 cargo was applied to knockout the NK cell cytokine checkpoint cytokine inducible SH2-containing protein (CIS, product of the CISH gene). Concurrent CISH knockout in CLL-1 CAR-NK cells were associated with reduced DNAM-1 and increased CD69 expression, reduced expression of NKG2D, NKp30, NKG2A, PD-1 and TIGIT. Enhanced primary AML blast cytotoxicity was observed of both control and CLL-1 CAR-NK cells indicating the potential for these technologies to enhance cytotoxicity and alter NK cell phenotype. Similarly, this CISH knockout approach has been employed in human iPSC-derived NK cells [114], and in CB-derived NK cells [115]; resulting in enhanced in vivo persistence, metabolic fitness and antitumour activity. These studies serve as examples of the potential for non-viral genetic editing but the complexity of the balance between NK activating and inhibitory receptors requires much further study to optimise and exploit this therapeutically.

It is also important to acknowledge the safety and ethical concerns that exist regarding the risk of insertional mutagenesis with gene editing tools including both transposon and CRISPR technology. Transposon genomic integration runs the risk of potential activation of oncogenes or interruptions of tumour-suppressor gene which may contribute to malignant transformation. Although SB transposon systems have demonstrated a good safety profile so far, a clinical trial employing PB engineered donor derived CD19 CAR-T cells resulted in 2 out of 10 patients developing T cell lymphoma derived from the CD19-CAR-T cells [116]. Despite the potential of this technology, further research is required to ensure the safety of transposon systems before progress to the clinic may be achieved. Strategies including the avoidance of strong viral enhancers which may increase the risk of oncogene activation, employment of “safe harbor” sites and site-directed DNA binding domains to enable site-specific transpositions are potential solutions to overcome problems with transposons [109, 117]. In the case of CRISPR, “off-target” DNA cuts may introduce unwanted mutations and potentially exacerbate retrotransposition [118]. Approaches to reduce off-target effects include optimisation of different components of CRISPR-Cas9 systems, development of prime editors and RNA editing [119]. Nevertheless, in November 2023 the UK Medicines and Healthcare Products Regulatory Agency (MHRA) was the first to approve a CRISPR-Cas9 gene editing therapy, Casgevy (exagomglogene autotemcel), for treatment of transfusion-dependent β-thalassemia and sickle cell disease. This landmark approval was followed by the FDA in December of Casgevy and Lyfgenia (lovotibeglogene autotemcel) and European Medicines Agency (EMA) approval of Casgevy [120]. Although patients treated with Casgevy and Lyfgenia are still undergoing long-term evaluation on safety and effectiveness of these treatments, this approval will undoubtedly open the door for further use and approval of CRISPR genome editing technologies.

Non-viral gene delivery to NK cells

Despite the huge potential for non-viral genome editing methods, a major hurdle is the method of intracellular delivery. Ultimately, transposon and CRISPR technologies are comprised of nucleic acids whether this is in DNA or RNA form, and thus require a method of cellular entry. In general, the most common non-viral delivery methods employed are via physical electroporation of naked nucleic acids, or chemical methods involving complexation with lipids, cationic polymers, proteins, or cell penetrating peptides (CPPs) which package nucleic acids and facilitate intracellular delivery, summarised in Fig. 5. Despite success in other cell types, NK cells have proven more difficult to transfect, with disappointing non-viral transfection rates compared to viral transduction. For ex vivo gene delivery, the main barriers to gene delivery are the cell membrane, endosomal entrapment and in the case of DNA, entry to the nucleus [106], for successful gene delivery an ideal delivery vector must overcome each of these barriers while being non-toxic.Fig. 5 Non-viral genetic engineering of “off-the-shelf” CAR-NK cells requires efficient transfection and stable expression of the CAR transgene. 1. Introduction of CAR constructs encoded in DNA and/or mRNA or genetic editing using CRISPR Cas9 or DNA transposon technologies such as PiggyBac and Sleeping Beauty to give stable gene expression. 2. Nucleic acids encoding the CAR construct may be delivered to NK cells via several non-viral delivery strategies including electroporation, lipid nanoparticles, cell penetrating peptides or multifunctional nanoparticles. 3. Following transfection, NK cells expressing the CAR construct are expanded in vitro to produce an “off-the-shelf” CAR-NK product which may be used to treat multiple patients

Electroporation (including nucleofection) is the most widely employed method for non-viral delivery to NK cells with transfection efficiency rates up to 90% [121], but toxicity can be a problem due to the strong electrical field applied to cells and can increase manufacturing timescale and costs. Cell viability has been reported as low as 2% following electroporation of primary NK cells for delivery of a plasmid encoding the reporter gene green fluorescent protein (GFP), although with careful optimisation this was increased to 50%, and some electroporator manufacturers quote viability rates of 80–90% [122, 123]. Nevertheless, these methods require careful optimisation, cytokine stimulation or expansion with feeder cells for adequate transfection efficiency and viability [99, 124]. A small number of studies have utilised non-viral delivery systems as the method of gene delivery for NK cells (summarised in Table 3), resulting in varying degrees of success.Table 3 Summary of non-viral delivery systems for gene delivery to NK cells

Name	Type of delivery system	Details of delivery system components	Cargo	NK cell source	Transfection efficiency	Cell viability	Source	
YSK12-C4	Lipid based “MEND”	Ionisable-cationic lipid containing unsaturated carbon chains: YSK12-C4 lipid (6Z, 9Z, 28Z, 31Z)-19-(4-(dimethylamino)butyl) heptatriaconta-6,9,28,31-tetraen-19-ol)

PEG-DMG: 1,2-dimyristoyl-sn-glycerol methoxyethyleneglycol 2000 ether.

Prepared in 85/15/1 molar ratio of YSK12-C4, cholesterol and PEG-DMG respectively.

	siRNA GAPDH	NK-92 cell line	75%	60%	[125]	
Lipid5/DSPC/

β-sitosterol/ DMG-PEG2K)

	LNP	Ionisable “Lipid 5”, 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), β-sitosterol and 1,2-Dimyristoyl-rac-glycero-methoxypolethelene glycol-2000 (DMG-PEG2K)	mRNA GFP (5moU modified)	KHYG-1 cell line	>80%	>95%	[126]	
CB NK cells	>75%	>95%	
CL1H6	LNP	CL1H6 has the same hydrophilic head group as YSK12-MEND and an oleate structure as a hydrophobic tail, with an amino moiety in place of a methyl group

Prepared in 25/75 ratio CL1H6 and cholesterol.

	siRNA GAPDH	NK-92 & KHYG-1 cell lines	90%	90%	[127]	
CART	LNP	Multiblock oligomers (poly(carbonate)-b-O(α amino ester)s) consisting of ≥1 lipid block and a charge-altering block via ester-to-amide rearrangement of the cationic poly(α amino ester) backbone into neutral small molecules (diketopiperizine).	mRNA GFP (5meC modified)	PB NK (primary)	32%	78%	[128]	
MF-NPs	Magnetic core NPs	Zn/Fe core shell capped with caffeic acid and coated with cationic polydopamine polymer	Plasmid CAR (anti-EGFR)	NK-92MI cell line	60%	98%	[129]	
PAGE	Peptide-mediated	Cas9 fused at N-terminal to HIV TAT peptide (GRKKRRQRRR) and 4x Myc nuclear localisation signals (NLS). 2x SV40 NLS and GFP at C-terminal

Co-delivered with ‘assist peptide’; a TAT-HA2 fusion peptide (RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG)

	CRISPR Cas9	NK-92 cell line	78%	>80%	[130]	

Lipid-based delivery to NK cells

Lipids have been employed in liposomes and lipid nanoparticles (LNP) to deliver nucleic acids for a range of applications, including most significantly, the use of lipid nanoparticles to deliver the mRNA covid vaccine by both BioNTech and Moderna [131]. The approval of these LNP-based vaccines represents a significant breakthrough for the field of non-viral delivery systems and has paved the way for more to follow. Lipids are amphiphilic molecules containing a polar head group linked to a hydrophobic tail and lipids with a range of properties have been employed for gene delivery. Cationic lipids such as 1,2-di-O-octadecenyl-3-trimethylammonium-propane (DOTMA) and its derivative 1,2-dioleoyl-3-trimethylammoium-propane (DOTAP) allow packaging of genetic cargo and intracellular delivery through electrostatic interaction and membrane fusion. Ionisable lipids are neutral at physiological pH which become protonated at low pH in endosomes, facilitating endosomal release of cargo. Other lipids such as 1,2-distearoyl-sn-glycero-phosphocholine (DSPC) and cholesterol analogues have been employed to help stabilise LNP structure [132]. LNPs may be internalised via various endocytic pathways such as macropinocytosis, clathrin-mediated and caveolae-meditated endocytosis and this differs between cell types. Following internalisation, LNPs usually enter the endosomal compartment and require an escape mechanism for cargo release [133]. As a result, combinations of lipids with different properties are often employed to optimise LNP functionality.

Nakamura et al. developed a multifunctional envelope-type nanodevice (MEND) containing an ionisable-cationic lipid to facilitate endosomal escape, termed YSK12-C4 lipid (YSK12-MEND), for delivery of siRNA to immune cell lines [125]. The authors demonstrated the transfection capacity of the YSK12-MEND in a range of human immune cells delivering siRNA encoding GAPDH. Gene silencing in NK-92 cells was 75% which was much higher than commercially available Lipofectamine RNAiMAX at 19% silencing. However, the YSK12-MEND LNP caused cytotoxicity in NK-92 cells (60% viability at 30 nM siRNA dose). The same group recently produced LNPs comprising a pH-sensitive cationic lipid termed CL1H6 for siRNA delivery to NK cell lines [127]. CL1H6 has the same hydrophilic head group as YSK12-MEND and an oleate structure as a hydrophobic tail, with an amino moiety in place of a methyl group, which facilitated cellular uptake and endosomal escape in NK-92 cells via membrane fusion. The ratio of CL1H6 and cholesterol in the LNPs was optimised at 25/75 to give better gene silencing effects (90% gene silencing of GAPDH following delivery of siRNA targeting GAPDH), while maintaining good cell viability (90% viability) in NK-92 cells. Similar results were also reported for delivery to KHYG-1 cells. The authors attribute this improved cell viability to the membrane fusion activity during endosomal escape. YSK12-MEND escapes endosomes with a high degree of membrane fusion, while CL1H6-LNP escaped endosomes with only mild membrane fusion. Similarly, Douka et al. recently optimized LNP formulations for mRNA delivery to NK cells with ionisable lipids [126]. The optimized LNPs comprised ionisable “Lipid 5”, DSPC, β-sitosterol and 1,2-Dimyristoyl-rac-glycero-3-methoxypolyethelene glycol-2000 (DMG-PEG2K) produced > 80% transfection efficiency in the KHYG-1 cell line and 75% in CB derived NK cells, with > 95% cell viability in each cell type.

Wilk et al. present the use of charge-altering releasable transporters (CARTs) for gene delivery to NK cells [128]. CARTs are multiblock oligomers consisting of ≥ 1 lipid block and a charge-altering block designed for mRNA delivery [134]. CARTs are initially cationic to complex anionic nucleic acids but biodegrade to neutral diketopiperazine small molecules under physiological conditions (pH7.4), facilitating release of the anionic cargo. Following transfection with CART delivering 31 ng mRNA encoding GFP to PB NK cells, 32% of cells expressed GFP with 78% viability, which was significantly better than Lipofectamine 2000 (0% GFP+ cells, 90% viability) and electroporation (2% GFP+ cells, 40% viability) (N.B. when the mRNA mass delivered was increased to 10 μg via electroporation transfection efficiency rose to 28% GFP+ cells, with 40% viability). Furthermore, CART successfully generated CD19-CAR-NK cells which were potently cytotoxic against CD19+ Nalm6 cells with 10% dead target cells compared to 5% with naïve NK cells. This demonstrates the potential of CARTs as a non-viral system for CAR-NK generation, but transient mRNA delivery could pose a problem for expansion and efficacy of CAR-NK cells in vivo. Further studies are required to expand this method for larger in vivo studies, assess the lifespan of CART-generated CAR-NK cells in vivo and compare efficacy to virally transduced CAR-NK cells.

Multifunctional nanoparticles for delivery to NK cells

Kim et al. described multifunctional nanoparticles (MF-NPs) comprising a core magnetic Zn/Fe shell, capped with caffeic acid and coated with cationic polydopamine polymer on the surface which form complexes with anionic nucleic acids for CAR delivery to NK-92MI cells [129]. The magnetic core enabled magnetic resonance imaging of NK cells and facilitates in vivo monitoring of cell trafficking. A plasmid encoding an epidermal growth factor receptor (EGFR) CAR construct was delivered by the MF-NPs to NK-92MI cells with a transfection efficiency of 60% and cell viability of 98%. Following tail vein injection of EGFR-CAR-NK-92MI cells to NK cell-free NOG mice (NOD/Shi-scid/IL2Rγnull) mice bearing MDA-MB-231 xenografts, tumour growth was significantly less in the CAR-NK-92MI group compared to mice treated with naïve NK-92MI and PBS control (twofold and 3.5-fold difference in tumour size respectively). Further work would be required to assess the biocompatibility and degradation profile of magnetic based NPs and ensure adequate expansion and persistence of MF-NP edited CAR-NK cells for clinical application.

Peptide-based delivery to NK cells

Peptide-based vectors have gained attention for gene delivery due to advantages including biocompatibility, flexibility and low toxicity [135]. Peptides with a wide range of specific functions have been derived from viruses or designed to mimic viral vector sequences which enable and enhance gene delivery and are generally classified according to function; DNA condensing peptides, CPPs, endosmolytic peptides and nuclear location sequences (NLS). CPPs are short peptides (5–30 amino acids) which efficiently carry macromolecular cargo across the cell membrane, without the need for receptors or other carriers [136]. A peptide-assisted genome editing (PAGE) CRISPR-Cas system has been developed which utilises CPP and endosomal escape peptides for genome editing in myeloid cells, primary T cells and NK-92 cells [137]. A cell penetrating Cas9 was designed which comprised Cas9 fused N-terminally to HIV TAT (GRKKRRQRRR) and 4 × Myc NLS, and C-terminally with 2 × SV40 NLS and GFP. This cell penetrating Cas9 was then co-delivered with an ‘assist peptide’; a fusion peptide (termed TAT-HA2 (RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG)) comprising the CPP TAT peptide derived from HIV-1 and an endosomal escape peptide from influenza A virus hemagglutinin (HA2) protein. The TAT-HA2 assist peptide potentiated Cas9 editing in mCherry+ EL4 T lymphoblast reporter cells from undetectable levels to 85% efficiency with over 80% cell viability. Furthermore, the PAGE system resulted in 78% gene editing in NK-92 cell line, highlighting the potential of CPPs for gene editing in NK cells. However, this is a complex engineering strategy and would require much more development if a CAR construct was to be delivered.

NK cell specific challenges to gene delivery

The current difficulties in non-viral transfection of NK cells are compounded by a lack of understanding of the specific biological barriers in these highly specialised cells and elements which are specific to NK cells much be considered in the design of non-viral delivery systems for NK cell therapies. Cellular uptake is the first biological barrier for gene delivery and NK cells with specialised activating and inhibitory receptors are more complicated than most cell types. Following intracellular uptake, endosomal escape is the first hurdle for successful gene delivery. Considering the specialised lytic machinery of NK cells is important to avoid degradation of genetic cargo in the endosomal/lysosomal compartment. Furthermore, the innate immune activity of NK cells via PRR signaling which facilitates NK anti-viral activity has been cited as a reason for NK cell resistance to viral vectors, and non-viral vectors must be designed to avoid this same fate. Overcoming these NK-specific barriers to gene delivery will be integral for a non-viral gene delivery system is to be successful in NK cell therapies.

Intracellular delivery to NK cells

Endocytosis is thought to be the main uptake pathway for most non-viral gene delivery systems and may be categorised as clathrin-mediated, caveolae-mediated, or micropinocytosis. Uptake may be influenced by factors including properties of the delivery system and the cell type [106, 132]. In the case of NK cells, the balance of activating and inhibitory receptors is regulated by endocytosis and recycling of receptors to the cell surface. For example, inhibitory receptor CD94/NKG2 continuously recycles between the cell surface and intracellular compartments in a process which resembles macropinocytosis [137]. Influenza virus directly infects PBMC-NK cells via clathrin and caveolin-dependent endocytosis [138]. Infection occurs by binding of viral HA protein to α-2,3 and/or α-2,6 linked terminal sialic acids, which are present on the surface of NK cells and specifically on activating receptor NKp46. The interaction of NKp46 with HA on the surface of virus-infected cells is a known mechanism for NK cell recognition and killing of infected target cells, but it appears that the virus itself can also infect NK cells through interaction with NKp46 [139], which results in increased apoptosis of infected NK cells, and decreased NK cytotoxic activity. This knowledge of viral infection methods may be exploited for the design of non-viral delivery systems, in terms of targeting or avoiding specific uptake pathways to enhance gene delivery, without unwanted activation causing phenotypic changes within the NK cells.

Cationic delivery systems, and particularly arginine-rich peptides are known to electrostatically bind to anionic species present on the extracellular surface of the cell membranes (e.g. lipid head groups, heparan sulphate proteoglycans (HSPGs) and syndecans on the cell membrane, initiating cellular uptake [140]. Letoha et al. report that syndecans facilitate uptake of cationic CPPs (e.g., TAT) [141]. The study revealed that syndecan-4 particularly binds and mediates transport of cationic CPPs through the plasma membrane into K562 erythroleukemia cells and higher syndecan-4 levels is correlated with higher transfection efficiency. The amount and size of heparan sulfate chains present on syndecans varies depending on the different stages of cellular differentiation and cell type [142]. Therefore, the expression of syndecans by different cells may lead to varying transfection results. HSPGs and syndecans are expressed by NK cells and have been reported to interact with activating NCRs (NKp30, NKp44 and NKp46) and KIR2DL4 (inhibitory receptor) and modulate their function [143–145]. These receptors can recognise and bind HSPG in trans which are often upregulated in target cells (e.g. cancer cells), but they may also bind with HSPG in cis (on the surface of the NK cells); impacting the function of the NK receptors through masking interactions with target cells or may affect the trafficking of NCRs to intracellular degradation and recycling pathways. If a delivery system binds to HSPG or syndecans for endocytosis, there is a risk that this will trigger unwanted activation of NCRs; impacting the activation status of the NK cells or trigger apoptosis. Therefore, careful design is required to give the best transfection efficiency without perturbing NK receptor status.

Receptor-mediated endocytosis is commonly employed to enhance transfection of gene delivery systems and active targeting strategies may help to overcome problems with HSPG-linked endocytosis. Again, inspiration may be taken from viral vectors when identifying suitable targets for receptor-mediated endocytosis. For example, BaEV lentiviral transduction is mediated by binding with ASCT1 and ASCT2 in freshly isolated human NK cells [105], which could potentially be targeted by non-viral delivery systems.

Endosomal Escape in NK cells

Non-viral delivery systems have been designed to facilitate endosomal escape through the “proton sponge” effect or fusogenic activity in response to low pH in endosomes [146]. However, the exact pH of endosomal compartment can vary depending on cell type, with differences between cell lines and primary cells, and the specific function or cargo content within the endosome [147]. There is little information in the literature regarding NK endosomal pH in the context of designing gene delivery systems. We can compare other immune effector cells such as T cells and macrophages to gain insight into immune cell endosomal characteristics, but this is no substitute for assessing NK cells specifically. Endosomal acidification is reported to be slower and not as robust in human Jurkat T cells (slowly drops from pH 6 to pH 5.2 at 240 min after uptake) compared to the model HeLa human cell line (pH drops to 5.0 within 120 min of uptake) commonly used to evaluate cationic polymers for gene delivery, with primary T cells showing higher endosomal pH (> pH 6) [148]. It has also been reported that early endosomal and recycling endosomes have a neutral pH in macrophages, which promotes the activity of transient receptor potential muclipin 2 (TRPML2); a calcium-permeable cation channel resident in the lysosomal compartment involved in recycling of plasma membrane proteins [149]. TRPML2 is also expressed in CD57+ NKG2C+ NK cells and is speculated to be involved in modulating chemokine secretion in activated NK cells [150]. It could therefore be extrapolated that endosomes in NK cells are also likely to have a higher pH (pH > 6) at least in the early endosomal compartment, but studies are needed to confirm this. When considering NK cell cytotoxic function is exerted primarily through specialised secretory lysosomes, or lytic granules, containing perforin and granzymes [151], it is possible that the presence of this lysosomal machinery may therefore impact on endosomal trafficking and escape following transfection. If the pH of endosomes in NK cells is closer to neutral as with T cells and macrophages, then this could pose a problem for delivery systems requiring a lower pH to trigger endosomal escape and warrants further investigation to optimise the design of delivery systems specific to NK cells.

Avoidance of pattern recognition receptor (PRR) activation in NK cells

During infection, NK cells detect the presence of viral or bacterial pathogen-associated molecular patterns (PAMPs) via PRRs, which are an essential component of the NK-cell mediated innate immune response. NK cells express a wide variety of PRRs including Toll-like receptors (TLR) 1–10, RIG1, NOD2 and MDA5 which are involved in the induction of cytotoxicity when activated [152]. TLR3, 7, 8, are expressed in endosomes and detect double stranded RNA (TLR3), single stranded RNA (TLR7 and 8) and CpG DNA (TLR9). This nucleic acid sensing facilitates virus detection and antiviral immune response [153]. Such PRRs have been cited as one reason for NK resistance to viral-based transduction. Indeed, inhibition of PRR activity resulted in increased transduction efficiency with a VSV-G pseudotyped lentiviral vector in NK cells. The authors pretreated freshly isolated PB NK cells with BX795, an inhibitor of the TBK1/1KKe complex which acts downstream of PRRs RIG-I, MDA5 and TLR3, which resulted in a 3.8-fold increase in lentiviral transduction efficiency. Similar pronounced enhancement of transduction in the presence of BX795 was also observed in the NK-92 cell line [154].

The nucleic acid sensing of PRRs therefore is a barrier to gene delivery to NK cells. Delivery of mRNA or DNA cargo is likely to activate PRRs triggering antiviral NK processes, resulting in poor viability of transfected NK cells. The use of modified mRNAs for genetic cargo may be utilized to avoid recognition of PRRs in NK cells. Substitution of nucleosides has proven to be significant in mitigating PRR detection and improves mRNA translation. Common modifications include uridine replacement with similar nucleosides such as pseudouridine (ψ), or N-1-methyl-pseudouridine (m1ψ), and cytosine can be replaced with 5-methylcytosine [155, 156]. The studies discussed in Sect. "Lipid-based delivery to NK cells" include two examples employing modified mRNA for delivery to NK cells. Douka et al. delivered 5-methoxyuridine (5moU)-modified mRNA with LNPs, while McKinlay et al. delivered 5-methylcytosine-modified mRNA. Neither study commented on their decision to employ modified mRNA or on the reasons for choosing the specific modification. Various substitutions have been employed, particularly within the mRNA vaccine field with pseudouridine-modified mRNA producing superior translation attributed to reduced binding with RNA-dependent protein kinase [157, 158]. Nevertheless, further research is required to define optimal nucleoside modification for CAR delivery to NK cells.

If DNA based cargo is to be delivered, for example in transposon systems, then limiting the CpG content should be considered. In the context of CAR construct delivery, this is particularly important considering the larger size of CAR constructs to be delivered. DNA minicircle technology has been employed in SB transposon systems to help reduce the size of cargo and enhance transfection efficiency. The TcBuster system uses a “nanoplasmid” technology which has been designed specifically for CAR construct delivery to T and NK cells [70].

Conclusion and future directions

In conclusion, this review details a comprehensive analysis of the current state of CAR-NK therapies and non-viral engineering of NK cells, highlighting the potential of CAR-NKs as a promising therapeutic approach in the field of cancer immunotherapy, and challenges which need to be overcome in order to realise that potential. The use of CAR-NK therapies is still at an early stage, but potent anti-tumor activity has been demonstrated in preclinical and early-phase clinical trials across various cancer types. The enhanced safety profile and potential for a more scalable, cost-effective “off-the-shelf” CAR-NK therapy would increase accessibility to patients; improving patient outcomes and quality of life. Development of efficient non-viral engineering strategies specific to NK cells are required to improve manufacturing processes of CAR-NK therapies to support the growing demand for advanced therapeutics. To date, the ideal non-viral delivery system has yet to be developed which efficiently delivers CAR transgenes to NK cells without impacting viability or receptor status of the cell; given how important receptor status is for NK cell functionality. Further investigations into novel delivery systems and clinical trials are warranted to fully unlock the therapeutic potential of CAR-NK cells and translate these findings into routine clinical practice.

Abbreviations

21spe-MLL5 Exon 21 specific mixed lineage leukemia protein-5

ADCC Antibody-dependent cellular cytotoxicity

AICL Activation inducted C-Type Lectin

ALL Acute lymphoblastic leukemia

AML Acute myeloid leukaemia

ASCT Sodium-dependent neutral amino acid transporter

BaEV-LV Baboon envelope pseudotyped lentiviral vector

BCMA B-cell maturation antigen

CAR Chimeric antigen receptor

CART Charge-altering releasable transporter

Cas CRISPR-associated

CB Umbilical cord blood

CD3z CD3 zeta chain

cDC1 Conventional type 1 dendritic cells

CIS Cytokine inducible SH2-containing protein

CLL Chronic lymphocytic leukaemia

CPP Cell penetrating peptide

CRISPR Clustered Regularly Interspaced Short Palindromic Repeats

CRS Cytokine release syndrome

DMG-PEG2K 1,2-Dimyristoyl-rac-glycero-3-methoxypolyethylene glycol-2000

DOTAP 1,2-Dioleoyl-3-trimethylammonium-propane

DOTMA 1,2-Di-O-octadecenyl-3-trimethylammonium propane

DSPC 1,2-Distearoyl-sn-glycero-3-phosphocholine

EBV-LCL Epstein-Barr virus-transformed lymphoblastoid feeder cells

EGFR Epidermal growth factor receptor

EMA European Medicines Agency

FDA U.S. Food and Drug Administration

GAG Glycosaminoglycans

GFP Green fluorescent protein

GPI Glycophosphatidylinositol

GREX Gas-permeable static cell culture flasks

GVHD Graft-versus-host disease

HA Viral hemagglutinin

haNKs High affinity NK92

HDR Homology-directed repair

HER2 Human epidermal growth factor receptor 2

HLA Human leukocyte antigen

HS Heparan sulfate

HSPGs Heparan sulphate proteoglycans

i.p. Intraperitoneal

IFN-γ Interferon-gamma

Ig Immunoglobulin

IgG Immunoglobulin G

IL-2 Interleukin-2

IL-2Rβ Interleukin-2 receptor beta chain

iPSCs Inducible pluripotent stem cells

ITAM Immunoreceptor tyrosine-based activation motif

ITIM Immunoreceptor tyrosine-based inhibitory motifs

ITR Inverted terminal repeat

iwCLL International Workshop on CLL

KIR Killer Ig-like receptors

LBCL Large B-cell lymphoma

LNP Lipid nanoparticles

MCL Mantle cell lymphoma

MEND Multifunctional envelope-type nanodevice

MF-NPs Multifunctional nanoparticles

MHC Major histocompatibility complex

MHRA UK Medicines and Healthcare Products Regulatory Agency

MICA/MICB Major histocompatibility complex class 1 chain-related protein A/B

MM Multiple myeloma

NCR Natural cytotoxicity receptor

NHEJ Non-homologous end joining

NK Natural killer

NLS Nuclear localisation signals

PAGE Peptide-assisted genome editing

PB Peripheral blood

PB PiggyBac

PBMC Peripheral blood mononuclear cells

PCNA Proliferating cell nuclear antigen

PD-1 Programmed cell death protein

PDGF-DD Platelet-derived growth factor-DD

PHA Phytohemagglutinin

PRR Pattern recognition receptor

PVR Poliovirus receptor

r/r Relapsed or refractory

RNP Ribonucleoproteins

SB Sleeping Beauty

scFv Single-chain fragment variable

SLAM Signalling lymphocyte activation molecule

t-haNKs Targeted high affinity NK-92

TAA Tumour associated antigen

taNKs Targeted affinity NK-92

TCR T-cell receptor

TIGIT T-cell immunoglobulin and ITIM domain

TME Tumour microenvironment

TNF-⍺ Tumour necrosis factor-alpha

TOL Toll-like receptor

TRAIL TNF-related apoptosis-inducing ligand

TRPML2 Transient receptor potential muclipin 2

TRUCK T-cells redirected for universal cytokine-mediated killing

TWEAK Tumor necrosis factor-like weak inducer of apoptosis

ULBP UL16 binding protein

VSV-G : Vesicular-stomatitis-virus-G protein

Acknowledgements

None.

Author contributions

EMcE wrote the main manuscript text and prepared all figures, tables and prepared revisions. HMcC proof-read and contributed to manuscript preparation. All authors reviewed the manuscript.

Funding

Not applicable.

Availability of data and materials

No datasets were generated or analysed during the current study.

Declarations

Ethics approval and consent to participate

Not applicable.

Consent for publication

All authors consent to this publication.

Competing interests

The authors declare no competing interests.

Publisher's Note

Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.
==== Refs
References

1. Karakostas P Panoskaltsis N Mantalaris A Georgiadis MC Optimization of CAR T-cell therapies supply chains Comput Chem Eng 2020 139 106913 10.1016/j.compchemeng.2020.106913
Karakostas P, Panoskaltsis N, Mantalaris A, Georgiadis MC. Optimization of CAR T-cell therapies supply chains. Comput Chem Eng. 2020;139: 106913. 10.1016/j.compchemeng.2020.106913.10.1016/j.compchemeng.2020.106913
2. Luginbuehl V Abraham E Kovar K Flaaten R Müller AMS Better by design: what to expect from novel CAR-engineered cell therapies? Biotechnol Adv 2022 58 107917 10.1016/j.biotechadv.2022.107917 35149146
Luginbuehl V, Abraham E, Kovar K, Flaaten R, Müller AMS. Better by design: what to expect from novel CAR-engineered cell therapies? Biotechnol Adv. 2022;58: 107917. 10.1016/j.biotechadv.2022.107917.35149146 10.1016/j.biotechadv.2022.107917
3. Miliotou AN Papadopoulou LC CAR T-cell therapy: a new era in cancer immunotherapy Curr Pharm Biotechnol 2018 19 5 18 10.2174/1389201019666180418095526 29667553
Miliotou AN, Papadopoulou LC. CAR T-cell therapy: a new era in cancer immunotherapy. Curr Pharm Biotechnol. 2018;19:5–18. 10.2174/1389201019666180418095526.29667553 10.2174/1389201019666180418095526
4. Sharma A Singh V Deol A Epidemiology and predictors of 30-day readmission in CAR-T cell therapy recipients Transplant Cell Ther 2023 29 108 e1 108.e7 10.1016/j.jtct.2022.11.004
Sharma A, Singh V, Deol A. Epidemiology and predictors of 30-day readmission in CAR-T cell therapy recipients. Transplant Cell Ther. 2023;29(108):e1-108.e7. 10.1016/j.jtct.2022.11.004.10.1016/j.jtct.2022.11.004
5. Lin C-Y Gobius I Souza-Fonseca-Guimaraes F Natural killer cell engineering—a new hope for cancer immunotherapy Semin Hematol 2020 57 194 200 10.1053/j.seminhematol.2020.10.002 33256912
Lin C-Y, Gobius I, Souza-Fonseca-Guimaraes F. Natural killer cell engineering—a new hope for cancer immunotherapy. Semin Hematol. 2020;57:194–200. 10.1053/j.seminhematol.2020.10.002.33256912 10.1053/j.seminhematol.2020.10.002
6. The Food and Drug Administration, Approved cellular and gene therapy products, n.d. https://www.fda.gov/vaccines-blood-biologics/cellular-gene-therapy-products/approved-cellular-and-gene-therapy-products. Accessed 5 May 2023.
7. Boettcher M Joechner A Li Z Yang SF Schlegel P Development of CAR T cell therapy in children—a comprehensive overview J Clin Med 2022 10.3390/jcm11082158 35456250
Boettcher M, Joechner A, Li Z, Yang SF, Schlegel P. Development of CAR T cell therapy in children—a comprehensive overview. J Clin Med. 2022. 10.3390/jcm11082158.35456250 10.3390/jcm11082158
8. Srivastava S Riddell SR CAR T cell therapy: challenges to bench-to-bedside efficacy J Immunol 2018 200 459 468 10.4049/jimmunol.1701155 29311388
Srivastava S, Riddell SR. CAR T cell therapy: challenges to bench-to-bedside efficacy. J Immunol. 2018;200:459–68.29311388 10.4049/jimmunol.1701155
9. Brentjens RJ Davila ML Riviere I Park J Wang X Cowell LG Bartido S Stefanski J Taylor C Olszewska M Borquez-Ojeda O Qu J Wasielewska T He Q Bernal Y Rijo IV Hedvat C Kobos R Curran K Steinherz P Jurcic J Rosenblat T Maslak P Frattini M Sadelain M CD19-targeted T cells rapidly induce molecular remissions in adults with chemotherapy-refractory acute lymphoblastic leukemia Sci Transl Med 2013 5 177ra38 10.1126/scitranslmed.3005930 23515080
Brentjens RJ, Davila ML, Riviere I, Park J, Wang X, Cowell LG, Bartido S, Stefanski J, Taylor C, Olszewska M, Borquez-Ojeda O, Qu J, Wasielewska T, He Q, Bernal Y, Rijo IV, Hedvat C, Kobos R, Curran K, Steinherz P, Jurcic J, Rosenblat T, Maslak P, Frattini M, Sadelain M. CD19-targeted T cells rapidly induce molecular remissions in adults with chemotherapy-refractory acute lymphoblastic leukemia. Sci Transl Med. 2013;5:177ra38.23515080 10.1126/scitranslmed.3005930
10. Porter DL Hwang W-T Frey NV Lacey SF Shaw PA Loren AW Bagg A Marcucci KT Shen A Gonzalez V Ambrose D Grupp SA Chew A Zheng Z Milone MC Levine BL Melenhorst JJ June CH Chimeric antigen receptor T cells persist and induce sustained remissions in relapsed refractory chronic lymphocytic leukemia Sci Transl Med 2015 7 303ra139 10.1126/scitranslmed.aac5415 26333935
Porter DL, Hwang W-T, Frey NV, Lacey SF, Shaw PA, Loren AW, Bagg A, Marcucci KT, Shen A, Gonzalez V, Ambrose D, Grupp SA, Chew A, Zheng Z, Milone MC, Levine BL, Melenhorst JJ, June CH. Chimeric antigen receptor T cells persist and induce sustained remissions in relapsed refractory chronic lymphocytic leukemia. Sci Transl Med. 2015;7:303ra139.26333935 10.1126/scitranslmed.aac5415
11. Lee DW Kochenderfer JN Stetler-Stevenson M Cui YK Delbrook C Feldman SA Fry TJ Orentas R Sabatino M Shah NN Steinberg SM Stroncek D Tschernia N Yuan C Zhang H Zhang L Rosenberg SA Wayne AS Mackall CL T cells expressing CD19 chimeric antigen receptors for acute lymphoblastic leukaemia in children and young adults: A phase 1 dose-escalation trial The Lancet 2015 385 517 528 10.1016/S0140-6736(14)61403-3
Lee DW, Kochenderfer JN, Stetler-Stevenson M, Cui YK, Delbrook C, Feldman SA, Fry TJ, Orentas R, Sabatino M, Shah NN, Steinberg SM, Stroncek D, Tschernia N, Yuan C, Zhang H, Zhang L, Rosenberg SA, Wayne AS, Mackall CL. T cells expressing CD19 chimeric antigen receptors for acute lymphoblastic leukaemia in children and young adults: A phase 1 dose-escalation trial. The Lancet. 2015;385:517–28. 10.1016/S0140-6736(14)61403-3.10.1016/S0140-6736(14)61403-3
12. U.S. Food and Drug Administration, Approved Cellular and Gene Therpay Products: Kymriah (tisagenlecleucel), 2022. https://www.fda.gov/vaccines-blood-biologics/cellular-gene-therapy-products/kymriah-tisagenlecleucel. Accessed 2 Nov 2023.
13. Zettler M Nabhan C Total costs of chimeric antigen receptor T-cell immunotherapy JAMA Oncol 2018 4 993 994 10.1001/jamaoncol.2018.0610 29801111
Zettler M, Nabhan C. Total costs of chimeric antigen receptor T-cell immunotherapy. JAMA Oncol. 2018;4:993–4. 10.1001/jamaoncol.2018.0610.29801111 10.1001/jamaoncol.2018.0610
14. U.S. Food and Drug Administration, Approved Cellular and Gene Therapy Products: Yescarta (axicabtagene ciloleucel), 2022. https://www.fda.gov/vaccines-blood-biologics/cellular-gene-therapy-products/yescarta-axicabtagene-ciloleucel. Accessed 2 Nov 2023.
15. U.S. Food and Drug Administration, Approved Cellular and Gene Therapy Products: Tecartus (brexucabtagene autoleucel), 2022. https://www.fda.gov/vaccines-blood-biologics/cellular-gene-therapy-products/tecartus-brexucabtagene-autoleucel. Accessed 2 Nov 2023.
16. Conduent Clinical Services, New Drug Fact Blast: Abecma, 2021.
17. U.S. Food and Drug Administration, Approved Cellular and Gene Therapy Products: Abecma (idecabtagene vicleucel), 2021. https://www.fda.gov/vaccines-blood-biologics/abecma-idecabtagene-vicleucel. Accessed 2 Nov 2023.
18. U.S. Food and Drug Administration, Approved Cellular and Gene Therapy Products: Breyanzi (lisocabtagene maraleucel), 2022. https://www.fda.gov/vaccines-blood-biologics/cellular-gene-therapy-products/breyanzi-lisocabtagene-maraleucel. Accessed 2 Nov 2023.
19. U.S. Food and Drug Administration, Vaccines, Blood and Biologics: Carvykti, (2023). https://www.fda.gov/vaccines-blood-biologics/carvykti. Accessed 2 Nov 2023.
20. Maude SL Laetsch TW Buechner J Rives S Boyer M Bittencourt H Bader P Verneris MR Stefanski HE Myers GD Qayed M De Moerloose B Hiramatsu H Schlis K Davis KL Martin PL Nemecek ER Yanik GA Peters C Baruchel A Boissel N Mechinaud F Balduzzi A Krueger J June CH Levine BL Wood P Taran T Leung M Mueller KT Zhang Y Sen K Lebwohl D Pulsipher MA Grupp SA Tisagenlecleucel in children and young adults with B-cell lymphoblastic leukemia N Engl J Med 2018 378 439 448 10.1056/nejmoa1709866 29385370
Maude SL, Laetsch TW, Buechner J, Rives S, Boyer M, Bittencourt H, Bader P, Verneris MR, Stefanski HE, Myers GD, Qayed M, De Moerloose B, Hiramatsu H, Schlis K, Davis KL, Martin PL, Nemecek ER, Yanik GA, Peters C, Baruchel A, Boissel N, Mechinaud F, Balduzzi A, Krueger J, June CH, Levine BL, Wood P, Taran T, Leung M, Mueller KT, Zhang Y, Sen K, Lebwohl D, Pulsipher MA, Grupp SA. Tisagenlecleucel in children and young adults with B-cell lymphoblastic leukemia. N Engl J Med. 2018;378:439–48. 10.1056/nejmoa1709866.29385370 10.1056/nejmoa1709866
21. Wrona E Borowiec M Potemski P CAR-NK cells in the treatment of solid tumors Int J Mol Sci 2021 22 1 19 10.3390/ijms22115899
Wrona E, Borowiec M, Potemski P. CAR-NK cells in the treatment of solid tumors. Int J Mol Sci. 2021;22:1–19. 10.3390/ijms22115899.10.3390/ijms22115899
22. Pan K Farrukh H Chittepu VCSR Xu H XianPan C Zhu Z CAR race to cancer immunotherapy: from CAR T CAR NK to CAR macrophage therapy J Exp Clin Cancer Res 2022 41 1 21 10.1186/s13046-022-02327-z 34980222
Pan K, Farrukh H, Chittepu VCSR, Xu H, XianPan C, Zhu Z. CAR race to cancer immunotherapy: from CAR T CAR NK to CAR macrophage therapy. J Exp Clin Cancer Res. 2022;41:1–21. 10.1186/s13046-022-02327-z.34980222 10.1186/s13046-022-02327-z
23. Stabile H Fionda C Gismondi A Santoni A Role of distinct natural killer cell subsets in anticancer response Front Immunol 2017 8 1 8 10.3389/fimmu.2017.00293 28149297
Stabile H, Fionda C, Gismondi A, Santoni A. Role of distinct natural killer cell subsets in anticancer response. Front Immunol. 2017;8:1–8. 10.3389/fimmu.2017.00293.28149297 10.3389/fimmu.2017.00293
24. Lee DA Cellular therapy: adoptive immunotherapy with expanded natural killer cells Immunol Rev 2019 290 85 99 10.1111/imr.12793 31355489
Lee DA. Cellular therapy: adoptive immunotherapy with expanded natural killer cells. Immunol Rev. 2019;290:85–99. 10.1111/imr.12793.31355489 10.1111/imr.12793
25. Biassoni R Malnati MS Human natural killer receptors, co-receptors, and their ligands Curr Protoc Immunol 2018 10.1002/cpim.47 30040219
Biassoni R, Malnati MS. Human natural killer receptors, co-receptors, and their ligands. Curr Protoc Immunol. 2018. 10.1002/cpim.47.30040219 10.1002/cpim.47
26. Wensveen FM Jelenčić V Polić B NKG2D: a master regulator of immune cell responsiveness Front Immunol 2018 10.3389/fimmu.2018.00441 30555492
Wensveen FM, Jelenčić V, Polić B. NKG2D: a master regulator of immune cell responsiveness. Front Immunol. 2018. 10.3389/fimmu.2018.00441.30555492 10.3389/fimmu.2018.00441
27. Pende D Falco M Vitale M Cantoni C Vitale C Munari E Bertaina A Moretta F Del Zotto G Pietra G Mingari MC Locatelli F Moretta L Killer Ig-like receptors (KIRs): their role in NK cell modulation and developments leading to their clinical exploitation Front Immunol 2019 10.3389/fimmu.2019.01179 31447858
Pende D, Falco M, Vitale M, Cantoni C, Vitale C, Munari E, Bertaina A, Moretta F, Del Zotto G, Pietra G, Mingari MC, Locatelli F, Moretta L. Killer Ig-like receptors (KIRs): their role in NK cell modulation and developments leading to their clinical exploitation. Front Immunol. 2019. 10.3389/fimmu.2019.01179.31447858 10.3389/fimmu.2019.01179
28. Xie G Dong H Liang Y Ham JD Rizwan R Chen J CAR-NK cells: a promising cellular immunotherapy for cancer EBioMedicine 2020 10.1016/j.ebiom.2020.102975 33310681
Xie G, Dong H, Liang Y, Ham JD, Rizwan R, Chen J. CAR-NK cells: a promising cellular immunotherapy for cancer. EBioMedicine. 2020. 10.1016/j.ebiom.2020.102975.33310681 10.1016/j.ebiom.2020.102975
29. Cherif B Triki H Charfi S Bouzidi L Ben Kridis W Khanfir A Chaabane K Sellami-Boudawara T Rebai A Immune checkpoint molecules B7–H6 and PD-L1 co-pattern the tumor inflammatory microenvironment in human breast cancer Sci Rep 2021 11 1 13 10.1038/s41598-021-87216-9 33414495
Cherif B, Triki H, Charfi S, Bouzidi L, Ben Kridis W, Khanfir A, Chaabane K, Sellami-Boudawara T, Rebai A. Immune checkpoint molecules B7–H6 and PD-L1 co-pattern the tumor inflammatory microenvironment in human breast cancer. Sci Rep. 2021;11:1–13. 10.1038/s41598-021-87216-9.33414495 10.1038/s41598-021-87216-9
30. Buller CW Mathew PA Mathew SO Roles of nk cell receptors 2b4 (Cd244), cs1 (cd319), and llt1 (clec2d) in cancer Cancers (Basel) 2020 12 1 15 10.3390/cancers12071755
Buller CW, Mathew PA, Mathew SO. Roles of nk cell receptors 2b4 (Cd244), cs1 (cd319), and llt1 (clec2d) in cancer. Cancers (Basel). 2020;12:1–15. 10.3390/cancers12071755.10.3390/cancers12071755
31. Vivier E Raulet DH Moretta A Caligiuri MA Zitvogel L Lanier LL Yokoyama WM Ugolini S Innate or adaptive immunity? The example of natural killer cells Science 1979 331 2011 44 49 10.1126/science.1198687
Vivier E, Raulet DH, Moretta A, Caligiuri MA, Zitvogel L, Lanier LL, Yokoyama WM, Ugolini S. Innate or adaptive immunity? The example of natural killer cells. Science. 1979;331(2011):44–9. 10.1126/science.1198687.10.1126/science.1198687
32. Wang F Hou H Wu S Tang Q Liu W Huang M Yin B Huang J Mao L Lu Y Sun Z TIGIT expression levels on human NK cells correlate with functional heterogeneity among healthy individuals Eur J Immunol 2015 45 2886 2897 10.1002/eji.201545480 26171588
Wang F, Hou H, Wu S, Tang Q, Liu W, Huang M, Yin B, Huang J, Mao L, Lu Y, Sun Z. TIGIT expression levels on human NK cells correlate with functional heterogeneity among healthy individuals. Eur J Immunol. 2015;45:2886–97. 10.1002/eji.201545480.26171588 10.1002/eji.201545480
33. Müller T Uherek C Maki G Chow KU Schimpf A Klingemann HG Tonn T Wels WS Expression of a CD20-specific chimeric antigen receptor enhances cytotoxic activity of NK cells and overcomes NK-resistance of lymphoma and leukemia cells Cancer Immunol Immunother 2008 57 411 423 10.1007/s00262-007-0383-3 17717662
Müller T, Uherek C, Maki G, Chow KU, Schimpf A, Klingemann HG, Tonn T, Wels WS. Expression of a CD20-specific chimeric antigen receptor enhances cytotoxic activity of NK cells and overcomes NK-resistance of lymphoma and leukemia cells. Cancer Immunol Immunother. 2008;57:411–23. 10.1007/s00262-007-0383-3.17717662 10.1007/s00262-007-0383-3
34. Screpanti V Wallin RPA Grandien A Ljunggren HG Impact of FASL-induced apoptosis in the elimination of tumor cells by NK cells Mol Immunol 2005 42 495 499 10.1016/j.molimm.2004.07.033 15607805
Screpanti V, Wallin RPA, Grandien A, Ljunggren HG. Impact of FASL-induced apoptosis in the elimination of tumor cells by NK cells. Mol Immunol. 2005;42:495–9. 10.1016/j.molimm.2004.07.033.15607805 10.1016/j.molimm.2004.07.033
35. Prager I Watzl C Mechanisms of natural killer cell-mediated cellular cytotoxicity J Leukoc Biol 2019 105 1319 1329 10.1002/JLB.MR0718-269R 31107565
Prager I, Watzl C. Mechanisms of natural killer cell-mediated cellular cytotoxicity. J Leukoc Biol. 2019;105:1319–29. 10.1002/JLB.MR0718-269R.31107565 10.1002/JLB.MR0718-269R
36. Wang R Jaw JJ Stutzman NC Zou Z Sun PD Natural killer cell-produced IFN-γ and TNF-α induce target cell cytolysis through up-regulation of ICAM-1 J Leukoc Biol 2012 91 299 309 10.1189/jlb.0611308 22045868
Wang R, Jaw JJ, Stutzman NC, Zou Z, Sun PD. Natural killer cell-produced IFN-γ and TNF-α induce target cell cytolysis through up-regulation of ICAM-1. J Leukoc Biol. 2012;91:299–309. 10.1189/jlb.0611308.22045868 10.1189/jlb.0611308
37. Fauriat C Long EO Ljunggren HG Bryceson YT Regulation of human NK-cell cytokine and chemokine production by target cell recognition Blood 2010 115 2167 2176 10.1182/blood-2009-08-238469 19965656
Fauriat C, Long EO, Ljunggren HG, Bryceson YT. Regulation of human NK-cell cytokine and chemokine production by target cell recognition. Blood. 2010;115:2167–76. 10.1182/blood-2009-08-238469.19965656 10.1182/blood-2009-08-238469
38. Capuano C Pighi C Battella S De Federicis D Galandrini R Palmieri G Harnessing CD16-mediated NK cell functions to enhance therapeutic efficacy of tumor-targeting mAbs Cancers (Basel) 2021 10.3390/cancers13102500 34439368
Capuano C, Pighi C, Battella S, De Federicis D, Galandrini R, Palmieri G. Harnessing CD16-mediated NK cell functions to enhance therapeutic efficacy of tumor-targeting mAbs. Cancers (Basel). 2021. 10.3390/cancers13102500.34439368 10.3390/cancers13102500
39. Liu S Galat V Galat Y Lee YKA Wainwright D Wu J NK cell-based cancer immunotherapy: from basic biology to clinical development J Hematol Oncol 2021 10.1186/s13045-020-01014-w 34930377
Liu S, Galat V, Galat Y, Lee YKA, Wainwright D, Wu J. NK cell-based cancer immunotherapy: from basic biology to clinical development. J Hematol Oncol. 2021. 10.1186/s13045-020-01014-w.34930377 10.1186/s13045-020-01014-w
40. Gust J Ponce R Liles WC Garden GA Turtle CJ Cytokines in CAR T cell-associated neurotoxicity Front Immunol 2020 10.3389/fimmu.2020.577027 33391257
Gust J, Ponce R, Liles WC, Garden GA, Turtle CJ. Cytokines in CAR T cell-associated neurotoxicity. Front Immunol. 2020. 10.3389/fimmu.2020.577027.33391257 10.3389/fimmu.2020.577027
41. Klingemann H Are natural killer cells superior CAR drivers? Oncoimmunology 2014 10.4161/onci.28147 25340009
Klingemann H. Are natural killer cells superior CAR drivers? Oncoimmunology. 2014. 10.4161/onci.28147.25340009 10.4161/onci.28147
42. Marin D Li Y Basar R Rafei H Daher M Dou J Mohanty V Dede M Nieto Y Uprety N Acharya S Liu E Wilson J Banerjee P Macapinlac HA Ganesh C Thall PF Bassett R Ammari M Rao S Cao K Shanley M Kaplan M Hosing C Kebriaei P Nastoupil LJ Flowers CR Moseley SM Lin P Ang S Popat UR Qazilbash MH Champlin RE Chen K Shpall EJ Rezvani K Safety, efficacy and determinants of response of allogeneic CD19-specific CAR-NK cells in CD19+ B cell tumors: a phase 1/2 trial Nat Med 2024 10.1038/s41591-023-02785-8 38238616
Marin D, Li Y, Basar R, Rafei H, Daher M, Dou J, Mohanty V, Dede M, Nieto Y, Uprety N, Acharya S, Liu E, Wilson J, Banerjee P, Macapinlac HA, Ganesh C, Thall PF, Bassett R, Ammari M, Rao S, Cao K, Shanley M, Kaplan M, Hosing C, Kebriaei P, Nastoupil LJ, Flowers CR, Moseley SM, Lin P, Ang S, Popat UR, Qazilbash MH, Champlin RE, Chen K, Shpall EJ, Rezvani K. Safety, efficacy and determinants of response of allogeneic CD19-specific CAR-NK cells in CD19+ B cell tumors: a phase 1/2 trial. Nat Med. 2024. 10.1038/s41591-023-02785-8.38238616 10.1038/s41591-023-02785-8
43. Ebrahimiyan H Tamimi A Shokoohian B Minaei N Memarnejadian A Hossein-Khannazer N Hassan M Vosough M Novel insights in CAR-NK cells beyond CAR-T cell technology; promising advantages Int Immunopharmacol 2022 10.1016/j.intimp.2022.108587 35149294
Ebrahimiyan H, Tamimi A, Shokoohian B, Minaei N, Memarnejadian A, Hossein-Khannazer N, Hassan M, Vosough M. Novel insights in CAR-NK cells beyond CAR-T cell technology; promising advantages. Int Immunopharmacol. 2022. 10.1016/j.intimp.2022.108587.35149294 10.1016/j.intimp.2022.108587
44. Sivori S Vacca P Del Zotto G Munari E Mingari MC Moretta L Human NK cells: surface receptors, inhibitory checkpoints, and translational applications Cell Mol Immunol 2019 16 430 441 10.1038/s41423-019-0206-4 30778167
Sivori S, Vacca P, Del Zotto G, Munari E, Mingari MC, Moretta L. Human NK cells: surface receptors, inhibitory checkpoints, and translational applications. Cell Mol Immunol. 2019;16:430–41. 10.1038/s41423-019-0206-4.30778167 10.1038/s41423-019-0206-4
45. Fang Y Zhu Y Kramer A Chen Y Li YR Yang L Graft-versus-host disease modulation by innate T cells Int J Mol Sci 2023 10.3390/ijms24044084 38203566
Fang Y, Zhu Y, Kramer A, Chen Y, Li YR, Yang L. Graft-versus-host disease modulation by innate T cells. Int J Mol Sci. 2023. 10.3390/ijms24044084.38203566 10.3390/ijms24044084
46. Baghery Saghchy Khorasani A Yousefi AM Bashash D CAR NK cell therapy in hematologic malignancies and solid tumors; obstacles and strategies to overcome the challenges Int Immunopharmacol 2022 110 109041 10.1016/j.intimp.2022.109041 35839565
Baghery Saghchy Khorasani A, Yousefi AM, Bashash D. CAR NK cell therapy in hematologic malignancies and solid tumors; obstacles and strategies to overcome the challenges. Int Immunopharmacol. 2022;110:109041. 10.1016/j.intimp.2022.109041.35839565 10.1016/j.intimp.2022.109041
47. Zhang C Oberoi P Oelsner S Waldmann A Lindner A Tonn T Wels WS Chimeric antigen receptor-engineered NK-92 cells: an off-the-shelf cellular therapeutic for targeted elimination of cancer cells and induction of protective antitumor immunity Front Immunol 2017 10.3389/fimmu.2017.00533 29422892
Zhang C, Oberoi P, Oelsner S, Waldmann A, Lindner A, Tonn T, Wels WS. Chimeric antigen receptor-engineered NK-92 cells: an off-the-shelf cellular therapeutic for targeted elimination of cancer cells and induction of protective antitumor immunity. Front Immunol. 2017. 10.3389/fimmu.2017.00533.29422892 10.3389/fimmu.2017.00533
48. Lamers-Kok N, Panella D, Georgoudaki AM, Liu H, Özkazanc D, Kučerová L, Duru AD, Spanholtz J, Raimo M, Natural killer cells in clinical development as non-engineered, engineered, and combination therapies, J Hematol Oncol 2022. 10.1186/s13045-022-01382-5.
49. Klingemann H Challenges of cancer therapy with natural killer cells Cytotherapy 2015 17 245 249 10.1016/j.jcyt.2014.09.007 25533934
Klingemann H. Challenges of cancer therapy with natural killer cells. Cytotherapy. 2015;17:245–9. 10.1016/j.jcyt.2014.09.007.25533934 10.1016/j.jcyt.2014.09.007
50. Vormittag P Gunn R Ghorashian S Veraitch FS A guide to manufacturing CAR T cell therapies Curr Opin Biotechnol 2018 53 164 181 10.1016/j.copbio.2018.01.025 29462761
Vormittag P, Gunn R, Ghorashian S, Veraitch FS. A guide to manufacturing CAR T cell therapies. Curr Opin Biotechnol. 2018;53:164–81. 10.1016/j.copbio.2018.01.025.29462761 10.1016/j.copbio.2018.01.025
51. Klingemann H Boissel L Toneguzzo F Natural killer cells for immunotherapy—advantages of the NK-92 cell line over blood NK cells Front Immunol 2016 7 1 7 10.3389/fimmu.2016.00091 26834743
Klingemann H, Boissel L, Toneguzzo F. Natural killer cells for immunotherapy—advantages of the NK-92 cell line over blood NK cells. Front Immunol. 2016;7:1–7. 10.3389/fimmu.2016.00091.26834743 10.3389/fimmu.2016.00091
52. Zhang Y Zhou W Yang J Yang J Wang W Chimeric antigen receptor engineered natural killer cells for cancer therapy Exp Hematol Oncol 2023 10.1186/s40164-023-00431-0 38037159
Zhang Y, Zhou W, Yang J, Yang J, Wang W. Chimeric antigen receptor engineered natural killer cells for cancer therapy. Exp Hematol Oncol. 2023. 10.1186/s40164-023-00431-0.38037159 10.1186/s40164-023-00431-0
53. Kloess S Kretschmer A Stahl L Fricke S Koehl U CAR-Expressing natural killer cells for cancer retargeting Transfus Med Hemother 2019 46 4 13 10.1159/000495771 31244577
Kloess S, Kretschmer A, Stahl L, Fricke S, Koehl U. CAR-Expressing natural killer cells for cancer retargeting. Transfus Med Hemother. 2019;46:4–13. 10.1159/000495771.31244577 10.1159/000495771
54. Wang K Wang L Wang Y Xiao L Wei J Hu Y Wang D Huang H Reprogramming natural killers for cancer therapy Mol Ther 2024 10.1016/j.ymthe.2024.01.027 39245939
Wang K, Wang L, Wang Y, Xiao L, Wei J, Hu Y, Wang D, Huang H. Reprogramming natural killers for cancer therapy. Mol Ther. 2024. 10.1016/j.ymthe.2024.01.027.39245939 10.1016/j.ymthe.2024.01.027
55. Morimoto T Nakazawa T Maeoka R Nakagawa I Tsujimura T Matsuda R Natural killer cell-based immunotherapy against glioblastoma Int J Mol Sci 2023 10.3390/ijms24032111 38069242
Morimoto T, Nakazawa T, Maeoka R, Nakagawa I, Tsujimura T, Matsuda R. Natural killer cell-based immunotherapy against glioblastoma. Int J Mol Sci. 2023. 10.3390/ijms24032111.38069242 10.3390/ijms24032111
56. Liu E Marin D Banerjee P Macapinlac HA Thompson P Basar R Nassif Kerbauy L Overman B Thall P Kaplan M Nandivada V Kaur I Nunez Cortes A Cao K Daher M Hosing C Cohen EN Kebriaei P Mehta R Neelapu S Nieto Y Wang M Wierda W Keating M Champlin R Shpall EJ Rezvani K Use of CAR-transduced natural killer cells in CD19-positive lymphoid tumors N Engl J Med 2020 382 545 553 10.1056/nejmoa1910607 32023374
Liu E, Marin D, Banerjee P, Macapinlac HA, Thompson P, Basar R, Nassif Kerbauy L, Overman B, Thall P, Kaplan M, Nandivada V, Kaur I, Nunez Cortes A, Cao K, Daher M, Hosing C, Cohen EN, Kebriaei P, Mehta R, Neelapu S, Nieto Y, Wang M, Wierda W, Keating M, Champlin R, Shpall EJ, Rezvani K. Use of CAR-transduced natural killer cells in CD19-positive lymphoid tumors. N Engl J Med. 2020;382:545–53. 10.1056/nejmoa1910607.32023374 10.1056/nejmoa1910607
57. Hallek M Cheson BD Catovsky D Caligaris-Cappio F Dighiero G Hillmen P Keating M Montserrat E Chiorazzi N Stilgenbauer S Rai KR Byrd JC Eichhorst B Robak T Seymour JF Kipps TJ Special Report iwCLL guidelines for diagnosis, indications for treatment, response assessment, and supportive management of CLL Blood 2018 131 2745 2760 10.1182/blood-2017-09-806398 29540348
Hallek M, Cheson BD, Catovsky D, Caligaris-Cappio F, Dighiero G, Hillmen P, Keating M, Montserrat E, Chiorazzi N, Stilgenbauer S, Rai KR, Byrd JC, Eichhorst B, Robak T, Seymour JF, Kipps TJ. Special Report iwCLL guidelines for diagnosis, indications for treatment, response assessment, and supportive management of CLL. Blood. 2018;131:2745–60.29540348 10.1182/blood-2017-09-806398
58. Cheson BD Fisher RI Barrington SF Cavalli F Schwartz LH Zucca E Lister TA Recommendations for initial evaluation, staging, and response assessment of hodgkin and non-hodgkin lymphoma: the lugano classification J Clin Oncol 2014 32 3059 3067 10.1200/JCO.2013.54.8800 25113753
Cheson BD, Fisher RI, Barrington SF, Cavalli F, Schwartz LH, Zucca E, Lister TA. Recommendations for initial evaluation, staging, and response assessment of hodgkin and non-hodgkin lymphoma: the lugano classification. J Clin Oncol. 2014;32:3059–67. 10.1200/JCO.2013.54.8800.25113753 10.1200/JCO.2013.54.8800
59. Burger MC Forster M-T Romanski A Straßheimer F Macas J Zeiner PS Steidl E Herkt S Weber KJ Schupp J Lun JH Strecker MI Wlotzka K Cakmak P Opitz C George R Mildenberger IC Nowakowska P Zhang C Röder J Müller E Ihrig K Langen K-J Rieger MA Herrmann E Bönig H Harter PN Reiss Y Hattingen E Rödel F Plate KH Tonn T Senft C Steinbach JP Wels WS Intracranial injection of NK cells engineered with a HER2-targeted chimeric antigen receptor in patients with recurrent glioblastoma Neurol Oncol 2023 10.1093/neuonc/noad087/7155851
Burger MC, Forster M-T, Romanski A, Straßheimer F, Macas J, Zeiner PS, Steidl E, Herkt S, Weber KJ, Schupp J, Lun JH, Strecker MI, Wlotzka K, Cakmak P, Opitz C, George R, Mildenberger IC, Nowakowska P, Zhang C, Röder J, Müller E, Ihrig K, Langen K-J, Rieger MA, Herrmann E, Bönig H, Harter PN, Reiss Y, Hattingen E, Rödel F, Plate KH, Tonn T, Senft C, Steinbach JP, Wels WS. Intracranial injection of NK cells engineered with a HER2-targeted chimeric antigen receptor in patients with recurrent glioblastoma. Neurol Oncol. 2023. 10.1093/neuonc/noad087/7155851.10.1093/neuonc/noad087/7155851
60. Wu X Matosevic S Gene-edited and CAR-NK cells: opportunities and challenges with engineering of NK cells for immunotherapy Mol Ther Oncolytics 2022 27 224 238 10.1016/j.omto.2022.10.011 36420307
Wu X, Matosevic S. Gene-edited and CAR-NK cells: opportunities and challenges with engineering of NK cells for immunotherapy. Mol Ther Oncolytics. 2022;27:224–38. 10.1016/j.omto.2022.10.011.36420307 10.1016/j.omto.2022.10.011
61. Zhang L Meng Y Feng X Han Z CAR-NK cells for cancer immunotherapy: from bench to bedside Biomark Res 2022 10 1 19 10.1186/s40364-022-00364-6 35000618
Zhang L, Meng Y, Feng X, Han Z. CAR-NK cells for cancer immunotherapy: from bench to bedside. Biomark Res. 2022;10:1–19. 10.1186/s40364-022-00364-6.35000618 10.1186/s40364-022-00364-6
62. Wang Y Xu H Zheng X Wei H Sun R Tian Z High expression of NKG2A/CD94 and low expression of granzyme B are associated with reduced cord blood NK cell activity Cell Mol Immunol 2007 4 377 382 17976318
Wang Y, Xu H, Zheng X, Wei H, Sun R, Tian Z. High expression of NKG2A/CD94 and low expression of granzyme B are associated with reduced cord blood NK cell activity. Cell Mol Immunol. 2007;4:377–82.17976318
63. Mehta RS Shpall EJ Rezvani K Cord blood as a source of natural killer cells Front Med (Lausanne) 2015 2 1 10 10.3389/fmed.2015.00093 25654080
Mehta RS, Shpall EJ, Rezvani K. Cord blood as a source of natural killer cells. Front Med (Lausanne). 2015;2:1–10. 10.3389/fmed.2015.00093.25654080 10.3389/fmed.2015.00093
64. Heipertz EL Zynda ER Stav-Noraas TE Hungler AD Boucher SE Kaur N Vemuri MC Current perspectives on “Off-The-Shelf” allogeneic NK and CAR-NK cell therapies Front Immunol 2021 10.3389/fimmu.2021.732135 34925314
Heipertz EL, Zynda ER, Stav-Noraas TE, Hungler AD, Boucher SE, Kaur N, Vemuri MC. Current perspectives on “Off-The-Shelf” allogeneic NK and CAR-NK cell therapies. Front Immunol. 2021. 10.3389/fimmu.2021.732135.34925314 10.3389/fimmu.2021.732135
65. Maia A Tarannum M Lérias JR Piccinelli S Borrego LM Maeurer M Romee R Castillo-Martin M Building a better defense: expanding and improving natural killer cells for adoptive cell therapy Cells 2024 10.3390/cells13050451 38474415
Maia A, Tarannum M, Lérias JR, Piccinelli S, Borrego LM, Maeurer M, Romee R, Castillo-Martin M. Building a better defense: expanding and improving natural killer cells for adoptive cell therapy. Cells. 2024. 10.3390/cells13050451.38474415 10.3390/cells13050451
66. Lapteva N Parihar R Rollins LA Gee AP Rooney CM Somanchi SS Large-scale culture and genetic modification of human natural killer cells for cellular therapy Natural killer cells: methods and protocols 2016 Springer Methods in Molecular Biology 195 202
Lapteva N, Parihar R, Rollins LA, Gee AP, Rooney CM. Large-scale culture and genetic modification of human natural killer cells for cellular therapy. In: Somanchi SS, editor. Natural killer cells: methods and protocols. Springer: Methods in Molecular Biology; 2016. p. 195–202 (10.1007/978-1-4939-3684-7_16).
67. Berjis A Muthumani D Aguilar OA Pomp O Johnson O Finck AV Engel NW Chen L Plachta N Scholler J Lanier LL June CH Sheppard NC Pretreatment with IL-15 and IL-18 rescues natural killer cells from granzyme B-mediated apoptosis after cryopreservation Nat Commun 2024 10.1038/s41467-024-47574-0 38729924
Berjis A, Muthumani D, Aguilar OA, Pomp O, Johnson O, Finck AV, Engel NW, Chen L, Plachta N, Scholler J, Lanier LL, June CH, Sheppard NC. Pretreatment with IL-15 and IL-18 rescues natural killer cells from granzyme B-mediated apoptosis after cryopreservation. Nat Commun. 2024. 10.1038/s41467-024-47574-0.38729924 10.1038/s41467-024-47574-0
68. Carlsten M Childs RW Genetic manipulation of NK cells for cancer immunotherapy: techniques and clinical implications Front Immunol 2015 10.3389/fimmu.2015.00266 26113846
Carlsten M, Childs RW. Genetic manipulation of NK cells for cancer immunotherapy: techniques and clinical implications. Front Immunol. 2015. 10.3389/fimmu.2015.00266.26113846 10.3389/fimmu.2015.00266
69. Gurney M Kundu S Pandey S O’Dwyer M Feeder cells at the interface of natural killer cell activation, expansion and gene editing Front Immunol 2022 10.3389/fimmu.2022.802906 35222382
Gurney M, Kundu S, Pandey S, O’Dwyer M. Feeder cells at the interface of natural killer cell activation, expansion and gene editing. Front Immunol. 2022. 10.3389/fimmu.2022.802906.35222382 10.3389/fimmu.2022.802906
70. Pomeroy EJ Lahr WS Chang JW Krueger J Wick BJ Slipek NJ Skeate JG Webber BR Moriarity BS Non-viral engineering of CAR-NK and CAR-T cells using the tcbuster transposon system BioRxiv 2021 12 1 35
Pomeroy EJ, Lahr WS, Chang JW, Krueger J, Wick BJ, Slipek NJ, Skeate JG, Webber BR, Moriarity BS. Non-viral engineering of CAR-NK and CAR-T cells using the tcbuster transposon system. BioRxiv. 2021;12:1–35.
71. Gurney M O’Reilly E Corcoran S Brophy S Krawczyk J Otto NM Hermanson DL Childs RW Szegezdi E O’Dwyer ME Concurrent transposon engineering and CRISPR/Cas9 genome editing of primary CLL-1 chimeric antigen receptor–natural killer cells Cytotherapy 2022 24 1087 1094 10.1016/j.jcyt.2022.07.008 36050244
Gurney M, O’Reilly E, Corcoran S, Brophy S, Krawczyk J, Otto NM, Hermanson DL, Childs RW, Szegezdi E, O’Dwyer ME. Concurrent transposon engineering and CRISPR/Cas9 genome editing of primary CLL-1 chimeric antigen receptor–natural killer cells. Cytotherapy. 2022;24:1087–94. 10.1016/j.jcyt.2022.07.008.36050244 10.1016/j.jcyt.2022.07.008
72. Fate Therapeutics, Fate Therapeutics Press Release December 2021, 2021. https://ir.fatetherapeutics.com/news-releases/news-release-details/fate-therapeutics-showcases-positive-interim-phase-1-data-ft596. Accessed 18 May 2023.
73. Li Y Hermanson DL Moriarity BS Kaufman DS Human iPSC-derived natural killer cells engineered with chimeric antigen receptors enhance anti-tumor activity Cell Stem Cell 2018 23 181 192.e5 10.1016/j.stem.2018.06.002 30082067
Li Y, Hermanson DL, Moriarity BS, Kaufman DS. Human iPSC-derived natural killer cells engineered with chimeric antigen receptors enhance anti-tumor activity. Cell Stem Cell. 2018;23:181-192.e5. 10.1016/j.stem.2018.06.002.30082067 10.1016/j.stem.2018.06.002
74. Cichocki F Van Der Stegen SJC Miller JS Engineered and banked iPSCs for advanced NK-and T-cell immunotherapies Blood 2023 141 846 855 10.1182/blood.2022016205 36327161
Cichocki F, Van Der Stegen SJC, Miller JS. Engineered and banked iPSCs for advanced NK-and T-cell immunotherapies. Blood. 2023;141:846–55.36327161 10.1182/blood.2022016205
75. Zhu H Kaufman DS Kaneko S An improved method to produce clinical-scale natural killer cells from human pluripotent stem cells In vitro differentiation of t-cells methods and protocols methods in molecular biology 2048 2019 New York Humana
Zhu H, Kaufman DS. An improved method to produce clinical-scale natural killer cells from human pluripotent stem cells. In: Kaneko S, editor. In vitro differentiation of t-cells methods and protocols methods in molecular biology 2048. New York: Humana; 2019. (10.1007/978-1-4939-9728-2_12).
76. Maddineni S Silberstein JL Sunwoo JB Emerging NK cell therapies for cancer and the promise of next generation engineering of iPSC-derived NK cells J Immunother Cancer 2022 10.1136/jitc-2022-004693 35580928
Maddineni S, Silberstein JL, Sunwoo JB. Emerging NK cell therapies for cancer and the promise of next generation engineering of iPSC-derived NK cells. J Immunother Cancer. 2022. 10.1136/jitc-2022-004693.35580928 10.1136/jitc-2022-004693
77. Doss MX Sachinidis A Current challenges of iPSC-based disease modeling and therapeutic implications Cells 2019 10.3390/cells8050403 31052294
Doss MX, Sachinidis A. Current challenges of iPSC-based disease modeling and therapeutic implications. Cells. 2019. 10.3390/cells8050403.31052294 10.3390/cells8050403
78. Matosevic S Viral and nonviral engineering of natural killer cells as emerging adoptive cancer immunotherapies J Immunol Res 2018 10.1155/2018/4054815 30306093
Matosevic S. Viral and nonviral engineering of natural killer cells as emerging adoptive cancer immunotherapies. J Immunol Res. 2018. 10.1155/2018/4054815.30306093 10.1155/2018/4054815
79. Suerth JD Morgan MA Kloess S Heckl D Neudörfl C Falk CS Koehl U Schambach A Efficient generation of gene-modified human natural killer cells via alpharetroviral vectors J Mol Med 2016 94 83 93 10.1007/s00109-015-1327-6 26300042
Suerth JD, Morgan MA, Kloess S, Heckl D, Neudörfl C, Falk CS, Koehl U, Schambach A. Efficient generation of gene-modified human natural killer cells via alpharetroviral vectors. J Mol Med. 2016;94:83–93. 10.1007/s00109-015-1327-6.26300042 10.1007/s00109-015-1327-6
80. Harnack U Johnen H Pecher G Natural killer cell line YT exerts cytotoxicity against CD86+ myeloma cells Anticancer Res 2011 31 475 479 21378326
Harnack U, Johnen H, Pecher G. Natural killer cell line YT exerts cytotoxicity against CD86+ myeloma cells. Anticancer Res. 2011;31:475–9.21378326
81. Subrakova VG Kulemzin SV Belovezhets TN Chikaev AN Chikaev NA Koval OA Gorchakov AA Taranin AV Shp-2 gene knockout upregulates CAR-driven cytotoxicity of YT NK cells Vavilovskii Zhurnal Genet Selektsii 2020 24 80 86 10.18699/VJ20.598 33659784
Subrakova VG, Kulemzin SV, Belovezhets TN, Chikaev AN, Chikaev NA, Koval OA, Gorchakov AA, Taranin AV. Shp-2 gene knockout upregulates CAR-driven cytotoxicity of YT NK cells. Vavilovskii Zhurnal Genet Selektsii. 2020;24:80–6. 10.18699/VJ20.598.33659784 10.18699/VJ20.598
82. Navarrete-Galvan L Guglielmo M Cruz Amaya J Smith-Gagen J Lombardi VC Merica R Hudig D Optimizing NK-92 serial killers: gamma irradiation, CD95/Fas-ligation, and NK or LAK attack limit cytotoxic efficacy J Transl Med 2022 20 1 13 10.1186/s12967-022-03350-6 34980160
Navarrete-Galvan L, Guglielmo M, Cruz Amaya J, Smith-Gagen J, Lombardi VC, Merica R, Hudig D. Optimizing NK-92 serial killers: gamma irradiation, CD95/Fas-ligation, and NK or LAK attack limit cytotoxic efficacy. J Transl Med. 2022;20:1–13. 10.1186/s12967-022-03350-6.34980160 10.1186/s12967-022-03350-6
83. Li H Song W Li Z Zhang M Preclinical and clinical studies of CAR-NK-cell therapies for malignancies Front Immunol 2022 10.3389/fimmu.2022.992232 36936475
Li H, Song W, Li Z, Zhang M. Preclinical and clinical studies of CAR-NK-cell therapies for malignancies. Front Immunol. 2022. 10.3389/fimmu.2022.992232.36936475 10.3389/fimmu.2022.992232
84. Maki G Martin JA Factors regulating the cytotoxic activity of the human natural killer cell line nk-92 J Hematother Stem Cell Res 2001 10 369 383 10.1089/152581601750288975 11454312
Maki G, Martin JA. Factors regulating the cytotoxic activity of the human natural killer cell line nk-92. J Hematother Stem Cell Res. 2001;10:369–83.11454312 10.1089/152581601750288975
85. Gong J Maki G Klingemann H Characterization of a human cell line (NK-92) with phenotypical and functional characteristics of activated natural killer cells Leukemia 1994 8 652 658 8152260
Gong J, Maki G, Klingemann H. Characterization of a human cell line (NK-92) with phenotypical and functional characteristics of activated natural killer cells. Leukemia. 1994;8:652–8.8152260
86. Tam YK Maki G Miyagawa B Hennemann B Tonn T Klingemann HG Characterisation of genetically altered, interleukin 2-independent natural killer cell lines suitable for adoptive cellular therapy Hum Gene Ther 1999 10 1359 1373 10.1089/10430349950018030 10365666
Tam YK, Maki G, Miyagawa B, Hennemann B, Tonn T, Klingemann HG. Characterisation of genetically altered, interleukin 2-independent natural killer cell lines suitable for adoptive cellular therapy. Hum Gene Ther. 1999;10:1359–73. 10.1089/10430349950018030.10365666 10.1089/10430349950018030
87. Tang X Yang L Li Z Nalin AP Dai H Xu T Yin J You F Zhu M Shen W Chen G Zhu X Wu D Yu J First-in-man clinical trial of CAR NK-92 cells: safety test of CD33-CAR NK-92 cells in patients with relapsed and refractory acute myeloid leukemia Am J Cancer Res 2018 8 1083 1089 30034945
Tang X, Yang L, Li Z, Nalin AP, Dai H, Xu T, Yin J, You F, Zhu M, Shen W, Chen G, Zhu X, Wu D, Yu J. First-in-man clinical trial of CAR NK-92 cells: safety test of CD33-CAR NK-92 cells in patients with relapsed and refractory acute myeloid leukemia. Am J Cancer Res. 2018;8:1083–9.30034945
88. Jochems C Hodge JW Fantini M Fujii R Mauric Morillon YI Greiner JW Padget MR Tritsch SR Yok Tsang K Campbell KS Klingemann H Boissel L Rabizadeh S Soon-Shiong P Schlom J An NK cell line (haNK) expressing high levels of granzyme and engineered to express the high affinity CD16 allele Oncotarget 2016 7 86359 86373 10.18632/oncotarget.13411 27861156
Jochems C, Hodge JW, Fantini M, Fujii R, Mauric Morillon YI, Greiner JW, Padget MR, Tritsch SR, Yok Tsang K, Campbell KS, Klingemann H, Boissel L, Rabizadeh S, Soon-Shiong P, Schlom J. An NK cell line (haNK) expressing high levels of granzyme and engineered to express the high affinity CD16 allele. Oncotarget. 2016;7:86359–73.27861156 10.18632/oncotarget.13411
89. Boissel L Betancur M Lu W Krause D Van Etten R Wels W Klingemann H Retargeting NK-92 cells by means of CD19- and CD20-specific chimeric antigen receptors compares favorably with antibody-dependent cellular cytotoxicity Oncoimmunology 2013 2 e26527 10.4161/onci.26527 24404423
Boissel L, Betancur M, Lu W, Krause D, Van Etten R, Wels W, Klingemann H. Retargeting NK-92 cells by means of CD19- and CD20-specific chimeric antigen receptors compares favorably with antibody-dependent cellular cytotoxicity. Oncoimmunology. 2013;2: e26527. 10.4161/onci.26527.24404423 10.4161/onci.26527
90. Robbins Y Greene S Friedman J Clavijo PE Van Waes C Fabian KP Padget MR Sater HA Lee JH Soon-Shiong P Gulley J Schlom J Hodge JW Allen CT Tumor control via targeting pd-l1 with chimeric antigen receptor modified nk cells Elife 2020 9 1 18 10.7554/eLife.54854
Robbins Y, Greene S, Friedman J, Clavijo PE, Van Waes C, Fabian KP, Padget MR, Sater HA, Lee JH, Soon-Shiong P, Gulley J, Schlom J, Hodge JW, Allen CT. Tumor control via targeting pd-l1 with chimeric antigen receptor modified nk cells. Elife. 2020;9:1–18. 10.7554/eLife.54854.10.7554/eLife.54854
91. Suck G Odendahl M Nowakowska P Seidl C Wels WS Klingemann HG Tonn T NK-92: an ‘off-the-shelf therapeutic’ for adoptive natural killer cell-based cancer immunotherapy Cancer Immunol Immunother 2016 65 485 492 10.1007/s00262-015-1761-x 26559813
Suck G, Odendahl M, Nowakowska P, Seidl C, Wels WS, Klingemann HG, Tonn T. NK-92: an ‘off-the-shelf therapeutic’ for adoptive natural killer cell-based cancer immunotherapy. Cancer Immunol Immunother. 2016;65:485–92. 10.1007/s00262-015-1761-x.26559813 10.1007/s00262-015-1761-x
92. ImmunityBio, Press Release: ImmunityBio Announces Results of Phase 2 Metastatic Pancreatic Cancer Trial at ASCO GI With Median Overall Survival of 6.3 Months in Patients With Third-Line Disease, More Than Doubling Historical Survival, (2022). https://ir.immunitybio.com/news-releases/news-release-details/immunitybio-announces-results-phase-2-metastatic-pancreatic?field_nir_news_date_value[min]. Accessed 18 May 2023.
93. Suck G Branch DR Smyth MJ Miller RG Vergidis J Fahim S Keating A KHYG-1, a model for the study of enhanced natural killer cell cytotoxicity Exp Hematol 2005 33 1160 1171 10.1016/j.exphem.2005.06.024 16219538
Suck G, Branch DR, Smyth MJ, Miller RG, Vergidis J, Fahim S, Keating A. KHYG-1, a model for the study of enhanced natural killer cell cytotoxicity. Exp Hematol. 2005;33:1160–71. 10.1016/j.exphem.2005.06.024.16219538 10.1016/j.exphem.2005.06.024
94. Stikvoort A Van Der Schans J Sarkar S Poels R Ruiter R Naik J Yuan H De Bruijn JD Van De Donk NWCJ Zweegman S Themeli M Groen R O’Dwyer M Mutis T CD38-specific chimeric antigen receptor expressing natural killer KHYG-1 cells: a proof of concept for an “Off the Shelf” therapy for multiple myeloma Hemasphere 2021 10.1097/HS9.0000000000000596 34131635
Stikvoort A, Van Der Schans J, Sarkar S, Poels R, Ruiter R, Naik J, Yuan H, De Bruijn JD, Van De Donk NWCJ, Zweegman S, Themeli M, Groen R, O’Dwyer M, Mutis T. CD38-specific chimeric antigen receptor expressing natural killer KHYG-1 cells: a proof of concept for an “Off the Shelf” therapy for multiple myeloma. Hemasphere. 2021. 10.1097/HS9.0000000000000596.34131635 10.1097/HS9.0000000000000596
95. Tonn T Schwabe D Klingemann HG Becker S Esser R Koehl U Suttorp M Seifried E Ottmann OG Bug G Treatment of patients with advanced cancer with the natural killer cell line NK-92 Cytotherapy 2013 15 1563 1570 10.1016/j.jcyt.2013.06.017 24094496
Tonn T, Schwabe D, Klingemann HG, Becker S, Esser R, Koehl U, Suttorp M, Seifried E, Ottmann OG, Bug G. Treatment of patients with advanced cancer with the natural killer cell line NK-92. Cytotherapy. 2013;15:1563–70. 10.1016/j.jcyt.2013.06.017.24094496 10.1016/j.jcyt.2013.06.017
96. Gong Y KleinWolterink RGJ Wang J Bos GMJ Germeraad WTV Chimeric antigen receptor natural killer (CAR-NK) cell design and engineering for cancer therapy J Hematol Oncol 2021 10.1186/s13045-021-01083-5 34727952
Gong Y, KleinWolterink RGJ, Wang J, Bos GMJ, Germeraad WTV. Chimeric antigen receptor natural killer (CAR-NK) cell design and engineering for cancer therapy. J Hematol Oncol. 2021. 10.1186/s13045-021-01083-5.34727952 10.1186/s13045-021-01083-5
97. Altvater B Landmeier S Pscherer S Temme J Schweer K Kailayangiri S Campana D Juergens H Pule M Rossig C 2B4 (CD244) signaling by recombinant antigen-specific chimeric receptors costimulates natural killer cell activation to leukemia and neuroblastoma cells Clin Cancer Res 2009 15 4857 4866 10.1158/1078-0432.CCR-08-2810 19638467
Altvater B, Landmeier S, Pscherer S, Temme J, Schweer K, Kailayangiri S, Campana D, Juergens H, Pule M, Rossig C. 2B4 (CD244) signaling by recombinant antigen-specific chimeric receptors costimulates natural killer cell activation to leukemia and neuroblastoma cells. Clin Cancer Res. 2009;15:4857–66. 10.1158/1078-0432.CCR-08-2810.19638467 10.1158/1078-0432.CCR-08-2810
98. Chang YH Connolly J Shimasaki N Mimura K Kono K Campana D A chimeric receptor with NKG2D specificity enhances natural killer cell activation and killing of tumor cells Cancer Res 2013 73 1777 1786 10.1158/0008-5472.CAN-12-3558 23302231
Chang YH, Connolly J, Shimasaki N, Mimura K, Kono K, Campana D. A chimeric receptor with NKG2D specificity enhances natural killer cell activation and killing of tumor cells. Cancer Res. 2013;73:1777–86. 10.1158/0008-5472.CAN-12-3558.23302231 10.1158/0008-5472.CAN-12-3558
99. Xiao L Cen D Gan H Sun Y Huang N Xiong H Jin Q Su L Liu X Wang K Yan G Dong T Wu S Zhou P Zhang J Liang W Ren J Teng Y Chen C Xu XH Adoptive transfer of NKG2D CAR mRNA-engineered natural killer cells in colorectal cancer patients Mol Ther 2019 27 1114 1125 10.1016/j.ymthe.2019.03.011 30962163
Xiao L, Cen D, Gan H, Sun Y, Huang N, Xiong H, Jin Q, Su L, Liu X, Wang K, Yan G, Dong T, Wu S, Zhou P, Zhang J, Liang W, Ren J, Teng Y, Chen C, Xu XH. Adoptive transfer of NKG2D CAR mRNA-engineered natural killer cells in colorectal cancer patients. Mol Ther. 2019;27:1114–25. 10.1016/j.ymthe.2019.03.011.30962163 10.1016/j.ymthe.2019.03.011
100. Agrawal P Ingle NP Boyle WS Ward E Tolar J Dorfman KD Reineke TM Fast, efficient, and gentle transfection of human adherent cells in suspension ACS Appl Mater Interfaces 2016 8 8870 8874 10.1021/acsami.6b01702 27035392
Agrawal P, Ingle NP, Boyle WS, Ward E, Tolar J, Dorfman KD, Reineke TM. Fast, efficient, and gentle transfection of human adherent cells in suspension. ACS Appl Mater Interfaces. 2016;8:8870–4. 10.1021/acsami.6b01702.27035392 10.1021/acsami.6b01702
101. Costa D Briscoe WH Queiroz J Polyethylenimine coated plasmid DNA-surfactant complexes as potential gene delivery systems Colloids Surf B Biointerfaces 2015 133 156 163 10.1016/j.colsurfb.2015.06.005 26099970
Costa D, Briscoe WH, Queiroz J. Polyethylenimine coated plasmid DNA-surfactant complexes as potential gene delivery systems. Colloids Surf B Biointerfaces. 2015;133:156–63. 10.1016/j.colsurfb.2015.06.005.26099970 10.1016/j.colsurfb.2015.06.005
102. Carvalho M Sepodes B Martins AP Regulatory and scientific advancements in gene therapy: State-of-the-art of clinical applications and of the supporting European regulatory framework Front Med (Lausanne) 2017 10.3389/fmed.2017.00182 29124055
Carvalho M, Sepodes B, Martins AP. Regulatory and scientific advancements in gene therapy: State-of-the-art of clinical applications and of the supporting European regulatory framework. Front Med (Lausanne). 2017. 10.3389/fmed.2017.00182.29124055 10.3389/fmed.2017.00182
103. Bari R Granzin M Tsang KS Roy A Krueger W Orentas R Schneider D Pfeifer R Moeker N Verhoeyen E Dropulic B Leung W A Distinct subset of highly proliferative and lentiviral vector (LV)-transducible NK cells define a readily engineered subset for adoptive cellular therapy Front Immunol 2019 10.3389/fimmu.2019.02784 31839796
Bari R, Granzin M, Tsang KS, Roy A, Krueger W, Orentas R, Schneider D, Pfeifer R, Moeker N, Verhoeyen E, Dropulic B, Leung W. A Distinct subset of highly proliferative and lentiviral vector (LV)-transducible NK cells define a readily engineered subset for adoptive cellular therapy. Front Immunol. 2019. 10.3389/fimmu.2019.02784.31839796 10.3389/fimmu.2019.02784
104. Robbins GM Wang M Pomeroy EJ Moriarity BS Nonviral genome engineering of natural killer cells Stem Cell Res Ther 2021 12 350 10.1186/s13287-021-02406-6 34134774
Robbins GM, Wang M, Pomeroy EJ, Moriarity BS. Nonviral genome engineering of natural killer cells. Stem Cell Res Ther. 2021;12:350.34134774 10.1186/s13287-021-02406-6
105. Colamartino ABL Lemieux W Bifsha P Nicoletti S Chakravarti N Sanz J Roméro H Selleri S Béland K Guiot M Tremblay-Laganière C Dicaire R Barreiro L Lee DA Verhoeyen E Haddad E Efficient and robust NK-Cell transduction with baboon envelope pseudotyped lentivector Front Immunol 2019 10 1 7 10.3389/fimmu.2019.02873 30723466
Colamartino ABL, Lemieux W, Bifsha P, Nicoletti S, Chakravarti N, Sanz J, Roméro H, Selleri S, Béland K, Guiot M, Tremblay-Laganière C, Dicaire R, Barreiro L, Lee DA, Verhoeyen E, Haddad E. Efficient and robust NK-Cell transduction with baboon envelope pseudotyped lentivector. Front Immunol. 2019;10:1–7. 10.3389/fimmu.2019.02873.30723466 10.3389/fimmu.2019.02873
106. McErlean EM McCrudden CM McCarthy HO Delivery of nucleic acids for cancer gene therapy: overcoming extra- and intra-cellular barriers Ther Deliv 2016 10.4155/tde-2016-0049 27582234
McErlean EM, McCrudden CM, McCarthy HO. Delivery of nucleic acids for cancer gene therapy: overcoming extra- and intra-cellular barriers. Ther Deliv. 2016. 10.4155/tde-2016-0049.27582234 10.4155/tde-2016-0049
107. McErlean EM, McCrudden CM, McCarthy HO, Multifunctional delivery systems for cancer gene therapy, In: Doaa Hashad (Ed.), Gene therapy: principles and challenges, InTech, 2015: pp. 57–104. 10.5772/61297.
108. Silva G Rodrigues AF Ferreira S Matos C Eleutério RP Marques G Kucheryava K Lemos AR Sousa PMF Castro R Barbas A Simão D Alves PM Novel scFv against Notch Ligand JAG1 suitable for development of cell therapies toward JAG1-positive tumors Biomolecules 2023 10.3390/biom13030459 38254633
Silva G, Rodrigues AF, Ferreira S, Matos C, Eleutério RP, Marques G, Kucheryava K, Lemos AR, Sousa PMF, Castro R, Barbas A, Simão D, Alves PM. Novel scFv against Notch Ligand JAG1 suitable for development of cell therapies toward JAG1-positive tumors. Biomolecules. 2023. 10.3390/biom13030459.38254633 10.3390/biom13030459
109. Tipanee J VandenDriessche T Chuah MK Transposons: moving forward from preclinical studies to clinical trials Hum Gene Ther 2017 28 1087 1104 10.1089/hum.2017.128 28920716
Tipanee J, VandenDriessche T, Chuah MK. Transposons: moving forward from preclinical studies to clinical trials. Hum Gene Ther. 2017;28:1087–104. 10.1089/hum.2017.128.28920716 10.1089/hum.2017.128
110. Sandoval-Villegas N Nurieva W Amberger M Ivics Z Contemporary transposon tools: a review and guide through mechanisms and applications of sleeping beauty, piggybac and tol2 for genome engineering Int J Mol Sci 2021 10.3390/ijms22105084 34064900
Sandoval-Villegas N, Nurieva W, Amberger M, Ivics Z. Contemporary transposon tools: a review and guide through mechanisms and applications of sleeping beauty, piggybac and tol2 for genome engineering. Int J Mol Sci. 2021. 10.3390/ijms22105084.34064900 10.3390/ijms22105084
111. Hudecek M Ivics Z Non-viral therapeutic cell engineering with the Sleeping Beauty transposon system Curr Opin Genet Dev 2018 52 100 108 10.1016/j.gde.2018.06.003 29957586
Hudecek M, Ivics Z. Non-viral therapeutic cell engineering with the Sleeping Beauty transposon system. Curr Opin Genet Dev. 2018;52:100–8. 10.1016/j.gde.2018.06.003.29957586 10.1016/j.gde.2018.06.003
112. Elmas E Saljoughian N de Souza Fernandes Pereira M Tullius BP Sorathia K Nakkula RJ Lee DA Naeimi Kararoudi M CRISPR gene editing of human primary NK and T cells for cancer immunotherapy Front Oncol 2022 10.3389/fonc.2022.834002 35449580
Elmas E, Saljoughian N, de Souza Fernandes Pereira M, Tullius BP, Sorathia K, Nakkula RJ, Lee DA, Naeimi Kararoudi M. CRISPR gene editing of human primary NK and T cells for cancer immunotherapy. Front Oncol. 2022. 10.3389/fonc.2022.834002.35449580 10.3389/fonc.2022.834002
113. Huang RS Shih HA Lai MC Chang YJ Lin S Enhanced NK-92 cytotoxicity by CRISPR genome engineering using Cas9 ribonucleoproteins Front Immunol 2020 11 1 16 10.3389/fimmu.2020.01008 32038653
Huang RS, Shih HA, Lai MC, Chang YJ, Lin S. Enhanced NK-92 cytotoxicity by CRISPR genome engineering using Cas9 ribonucleoproteins. Front Immunol. 2020;11:1–16. 10.3389/fimmu.2020.01008.32038653 10.3389/fimmu.2020.01008
114. Zhu H Blum RH Bernareggi D Ask EH Wu Z Hoel HJ Meng Z Wu C Guan KL Malmberg KJ Kaufman DS Metabolic reprograming via deletion of CISH in human iPSC-derived NK cells promotes in vivo persistence and enhances anti-tumor activity Cell Stem Cell 2020 27 224 237.e6 10.1016/j.stem.2020.05.008 32531207
Zhu H, Blum RH, Bernareggi D, Ask EH, Wu Z, Hoel HJ, Meng Z, Wu C, Guan KL, Malmberg KJ, Kaufman DS. Metabolic reprograming via deletion of CISH in human iPSC-derived NK cells promotes in vivo persistence and enhances anti-tumor activity. Cell Stem Cell. 2020;27:224-237.e6. 10.1016/j.stem.2020.05.008.32531207 10.1016/j.stem.2020.05.008
115. Daher M Basar R Gokdemir E Baran N Uprety N Nunez Cortes AK Mendt M Kerbauy LN Banerjee PP Shanley M Imahashi N Li L Lim FLWI Fathi M Rezvan A Mohanty V Shen Y Shaim H Lu J Ozcan G Ensley E Kaplan M Nandivada V Bdiwi M Acharya S Xi Y Wan X Mak D Liu E Jiang XR Ang S Muniz-Feliciano L Li Y Wang J Kordasti S Petrov N Varadarajan N Marin D Brunetti L Skinner RJ Lyu S Silva L Turk R Schubert MS Rettig GR McNeill MS Kurgan G Behlke MA Li H Fowlkes NW Chen K Konopleva M Champlin RE Shpall EJ Rezvani K Targeting a cytokine checkpoint enhances the fitness of armored cord blood CAR-NK cells Blood 2021 137 624 636 10.1182/blood.2020007748 32902645
Daher M, Basar R, Gokdemir E, Baran N, Uprety N, Nunez Cortes AK, Mendt M, Kerbauy LN, Banerjee PP, Shanley M, Imahashi N, Li L, Lim FLWI, Fathi M, Rezvan A, Mohanty V, Shen Y, Shaim H, Lu J, Ozcan G, Ensley E, Kaplan M, Nandivada V, Bdiwi M, Acharya S, Xi Y, Wan X, Mak D, Liu E, Jiang XR, Ang S, Muniz-Feliciano L, Li Y, Wang J, Kordasti S, Petrov N, Varadarajan N, Marin D, Brunetti L, Skinner RJ, Lyu S, Silva L, Turk R, Schubert MS, Rettig GR, McNeill MS, Kurgan G, Behlke MA, Li H, Fowlkes NW, Chen K, Konopleva M, Champlin RE, Shpall EJ, Rezvani K. Targeting a cytokine checkpoint enhances the fitness of armored cord blood CAR-NK cells. Blood. 2021;137:624–36. 10.1182/blood.2020007748.32902645 10.1182/blood.2020007748
116. Bishop DC Clancy LE Simms R Burgess J Mathew G Moezzi L Street JA Sutrave G Atkins E McGuire HM Gloss BS Lee K Jiang W Maddock K McCaughan G Avdic S Antonenas V O’Brien TA Shaw PJ Irving DO Gottlieb DJ Blyth E Micklethwaite KP Development of CAR T-cell lymphoma in 2 of 10 patients effectively treated with piggyBac-modified CD19 CAR T cells Blood 2021 138 1504 1509 10.1182/blood.2021010813 34010392
Bishop DC, Clancy LE, Simms R, Burgess J, Mathew G, Moezzi L, Street JA, Sutrave G, Atkins E, McGuire HM, Gloss BS, Lee K, Jiang W, Maddock K, McCaughan G, Avdic S, Antonenas V, O’Brien TA, Shaw PJ, Irving DO, Gottlieb DJ, Blyth E, Micklethwaite KP. Development of CAR T-cell lymphoma in 2 of 10 patients effectively treated with piggyBac-modified CD19 CAR T cells. Blood. 2021;138:1504–9. 10.1182/blood.2021010813.34010392 10.1182/blood.2021010813
117. Wilson MH Gottschalk S Expect the unexpected: piggyBac and lymphoma Blood 2021 138 1379 1380 10.1182/blood.2021012349 34673949
Wilson MH, Gottschalk S. Expect the unexpected: piggyBac and lymphoma. Blood. 2021;138:1379–80. 10.1182/blood.2021012349.34673949 10.1182/blood.2021012349
118. Tao J Wang Q Mendez-Dorantes C Burns KH Chiarle R Frequency and mechanisms of LINE-1 retrotransposon insertions at CRISPR/Cas9 sites Nat Commun 2022 10.1038/s41467-022-31322-3 36566249
Tao J, Wang Q, Mendez-Dorantes C, Burns KH, Chiarle R. Frequency and mechanisms of LINE-1 retrotransposon insertions at CRISPR/Cas9 sites. Nat Commun. 2022. 10.1038/s41467-022-31322-3.36566249 10.1038/s41467-022-31322-3
119. Tao J Bauer DE Chiarle R Assessing and advancing the safety of CRISPR-Cas tools: from DNA to RNA editing Nat Commun 2023 14 212 10.1038/s41467-023-35886-6 36639728
Tao J, Bauer DE, Chiarle R. Assessing and advancing the safety of CRISPR-Cas tools: from DNA to RNA editing. Nat Commun. 2023;14:212. 10.1038/s41467-023-35886-6.36639728 10.1038/s41467-023-35886-6
120. Parums DV Editorial: first regulatory approvals for CRISPRCas9 therapeutic gene editing for sickle cell disease and transfusion-dependent beta-thalassemia Med Sci Monitor 2024 10.12659/MSM.944204
Parums DV. Editorial: first regulatory approvals for CRISPRCas9 therapeutic gene editing for sickle cell disease and transfusion-dependent beta-thalassemia. Med Sci Monitor. 2024. 10.12659/MSM.944204.10.12659/MSM.944204
121. Carlsten M Levy E Karambelkar A Li L Reger R Berg M Peshwa MV Childs RW Efficient mRNA-based genetic engineering of human NK cells with high-affinity CD16 and CCR7 augments rituximab-induced ADCC against lymphoma and targets NK cell migration toward the lymph node-associated chemokine CCL19 Front Immunol 2016 7 1 9 10.3389/fimmu.2016.00105 26834743
Carlsten M, Levy E, Karambelkar A, Li L, Reger R, Berg M, Peshwa MV, Childs RW. Efficient mRNA-based genetic engineering of human NK cells with high-affinity CD16 and CCR7 augments rituximab-induced ADCC against lymphoma and targets NK cell migration toward the lymph node-associated chemokine CCL19. Front Immunol. 2016;7:1–9. 10.3389/fimmu.2016.00105.26834743 10.3389/fimmu.2016.00105
122. Ingegnere T Mariotti FR Pelosi A Quintarelli C De Angelis B Tumino N Besi F Cantoni C Locatelli F Vacca P Moretta L Human CAR NK cells: a new non-viral method allowing high efficient transfection and strong tumor cell killing Front Immunol 2019 10 1 10 10.3389/fimmu.2019.00957 30723466
Ingegnere T, Mariotti FR, Pelosi A, Quintarelli C, De Angelis B, Tumino N, Besi F, Cantoni C, Locatelli F, Vacca P, Moretta L. Human CAR NK cells: a new non-viral method allowing high efficient transfection and strong tumor cell killing. Front Immunol. 2019;10:1–10. 10.3389/fimmu.2019.00957.30723466 10.3389/fimmu.2019.00957
123. Maxcyte, Translation of NK Cell CAR Therapy to the Clinic: Critical Role of Performance & Clinical-scalability 2023. https://maxcyte.com/resource/translation-of-nk-cell-car-therapy-to-the-clinic-critical-role-of-performance-clinical-scalability/#:~:text=24%20hours%20post%20electroporation%2070,expression%20and%2087%25%20cell%20viability. Accessed 24 Nov 2023.
124. Ng YY Tay JCK Wang S CXCR1 expression to improve anti-cancer efficacy of intravenously injected CAR-NK cells in mice with peritoneal xenografts Mol Ther Oncolytics 2020 16 75 85 10.1016/J.OMTO.2019.12.006 31970285
Ng YY, Tay JCK, Wang S. CXCR1 expression to improve anti-cancer efficacy of intravenously injected CAR-NK cells in mice with peritoneal xenografts. Mol Ther Oncolytics. 2020;16:75–85. 10.1016/J.OMTO.2019.12.006.31970285 10.1016/J.OMTO.2019.12.006
125. Nakamura T Kuroi M Fujiwara Y Warashina S Sato Y Harashima H Small-sized, stable lipid nanoparticle for the efficient delivery of siRNA to human immune cell lines Sci Rep 2016 6 1 9 10.1038/srep37849 28442746
Nakamura T, Kuroi M, Fujiwara Y, Warashina S, Sato Y, Harashima H. Small-sized, stable lipid nanoparticle for the efficient delivery of siRNA to human immune cell lines. Sci Rep. 2016;6:1–9. 10.1038/srep37849.28442746 10.1038/srep37849
126. Douka S Brandenburg LE Casadidio C Walther J Garcia BBM Spanholtz J Raimo M Hennink WE Mastrobattista E Caiazzo M Lipid nanoparticle-mediated messenger RNA delivery for ex vivo engineering of natural killer cells J Control Release 2023 361 455 469 10.1016/j.jconrel.2023.08.014 37567506
Douka S, Brandenburg LE, Casadidio C, Walther J, Garcia BBM, Spanholtz J, Raimo M, Hennink WE, Mastrobattista E, Caiazzo M. Lipid nanoparticle-mediated messenger RNA delivery for ex vivo engineering of natural killer cells. J Control Release. 2023;361:455–69. 10.1016/j.jconrel.2023.08.014.37567506 10.1016/j.jconrel.2023.08.014
127. Nakamura T Nakade T Yamada K Sato Y Harashima H The hydrophobic tail of a pH-sensitive cationic lipid influences siRNA transfection activity and toxicity in human NK cell lines Int J Pharm 2021 609 121140 10.1016/j.ijpharm.2021.121140 34592399
Nakamura T, Nakade T, Yamada K, Sato Y, Harashima H. The hydrophobic tail of a pH-sensitive cationic lipid influences siRNA transfection activity and toxicity in human NK cell lines. Int J Pharm. 2021;609: 121140. 10.1016/j.ijpharm.2021.121140.34592399 10.1016/j.ijpharm.2021.121140
128. Wilk AJ Benner NL Vergara R Haabeth OAW Levy R Waymouth RM Wender PA Blish CA Charge-altering releasable transporters enable specific phenotypic manipulation of natural killer cells for cancer immunotherapy Blood Adv 2020 4 4244 4255 10.1182/bloodadvances.2020002355 32898247
Wilk AJ, Benner NL, Vergara R, Haabeth OAW, Levy R, Waymouth RM, Wender PA, Blish CA. Charge-altering releasable transporters enable specific phenotypic manipulation of natural killer cells for cancer immunotherapy. Blood Adv. 2020;4:4244–55.32898247 10.1182/bloodadvances.2020002355
129. Kim KS Han JH Park JH Kim HK Choi SH Kim GR Song H An HJ Han DK Park W Park KS Multifunctional nanoparticles for genetic engineering and bioimaging of natural killer (NK) cell therapeutics Biomaterials 2019 221 119418 10.1016/j.biomaterials.2019.119418 31419655
Kim KS, Han JH, Park JH, Kim HK, Choi SH, Kim GR, Song H, An HJ, Han DK, Park W, Park KS. Multifunctional nanoparticles for genetic engineering and bioimaging of natural killer (NK) cell therapeutics. Biomaterials. 2019;221: 119418.31419655 10.1016/j.biomaterials.2019.119418
130. Zhang Z Baxter AE Ren D Qin K Chen Z Collins SM Huang H Komar CA Bailer PF Parker JB Blobel GA Kohli RM Wherry EJ Berger SL Shi J Efficient engineering of human and mouse primary cells using peptide-assisted genome editing Nat Biotechnol 2023 10.1038/s41587-023-01756-1 37974010
Zhang Z, Baxter AE, Ren D, Qin K, Chen Z, Collins SM, Huang H, Komar CA, Bailer PF, Parker JB, Blobel GA, Kohli RM, Wherry EJ, Berger SL, Shi J. Efficient engineering of human and mouse primary cells using peptide-assisted genome editing. Nat Biotechnol. 2023. 10.1038/s41587-023-01756-1.37974010 10.1038/s41587-023-01756-1
131. Chung YH Beiss V Fiering SN Steinmetz NF COVID-19 vaccine frontrunners and their nanotechnology design ACS Nano 2020 10.1021/acsnano.0c07197 33236883
Chung YH, Beiss V, Fiering SN, Steinmetz NF. COVID-19 vaccine frontrunners and their nanotechnology design. ACS Nano. 2020. 10.1021/acsnano.0c07197.33236883 10.1021/acsnano.0c07197
132. Hou X Zaks T Langer R Dong Y Lipid nanoparticles for mRNA delivery Nat Rev Mater 2021 6 1078 1094 10.1038/s41578-021-00358-0 34394960
Hou X, Zaks T, Langer R, Dong Y. Lipid nanoparticles for mRNA delivery. Nat Rev Mater. 2021;6:1078–94. 10.1038/s41578-021-00358-0.34394960 10.1038/s41578-021-00358-0
133. Chatterjee S Kon E Sharma P Peer D Endosomal escape: a bottleneck for LNP-mediated therapeutics Proc Natl Acad Sci U S A 2024 10.1073/pnas.2307800120 38652749
Chatterjee S, Kon E, Sharma P, Peer D. Endosomal escape: a bottleneck for LNP-mediated therapeutics. Proc Natl Acad Sci U S A. 2024. 10.1073/pnas.2307800120.38652749 10.1073/pnas.2307800120
134. McKinlay CJ Vargas JR Blake TR Hardy JW Kanada M Contag CH Wender PA Waymouth RM Charge-altering releasable transporters (CARTs) for the delivery and release of mRNA in living animals Proc Natl Acad Sci U S A 2017 114 E448 E456 10.1073/pnas.1614193114 28069945
McKinlay CJ, Vargas JR, Blake TR, Hardy JW, Kanada M, Contag CH, Wender PA, Waymouth RM. Charge-altering releasable transporters (CARTs) for the delivery and release of mRNA in living animals. Proc Natl Acad Sci U S A. 2017;114:E448–56. 10.1073/pnas.1614193114.28069945 10.1073/pnas.1614193114
135. Han K Yang J Chen S Chen J-X Liu C-W Li C Cheng H Zhuo R-X Zhang X-Z Novel gene transfer vectors based on artificial recombinant multi-functional oligopeptides Int J Pharm 2012 436 555 563 10.1016/j.ijpharm.2012.07.001 22796172
Han K, Yang J, Chen S, Chen J-X, Liu C-W, Li C, Cheng H, Zhuo R-X, Zhang X-Z. Novel gene transfer vectors based on artificial recombinant multi-functional oligopeptides. Int J Pharm. 2012;436:555–63. 10.1016/j.ijpharm.2012.07.001.22796172 10.1016/j.ijpharm.2012.07.001
136. Heitz F Morris MC Divita G Twenty years of cell-penetrating peptides: from molecular mechanisms to therapeutics Br J Pharmacol 2009 157 195 206 10.1111/j.1476-5381.2009.00057.x 19309362
Heitz F, Morris MC, Divita G. Twenty years of cell-penetrating peptides: from molecular mechanisms to therapeutics. Br J Pharmacol. 2009;157:195–206.19309362 10.1111/j.1476-5381.2009.00057.x
137. Masilamani M Peruzzi G Borrego F Coligan JE Endocytosis and intracellular trafficking of human natural killer cell receptors Traffic 2009 10 1735 1744 10.1111/j.1600-0854.2009.00973.x 19719476
Masilamani M, Peruzzi G, Borrego F, Coligan JE. Endocytosis and intracellular trafficking of human natural killer cell receptors. Traffic. 2009;10:1735–44. 10.1111/j.1600-0854.2009.00973.x.19719476 10.1111/j.1600-0854.2009.00973.x
138. Mao H Tu W Qin G Law HKW Sia SF Chan P-L Liu Y Lam K-T Zheng J Peiris M Lau Y-L Influenza virus directly infects human natural killer cells and induces cell apoptosis J Virol 2009 83 9215 9222 10.1128/jvi.00805-09 19587043
Mao H, Tu W, Qin G, Law HKW, Sia SF, Chan P-L, Liu Y, Lam K-T, Zheng J, Peiris M, Lau Y-L. Influenza virus directly infects human natural killer cells and induces cell apoptosis. J Virol. 2009;83:9215–22. 10.1128/jvi.00805-09.19587043 10.1128/jvi.00805-09
139. Van Erp EA Van Kampen MR Van Kasteren PB De Wit J Viral infection of human natural killer cells Viruses 2019 11 1 13 10.3390/v11030243
Van Erp EA, Van Kampen MR, Van Kasteren PB, De Wit J. Viral infection of human natural killer cells. Viruses. 2019;11:1–13. 10.3390/v11030243.10.3390/v11030243
140. Gonçalves E Kitas E Seelig J Binding of oligoarginine to membrane lipids and heparan sulfate: structural and thermodynamic characterization of a cell-penetrating peptide Biochemistry 2005 44 2692 2702 10.1021/bi048046i 15709783
Gonçalves E, Kitas E, Seelig J. Binding of oligoarginine to membrane lipids and heparan sulfate: structural and thermodynamic characterization of a cell-penetrating peptide. Biochemistry. 2005;44:2692–702.15709783 10.1021/bi048046i
141. Letoha T Keller-Pintér A Kusz E Kolozsi C Bozsó Z Tóth G Vizler C Oláh Z Szilák L Cell-penetrating peptide exploited syndecans Biochim Biophys Acta Biomembr 2010 1798 2258 2265 10.1016/j.bbamem.2010.01.022
Letoha T, Keller-Pintér A, Kusz E, Kolozsi C, Bozsó Z, Tóth G, Vizler C, Oláh Z, Szilák L. Cell-penetrating peptide exploited syndecans. Biochim Biophys Acta Biomembr. 2010;1798:2258–65. 10.1016/j.bbamem.2010.01.022.10.1016/j.bbamem.2010.01.022
142. Poon GMK Gariépy J Cell-surface proteoglycans as molecular portals for cationic peptide and polymer entry into cells Biochem Soc Trans 2007 35 788 793 10.1042/BST0350788 17635149
Poon GMK, Gariépy J. Cell-surface proteoglycans as molecular portals for cationic peptide and polymer entry into cells. Biochem Soc Trans. 2007;35:788–93. 10.1042/BST0350788.17635149 10.1042/BST0350788
143. Pazina T Shemesh A Brusilovsky M Porgador A Campbell KS Regulation of the functions of natural cytotoxicity receptors by interactions with diverse ligands and alterations in splice variant expression Front Immunol 2017 10.3389/fimmu.2017.00369 28424697
Pazina T, Shemesh A, Brusilovsky M, Porgador A, Campbell KS. Regulation of the functions of natural cytotoxicity receptors by interactions with diverse ligands and alterations in splice variant expression. Front Immunol. 2017. 10.3389/fimmu.2017.00369.28424697 10.3389/fimmu.2017.00369
144. Brusilovsky M Radinsky O Cohen L Yossef R Shemesh A Braiman A Mandelboim O Campbell KS Porgador A Regulation of natural cytotoxicity receptors by heparan sulfate proteoglycans in -cis: a lesson from NKp44 Eur J Immunol 2015 45 1180 1191 10.1002/eji.201445177 25546090
Brusilovsky M, Radinsky O, Cohen L, Yossef R, Shemesh A, Braiman A, Mandelboim O, Campbell KS, Porgador A. Regulation of natural cytotoxicity receptors by heparan sulfate proteoglycans in -cis: a lesson from NKp44. Eur J Immunol. 2015;45:1180–91. 10.1002/eji.201445177.25546090 10.1002/eji.201445177
145. Brusilovsky M Radinsky O Yossef R Campbell KS Porgador A Carbohydrate-mediated modulation of NK cell receptor function: structural and functional influences of heparan sulfate moieties expressed on NK cell surface Front Oncol 2014 4 1 3 10.1038/nrc842 24478982
Brusilovsky M, Radinsky O, Yossef R, Campbell KS, Porgador A. Carbohydrate-mediated modulation of NK cell receptor function: structural and functional influences of heparan sulfate moieties expressed on NK cell surface. Front Oncol. 2014;4:1–3. 10.1038/nrc842.24478982 10.1038/nrc842
146. Durymanov M Reineke J Non-viral delivery of nucleic acids: Insight into mechanisms of overcoming intracellular barriers Front Pharmacol 2018 10.3389/fphar.2018.00971 30186185
Durymanov M, Reineke J. Non-viral delivery of nucleic acids: Insight into mechanisms of overcoming intracellular barriers. Front Pharmacol. 2018. 10.3389/fphar.2018.00971.30186185 10.3389/fphar.2018.00971
147. Ma L Ouyang Q Werthmann GC Thompson HM Morrow EM Live-cell microscopy and fluorescence-based measurement of luminal pH in intracellular organelles Front Cell Dev Biol 2017 10.3389/fcell.2017.00071 28871281
Ma L, Ouyang Q, Werthmann GC, Thompson HM, Morrow EM. Live-cell microscopy and fluorescence-based measurement of luminal pH in intracellular organelles. Front Cell Dev Biol. 2017. 10.3389/fcell.2017.00071.28871281 10.3389/fcell.2017.00071
148. Olden BR Cheng E Cheng Y Pun SH Identifying key barriers in cationic polymer gene delivery to human T cells Biomater Sci 2019 7 789 797 10.1039/c8bm01262h 30633266
Olden BR, Cheng E, Cheng Y, Pun SH. Identifying key barriers in cationic polymer gene delivery to human T cells. Biomater Sci. 2019;7:789–97. 10.1039/c8bm01262h.30633266 10.1039/c8bm01262h
149. Plesch E Chen C-C Butz E Scotto Rosato A Krogsaeter EK Yinan H Bartel K Keller M Robaa D Teupser D Holdt LM Vollmar AM Sippl W Puertollano R Medina D Biel M Wahl-Schott C Bracher F Grimm C Selective agonist of TRPML2 reveals direct role in chemokine release from innate immune cells Elife 2018 10.7554/eLife.39720.001 30479274
Plesch E, Chen C-C, Butz E, Scotto Rosato A, Krogsaeter EK, Yinan H, Bartel K, Keller M, Robaa D, Teupser D, Holdt LM, Vollmar AM, Sippl W, Puertollano R, Medina D, Biel M, Wahl-Schott C, Bracher F, Grimm C. Selective agonist of TRPML2 reveals direct role in chemokine release from innate immune cells. Elife. 2018. 10.7554/eLife.39720.001.30479274 10.7554/eLife.39720.001
150. Gleeson PA The role of endosomes in innate and adaptive immunity Semin Cell Dev Biol 2014 31 64 72 10.1016/j.semcdb.2014.03.002 24631355
Gleeson PA. The role of endosomes in innate and adaptive immunity. Semin Cell Dev Biol. 2014;31:64–72. 10.1016/j.semcdb.2014.03.002.24631355 10.1016/j.semcdb.2014.03.002
151. Mace EM Human natural killer cells: form, function, and development J Allergy Clin Immunol 2023 151 371 385 10.1016/J.JACI.2022.09.022 36195172
Mace EM. Human natural killer cells: form, function, and development. J Allergy Clin Immunol. 2023;151:371–85. 10.1016/J.JACI.2022.09.022.36195172 10.1016/J.JACI.2022.09.022
152. Oth T Habets THPM Germeraad WTV Zonneveld MI Bos GMJ Vanderlocht J Pathogen recognition by NK cells amplifies the pro-inflammatory cytokine production of monocyte-derived DC via IFN-γ BMC Immunol 2018 10.1186/s12865-018-0247-y 29433450
Oth T, Habets THPM, Germeraad WTV, Zonneveld MI, Bos GMJ, Vanderlocht J. Pathogen recognition by NK cells amplifies the pro-inflammatory cytokine production of monocyte-derived DC via IFN-γ. BMC Immunol. 2018. 10.1186/s12865-018-0247-y.29433450 10.1186/s12865-018-0247-y
153. Carty M Guy C Bowie AG Detection of Viral Infections by Innate Immunity Biochem Pharmacol 2021 10.1016/j.bcp.2020.114316 33152343
Carty M, Guy C, Bowie AG. Detection of Viral Infections by Innate Immunity. Biochem Pharmacol. 2021. 10.1016/j.bcp.2020.114316.33152343 10.1016/j.bcp.2020.114316
154. Sutlu T Nyström S Gilljam M Stellan B Applequist SE Alici E Inhibition of intracellular antiviral defense mechanisms augments lentiviral transduction of human natural killer cells: implications for gene therapy Hum Gene Ther 2012 23 1090 1100 10.1089/hum.2012.080 22779406
Sutlu T, Nyström S, Gilljam M, Stellan B, Applequist SE, Alici E. Inhibition of intracellular antiviral defense mechanisms augments lentiviral transduction of human natural killer cells: implications for gene therapy. Hum Gene Ther. 2012;23:1090–100. 10.1089/hum.2012.080.22779406 10.1089/hum.2012.080
155. Svitkin YV Cheng YM Chakraborty T Presnyak V John M Sonenberg N N1-methyl-pseudouridine in mRNA enhances translation through eIF2α-dependent and independent mechanisms by increasing ribosome density Nucleic Acids Res 2017 45 6023 6036 10.1093/nar/gkx135 28334758
Svitkin YV, Cheng YM, Chakraborty T, Presnyak V, John M, Sonenberg N. N1-methyl-pseudouridine in mRNA enhances translation through eIF2α-dependent and independent mechanisms by increasing ribosome density. Nucleic Acids Res. 2017;45:6023–36. 10.1093/nar/gkx135.28334758 10.1093/nar/gkx135
156. Andries O McCafferty S SmedtDe SC Weiss R Sanders NN Kitada T N1-methylpseudouridine-incorporated mRNA outperforms pseudouridine-incorporated mRNA by providing enhanced protein expression and reduced immunogenicity in mammalian cell lines and mice J Contr Release 2015 217 337 344 10.1016/j.jconrel.2015.08.051
Andries O, McCafferty S, SmedtDe SC, Weiss R, Sanders NN, Kitada T. N1-methylpseudouridine-incorporated mRNA outperforms pseudouridine-incorporated mRNA by providing enhanced protein expression and reduced immunogenicity in mammalian cell lines and mice. J Contr Release. 2015;217:337–44. 10.1016/j.jconrel.2015.08.051.10.1016/j.jconrel.2015.08.051
157. Anderson BR Muramatsu H Nallagatla SR Bevilacqua PC Sansing LH Weissman D Karikó K Incorporation of pseudouridine into mRNA enhances translation by diminishing PKR activation Nucleic Acids Res 2010 38 5884 5892 10.1093/nar/gkq347 20457754
Anderson BR, Muramatsu H, Nallagatla SR, Bevilacqua PC, Sansing LH, Weissman D, Karikó K. Incorporation of pseudouridine into mRNA enhances translation by diminishing PKR activation. Nucleic Acids Res. 2010;38:5884–92. 10.1093/nar/gkq347.20457754 10.1093/nar/gkq347
158. Sahin U Karikó K Türeci Ö mRNA-based therapeutics—developing a new class of drugs Nat Rev Drug Discov 2014 13 759 780 10.1038/nrd4278 25233993
Sahin U, Karikó K, Türeci Ö. mRNA-based therapeutics—developing a new class of drugs. Nat Rev Drug Discov. 2014;13:759–80. 10.1038/nrd4278.25233993 10.1038/nrd4278
