
==== Front
PLoS One
PLoS One
plos
PLOS ONE
1932-6203
Public Library of Science San Francisco, CA USA

10.1371/journal.pone.0309844
PONE-D-24-10749
Research Article
Research and Analysis Methods
Database and Informatics Methods
Bioinformatics
Sequence Analysis
Sequence Motif Analysis
Medicine and Health Sciences
Pathology and Laboratory Medicine
Pathogens
Virulence Factors
Medicine and Health Sciences
Gastroenterology and Hepatology
Gastritis
Medicine and Health Sciences
Epidemiology
Medical Risk Factors
Medicine and Health Sciences
Oncology
Cancers and Neoplasms
Gastrointestinal Tumors
Gastric Cancer
Medicine and Health Sciences
Gastroenterology and Hepatology
Peptic Ulcer Disease
Medicine and Health Sciences
Epidemiology
Medical Risk Factors
Cancer Risk Factors
Medicine and Health Sciences
Oncology
Cancer Risk Factors
Medicine and Health Sciences
Pathology and Laboratory Medicine
Pathogenesis
Virulence gene polymorphisms in Shandong Helicobacter pylori strains and their relevance to gastric cancer
Virulence gene polymorphisms and their relevance to gastric cancer
https://orcid.org/0000-0002-9459-6663
Xue Zhijing Conceptualization Formal analysis Writing – original draft 1 2 3
Li Weijia Formal analysis 4
Ding Hailing Formal analysis Writing – review & editing 5
Pei Fengyan Formal analysis 6
https://orcid.org/0000-0001-7056-8206
Zhang Jianzhong Formal analysis Resources 3
Gong Yanan Formal analysis 3
Fan Ruyue Formal analysis 7
Wang Fang Resources 1
Wang Youjun Resources 1
Chen Qing Resources 1
Li Yanran Resources 1
Yang Xinyu Resources 1 2
Zheng Yan Conceptualization 1 2 *
Su Guohai Conceptualization 2 8 *
1 Department of Gastroenterology, Central Hospital Affiliated to Shandong First Medical University, Jinan, Shandong, China
2 Research Center of Translational Medicine, Central Hospital Affiliated to Shandong First Medical University, Jinan, Shandong, China
3 National Institute for Communicable Disease Control and Prevention, Chinese Center for Disease Control and Prevention, Beijing, China
4 Department of Gastroenterology, Qilu Hospital of Shandong University, Jinan, Shandong, China
5 The Faculty of Medicine, Qilu Institute of Technology, Jinan, Shandong, China
6 Medical Research & Laboratory Diagnostic Center, Central Hospital Affiliated to Shandong First Medical University, Jinan, Shandong, China
7 Shandong Center for Disease Control and Prevention, Jinan, Shandong, China
8 Department of Cardiovascular Medicine, Central Hospital Affiliated to Shandong First Medical University, Jinan, Shandong, China
Ghavami Saeid Editor
University of Manitoba, CANADA
Competing Interests: The authors declare that they have no competing interests.

* E-mail: 8793822@qq.com (YZ); gttstg@163.com (GS)
9 9 2024
2024
19 9 e030984421 3 2024
20 8 2024
© 2024 Xue et al
2024
Xue et al
https://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.

Background

Helicobacter pylori (H. pylori) virulence factors, particularly the cagA and vacA genotypes, play important roles in the pathogenic process of gastrointestinal disease.

Methods

The cagA and vacA genotypes of 87 H. pylori strains were determined by PCR and sequencing. The EPIYA and CM motif patterns were analyzed and related to clinical outcomes. We examined the associations between the virulence genes of H. pylori and gastrointestinal diseases in Shandong, and the results were analyzed via the chi-square test and logistic regression model.

Results

Overall, 76 (87.36%) of the strains carried the East Asian-type CagA, with the ABD types being the most prevalent (90.79%). However, no significant differences were observed among the different clinical outcomes. The analysis of CagA sequence types revealed 8 distinct types, encompassing 250 EPIYA motifs, including 4 types of EPIYA or EPIYA-like sequences. Additionally, 28 CM motifs were identified, with the most prevalent patterns being E (66.67%), D (16.09%), and W-W (5.75%). Notably, a significant association was discovered between strains with GC and the CM motif pattern D (P < 0.01). With respect to the vacA genotypes, the strains were identified as s1, s2, m1, m2, i1, i2, d1, d2, c1, and c2 in 87 (100%), 0 (0), 26 (29.89%), 61 (70.11%), 73 (83.91%), 14 (16.09%), 76 (87.36%), 11 (12.64%), 18 (20.69%), and 69 (79.31%), respectively. Specifically, the vacA m1 and c1 genotypes presented a significantly greater prevalence in strains from GC compared to CG (P < 0.05). Following adjustment for age and sex, the vacA c1 genotype demonstrated a notable association with GC (OR = 5.174; 95% CI, 1.402–20.810; P = 0.012). This association was both independent of and more pronounced than the correlations between vacA m1 and GC.

Conclusions

CagA proteins possessing CM motif pattern D were more frequently observed in patients with GC (P < 0.01), implying a potentially higher virulence of CM motif pattern D than the other CM motif patterns. Moreover, a strong positive association was identified between the vacA c1 genotype and GC, indicating that the vacA c1 genotype is a robust risk indicator for GC among male patients aged ≥55 years in Shandong.

http://dx.doi.org/10.13039/501100018537 National Science and Technology Major Project 2018ZX10712-001 https://orcid.org/0000-0001-7056-8206
Zhang Jianzhong http://dx.doi.org/10.13039/501100007129 Natural Science Foundation of Shandong Province ZR2022QH216 Fan Ruyue http://dx.doi.org/10.13039/100016694 Science and Technology Development Plan of Shandong Province 202202080452 https://orcid.org/0000-0002-9459-6663
Xue Zhijing This work was supported by the National Science and Technology Major Project of China (2018ZX10712-001), the Natural Science Foundation of Shandong Province (ZR2022QH216), and the Shandong Medical and Health Science and Technology Development Plan Project (202202080452). The funders had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript. Data AvailabilityThe nucleotide sequence data are available under the China National Microbiological Data Center (NMDC) accession numbers NMDCN0002PIT to NMDCN0002PLJ.
Data Availability

The nucleotide sequence data are available under the China National Microbiological Data Center (NMDC) accession numbers NMDCN0002PIT to NMDCN0002PLJ.
==== Body
pmcIntroduction

Helicobacter pylori (H. pylori) is a gram-negative bacterium known for its colonization of the human stomach and its significant role as a primary contributor to severe gastroduodenal diseases, such as chronic gastritis (CG), peptic ulcer disease (PUD), gastric adenocarcinoma (GAC), and mucosal-associated lymphoid tissue (MALT) lymphoma [1, 2]. Gastric cancer (GC) is the third most common cause of cancer-related mortality and ranks fifth among malignant tumors globally [3]. Although H. pylori infection is a crucial risk factor for the development of GC, only a minority of individuals infected with H. pylori progress to this severe condition [4]. In addition to genetic susceptibility, duration of infection, and environmental and lifestyle factors, an important reason for the different clinical outcomes of H. pylori infection is the virulence factors of H. pylori [5]. H. pylori can produce a variety of virulence factors, of which cytotoxin-associated gene A (CagA) and vacuolating cytotoxin (VacA) are the most extensively studied [6, 7].

CagA is one of the most important virulence factors of H. pylori related to the pathogenic mechanisms of GC and is encoded by the cagA gene located at the end of the cag pathogenicity island (cag PAI) [8, 9]. Research indicates that CagA-positive strains can cause more severe gastric mucosal damage and inflammatory responses, thereby substantially increasing the risk of developing PUD and GC [10, 11]. Notably, there is a regional disparity in CagA prevalence, with nearly all strains in East Asian countries being CagA-positive compared with approximately 50% in Western countries [12]. CagA is subdivided into the East Asian-type and Western-type on the basis of differences in the repeat sequences at its C-terminus, which contains tyrosine phosphorylation site EPIYA (Glu-Pro-Ile-Tyr-Ala) motifs [13, 14]. In accordance with the sequences surrounding the EPIYA motifs, four distinct EPIYA segments, EPIYA-A, EPIYA-B, EPIYA-C, and EPIYA-D, have been identified [15, 16]. Almost all the CagA-positive strains have EPIYA-A or EPIYA-B segments. The EPIYA-C segment is unique to the Western-type CagA, whereas the EPIYA-D segment characterizes the East Asian-type CagA [17, 18]. These differences in CagA contribute to variations in the pathogenicity of H. pylori strains in different regions. Compared with the Western-type CagA, the East Asian-type CagA with the EPIYA-D segment has a stronger binding affinity for src homology 2 (SH2)-containing protein tyrosine phosphatases (SHP-2). In addition, the Western-type CagA, which contains multiple EPIYA-C segments, has heightened SHP-2 binding activity, resulting in more pronounced cellular morphological changes [19]. The structural arrangement of the EPIYA segment sequences within CagA displays considerable diversity among strains. For example, over 60% of the Western-type CagA comprises the ABC type (66.5%), followed by the ABCC (20.3%) and ABCCC (4%) types. Conversely, the predominant type within the East Asian-type CagA is ABD (83.6%), followed by the ABBD, ABDD, and AABD types. A small proportion of Western-type and East Asian-type CagA exhibit more complex arrangements of EPIYA segment sequences [20, 21]. These variations in EPIYA repeat sequences play crucial roles in determining the structural polymorphism of the CagA protein, thereby influencing its functional diversity.

There is another motif composed of 16 amino acid residues, known as the CagA multimerization (CM) motif at the C-terminus of CagA [22, 23]. Western CM sequences (FPLKRHDKVDDLSKVG) are classified as typical Western CM (W-CM) motifs because they are similar to those obtained from patients in Western countries, whereas East Asian CM sequences (FPLRRSAAVNDLSKVG) are classified as typical East Asian CM (E-CM) motifs that are similar to those obtained from East Asian countries [24, 25]. Variations in positions 4, 6, 7, 8, and 10 (FPLxRxxxVxDLSKVG) between the W-CM and E-CM motifs were elucidated in a previous study [26]. The Western-type CagA is characterized by at least two CM sequences, whose number corresponds to the number of EPIYA-C segments, whereas the East Asian-type CagA exclusively harbors a single CM motif at the C-terminus [27]. The CM motif can mediate CagA dimerization and stabilize its binding to SHP-2 [22]. Additionally, CM motifs can also bind to polarity regulatory kinase partitioning defective 1/microtubule affinity regulating kinase (PAR1/MARK), consequently inhibiting the activity of kinases [28]. This multifaceted interaction underscores the intricate regulatory mechanisms involving the CagA protein and its CM motifs in the context of H. pylori infection.

VacA, which is encoded by vacuolating cytotoxin gene A (vacA), is another extensively studied virulence factor of H. pylori that can be endocytosed by host cells and induce vacuolation and various cellular activities, leading to cell death and cell membrane receptor binding [29, 30]. The vacA gene exhibits five polymorphic regions, denoted as signal (s)-, intermediate (i)-, middle (m)-, deletion (d)-, and central (c)-regions, fostering the production of VacA with varying toxicities in different strains [31]. On the basis of vacA allelic diversity in these regions, two different genotypes have been described for each region: s1 and s2 for the s-region, i1 and i2 for the i-region, m1 and m2 for the m-region, d1 and d2 for the d-region, and c1 and c2 for the c-region [30, 31]. The different combinations of vacA s-, m-, i-, d-, and c-region genotypes determine the vacuolating activity of various H. pylori strains [32–35]. Previous investigations have revealed that strains with the s1m1 genotype exhibit greater cytotoxicity than those with the s1m2 and s2m2 variants do, thereby increasing the risk of PUD or GC development [36]. Additionally, strains bearing the i1 genotype demonstrate a robust association with GC and heightened vacuolating cytotoxin activity [37, 38]. This nuanced understanding highlights the critical role of vacA and its genotypic variants in influencing the virulence potential of H. pylori strains.

Shandong Province, situated in eastern China along the Yellow Sea, has a substantial prevalence of H. pylori infection, reaching 83.15% (74/89), alongside an incidence of GC reported at 34.58 per 100,000 persons [39, 40]. Despite the high prevalence of H. pylori in Shandong, little is known about the local prevalence of the cagA and vacA genotypes, as well as their associations with gastroduodenal diseases. Thus, this study aimed to assess the prevalence of different genotypes of cagA and vacA and to determine the relationships between these genotypes and clinical outcomes via gene sequencing methods. This study provides valuable insights into the prevalence and genetic characteristics of H. pylori strains in Shandong, shedding light on their potential implications for the development of gastroduodenal diseases.

Materials and methods

Patients and gastric biopsies

The H. pylori infection study was conducted from December 2014 to December 2015 in Shandong. A total of 305 patients were enrolled in this study, including 107 females (age range: 20–73 years; mean age: 51.71 ± 11.68 years) and 198 males (age range: 23–78 years; mean age: 56.03 ± 10.55 years). Among them, 206 patients were from Central Hospital Affiliated with Shandong First Medical University (Jinan, Shandong Province, China), and 99 patients were from Rushan People’s Hospital (Weihai, Shandong Province, China). The inclusion criteria included patients with dyspeptic symptoms who underwent upper gastrointestinal tract endoscopy and patients who provided informed consent. The exclusions criteria included patients who had received any antibiotics at least 1 month prior to endoscopy, patients who had received nonsteroidal anti-inflammatory drugs, steroids or proton pump inhibitors at least 3 months prior to endoscopy, and patients who had received anti-H. pylori eradication treatment. The final endoscopy diagnoses were CG in 266 (87.21%) patients, GC in 10 (3.28%), and PUD in 29 (9.51%) including GU (22, 7.21%) and DU (7, 2.30%). Three biopsy samples were taken from the antrum of each patient for H. pylori culture and histological examination. The biopsy samples for culture were immediately stored in brain heart infusion broth (BHI, CM1135, Oxoid) containing 20% glycerin. Written informed consent was obtained from all participants under a protocol approved by the Ethical Committee of the National Institute for Communicable Disease Control and Prevention, Chinese Center for Disease Control and Prevention (Approval No. ICDC-2013001).

H. pylori isolation and identification

The gastric biopsy samples were homogenized and cultured on the surface of Karmali agar (CM0935, Oxoid) plates supplemented with 5% defibrinated sheep blood or H. pylori selective supplement (vancomycin 10 μg/mL, trimethoprim 5 μg/mL, cefsulodin 5 μg/mL, and amphotericin B 5 μg/mL). The plates were incubated at 37°C under a microaerobic atmosphere (5% O2, 10% CO2, and 85% N2) for up to 10 days. H. pylori isolates were identified on the basis of colony morphology (smooth and translucent), gram staining (gram-negative with spiral-shaped bacilli), and positive reactions for oxidase, catalase, and urease. After subculturing on Karmali agar supplemented with 5% defibrinated sheep blood, all the isolates were stored at -80°C in BHI broth containing 20% glycerin.

DNA extraction and genotyping

Bacterial DNA was extracted via the TIANamp Bacteria DNA Kit (TIANGEN, China) according to the manufacturer’s protocol. The cagA status was determined by polymerase chain reaction (PCR) amplification and direct sequencing using forward (5’-TGCGTGTGTGGCTGTTAGTAG-3’) and reverse (5’-CCCTAGTCGGTAATGGGTTGT-3’) primers designed in the 3’ repeat region of cagA, as described previously [41]. The presence of cagA was confirmed by primers for the conserved region of cagA: forward (5’-AGC AAAAAGCGACCTTGAAA-3’) and reverse (5’-AGTGGCTCAAGCTCGTGAAT-3’), as described previously [42]. The PCR conditions were denaturation for 5 min at 94°C, 35 cycles (94°C for 30 s, 54°C for 30 s, and 72°C for 40 s), and a final extension of 10 min at 72°C. The PCR products were purified via the E.Z.N.A.® Gel Extraction Kit (OMEGA, USA) according to the manufacturer’s instructions, and the cagA genotype (East Asian-type or Western-type) was confirmed by sequencing. The nucleotide sequences of the cagA 3’ variable region were subjected to translation via BioEdit version 7.2.5. The EPIYA segment types and CM motif of CagA were compared using the program WebLogo 3 (http://weblogo.three.plusone.com/).

Genotyping of the vacA s- (s1 or s2), m- (m1 or m2), i- (i1 or i2), d- (d1 or d2), and c- (c1 or c2) regions was performed following previously described methods [43–46]. Multiple sequence alignments of the vacA sequences were generated via MAFFT 7 (http://mafft.cbrc.jp/alignment/server/). The genotyping of the s- and m-regions of vacA was performed according to the method of Atherton et al. [43, 46], the i- and d-regions were typed according to the method of Ogiwara et al. [44], and the c-region was determined via the method of Bakhti et al. [45].

Statistical analysis

Statistical analyses were conducted via SPSS statistical software version 20 (SPSS, Chicago, USA). The chi-square (χ2) test and Fisher’s exact test were used to assess the associations between each genotype and different regions, as well as clinical outcomes. A logistic regression model was used to evaluate the relationships between the candidate genes and clinical outcomes. The odds ratio (OR) and 95% confidence interval (CI) were obtained for multivariate analysis and used to estimate the risk. P < 0.05 was considered statistically significant.

Results

Patient characteristics

A total of 87 H. pylori strains (87/305, 28.52%) were successfully isolated from dyspeptic patients, consisting of 62 males (age range: 32–78 years; mean age: 58.06 ± 8.53 years) and 25 females (age range: 36–73 years; mean age: 54.84 ± 9.59 years). Among these strains, 67 strains were isolated from subjects with CG, 10 from PUD patients (4 with GU and 6 with DU), and 10 from GC patients. Stratified analyses were conducted on the basis of sex distribution: females (25/87, 28.74%) and males (62/87, 71.26%), as well as two age categories: patients aged <55 years (37/87, 42.53%) and those aged ≥55 years (50/87, 57.47%). Within the CG group, further classification identified chronic superficial gastritis (CSG) in 16 patients (23.88%) and chronic atrophic gastritis (CAG) in 51 patients (76.12%) based on the presence or absence of glandular atrophy. Among the GC patients, all individuals were aged over 55 years, with 80% being male. Statistical analyses revealed a significant association between age and GC (P = 0.007), whereas no statistically significant difference was detected between sex and GC (P = 0.260) (Table 1).

10.1371/journal.pone.0309844.t001 Table 1 Characteristics of patients enrolled in this study.

Types of diseases	No. of patients (%)	Age groups	Sex groups	
No. of ≥55 (%)	No. of <55 (%)	No. of males (%)	No. of females (%)	
CG	67/87 (77.01)	33/67 (49.25)	34/67 (50.75)	49/67 (73.13)	18/67 (26.87)	
CSG	16/67 (23.88)	7/16 (43.75)	9/16 (56.25)	10/16 (62.5)	6/16 (37.5)	
CAG	51/67 (76.12)	26/51 (50.98)	25/51 (49.02)	39/51 (76.47)	12/51 (23.53)	
PUD	10/87 (11.49)	7/10 (70)	3/10 (30)	5/10 (50)	5/10 (50)	
GU	4/10 (40)	3/4 (75)	1/4 (25)	1/4 (25)	3/4 (75)	
DU	6/10 (60)	4/6 (66.67)	2/6 (33.33)	4/6 (66.67)	2/6 (33.33)	
GC	10/87 (11.49)	10/10 (100) a	0 (0)	8/10 (80)	2/10 (20)	
Total	87/87 (100)	50/87 (57.47)	37/87 (42.53)	62/87 (71.26)	25/87 (28.74)	
CG: chronic gastritis; CSG: chronic superficial gastritis; CAG: chronic atrophic gastritis; PUD: peptic ulcer disease; GU: gastric ulcer; DU: duodenal ulcer; GC: gastric cancer. a Boldface data indicate a significant difference.

The prevalence of H. pylori cagA and vacA genotypes

All strains tested were successfully detected for the cagA and vacA genotypes. Among these strains, 62 strains were isolated from Jinan (53 with CG and 9 with PUD), and 25 were isolated from Weihai (14 with CG, 1 with PUD, and 10 with GC). As shown in S1 Table, we analyzed the distribution of cagA and vacA genotypes based on age, gender, and diseases. Statistical analysis showed no significant association between different genotypes and age and gender, and no statistically significant difference was observed between different genotypes in GSC and GAC. The distributions of the cagA and vacA genotypes in Shandong are summarized in Table 2. The East Asian-type cagA was predominant, constituting 87.36% (76/87) of the strains, whereas the Western-type cagA was identified in 12.64% (11/87) of the cases. The prevalence of the East Asian-type cagA was 85.48% in Jinan and 92% in Weihai, whereas that of the Western-type cagA was present in 14.52% and 8% of strains from Jinan and Weihai, respectively. Statistical analysis revealed no significant differences in the distribution of the cagA genotypes between the two distinct regions (χ2 = 0.685, P > 0.05).

10.1371/journal.pone.0309844.t002 Table 2 Prevalence of H. pylori cagA and vacA genotypes in Shandong.

Genotypes	No. of isolates	
Jinan (n = 62)	Weihai (n = 25)	Total (n = 87)	
cagA	62 (100)	25 (100)	87 (100)	
East Asian-type cagA	53 (85.48)	23 (92)	76 (87.36)	
Western-type cagA	9 (14.52)	2 (8)	11 (12.64)	
vacA	62 (100)	25 (100)	87 (100)	
s1	62 (100)	25 (100)	87 (100)	
s2	0 (0)	0 (0)	0 (0)	
m1	15 (24.19)	11 (44)	26 (29.89)	
m2	47 (75.81)	14 (56)	61 (70.11)	
i1	52 (83.87)	21 (84)	73 (83.91)	
i2	10 (16.13)	4 (16)	14 (16.09)	
d1	54 (87.10)	22 (88)	76 (87.36)	
d2	8 (12.90)	3 (12)	11 (12.64)	
c1	10 (16.13)	8 (32)	18 (20.69)	
c2	52 (83.87)	17 (68)	69 (79.31)	
s1m1i1	15 (24.19)	11 (44)	26 (29.89)	
s1m1d1	15 (24.19)	11 (44)	26 (29.89)	
s1m1c1	10 (16.13)	8 (32)	18 (20.69)	
s1m1i2	0 (0)	0 (0)	0 (0)	
s1m1d2	0 (0)	0 (0)	0 (0)	
s1m1c2	5 (8.06)	3 (12)	8 (9.20)	
s1m2i1	37 (59.68)	10 (40)	47 (54.02)	
s1m2d1	39 (62.9)	11 (44)	50 (57.47)	
s1m2c1	0 (0)	0 (0)	0 (0)	
s1m2i2	10 (16.13)	4 (16)	14 (16.09)	
s1m2d2	8 (12.9)	3 (12)	11 (12.64)	
s1m2c2	47 (75.81)	14 (56)	61 (70.11)	
s1m2i1d1c2	35 (56.45)	9 (36)	44 (50.57)	
s1m1i1d1c1	10 (16.13)	8 (32)	18 (20.69)	
s1m1i1d1c2	5 (8.06)	3 (12)	8 (9.20)	
s1m2i2d2c2	6 (9.68)	2 (8)	8 (9.20)	
s1m2i2d1c2	4 (6.45)	2 (8)	6 (6.90)	
s1m2i1d2c2	2 (3.23)	1 (4)	3 (3.45)	
Values in parentheses are percentages.

The vacA genotypes were evaluated based on the five polymorphic regions: the s-, m-, i-, d-, and c-regions. All strains were successfully identified by their vacA genotypes, which were classified as s1, s2, m1, m2, i1, i2, d1, d2, c1, and c2 in 87 (100%), 0 (0), 26 (29.89%), 61 (70.11%), 73 (83.91%), 14 (16.09%), 76 (87.36%), 11 (12.64%), 18 (20.69%), and 69 (79.31%) strains, respectively (Table 2). Statistical analysis revealed no significant differences in the vacA genotypes between the two different regions (P > 0.05). For the combination of the vacA s-, m-, i-, d-, and c-regions, 44 strains (50.57%) presented s1m2i1d1c2, followed by 18 strains (20.69%) with s1m1i1d1c1, 8 strains (9.20%) with s1m1i1d1c2, 8 strains (9.20%) with s1m2i2d2c2, 6 strains (6.90%) with s1m2i2d1c2, and 3 strains (3.45%) with s1m2i1d2c2. The two most common vacA genotype combinations were s1m2i1d1c2 and s1m1i1d1c1 in the two different regions, but the differences were not statistically significant (P > 0.05). An examination of the two different regions of the vacA genotype revealed that all strains possessing s1 and m1 also carried i1 and d1 (26/87, 29.89%). Conversely, strains containing the s1 and m2 genotypes predominantly harbored the c2 genotype (68.97%, 60/87). Furthermore, the investigation revealed the presence of every type of i-region and d-region among strains characterized by the s1 and m2 vacA genotypes (Table 2).

Associations between virulence factors and clinical outcomes

As shown in Table 3, the East Asian-type cagA was present in 88.06% of isolates from CG patients, 80% from PUD patients, and 90% from GC patients, whereas the Western-type cagA was identified in 11.94%, 20%, and 10%, respectively. In this study, there was no significant difference between the East Asian-type or Western-type cagA genotypes and clinical outcomes (P > 0.05). A total of 13.21% of GC patients were infected with Western-type cagA strains in Jinan, which was higher than that in Weihai (7.14%); however, the difference was not statistically significant (P > 0.05).

10.1371/journal.pone.0309844.t003 Table 3 Association between H. pylori virulence factors and clinical outcomes.

Genotypes	No. of isolates	
Jinan (n = 62)	Weihai (n = 25)	Total (n = 87)	
CG (53)	PUD (9)	GC (0)	CG (14)	PUD (1)	GC (10)	CG (67)	PUD (10)	GC (10)	
cagA										
East Asian-type cagA	46 (86.79)	7 (77.78)	0 (0)	13 (92.86)	1 (100)	9 (90)	59 (88.06)	8 (80)	9 (90)	
Western-type cagA	7 (13.21)	2 (22.22)	0 (0)	1 (7.14)	0(0)	1 (10)	8 (11.94)	2 (20)	1 (10)	
vacA			0 (0)							
s1	53 (100)	9 (100)	0 (0)	14 (100)	1 (100)	10 (100)	67 (100)	10 (100)	10 (100)	
s2	0 (0)	0 (0)	0 (0)	0 (0)	0 (0)	0 (0)	0 (0)	0 (0)	0 (0)	
m1	14 (26.42)	1 (11.11)	0 (0)	4 (28.57)	1 (100)	6 (60)	18 (26.87)	2 (20)	6 (60) a	
m2	39 (73.58)	8 (88.89)	0 (0)	10 (71.43)	0 (0)	4 (40)	49 (73.13)	8 (80)	4 (40)	
i1	45 (84.91)	7 (77.78)	0 (0)	12 (85.71)	1(100)	8 (80)	57 (85.07)	8 (80)	8 (80)	
i2	8 (15.09)	2 (22.22)	0 (0)	2 (14.29)	0 (0)	2 (20)	10 (14.93)	2 (20)	2 (20)	
d1	46 (86.79)	8 (88.89)	0 (0)	12 (85.71)	1 (100)	9 (90)	58 (86.57)	9 (90)	9 (90)	
d2	7 (13.21)	1 (11.11)	0 (0)	2 (14.29)	0 (0)	1 (10)	9 (13.43)	1 (10)	1 (10)	
c1	10 (18.87)	0 (0)	0 (0)	3 (21.43)	0 (0)	5 (50)	13 (19.40)	0 (0)	5 (50) a	
c2	43 (81.13)	9 (100)	0 (0)	11 (78.57)	1 (100)	5 (50)	54 (80.60)	10 (100)	5 (50)	
m1i1	14 (26.42)	1 (11.11)	0 (0)	4 (28.57)	1 (100)	6 (60)	18 (26.87)	2 (20)	6 (60) a	
m2i2	8 (15.09)	2 (22.22)	0 (0)	2 (14.29)	0 (0)	2 (20)	10 (14.93)	2 (20)	2 (20)	
m1d1	14 (26.42)	1 (11.11)	0 (0)	4 (28.57)	1 (100)	6 (60)	18 (26.87)	2 (20)	6 (60) a	
m2d2	7 (13.21)	1 (11.11)	0 (0)	2 (14.29)	0 (0)	1 (10)	9 (13.43)	1 (10)	1 (10)	
m1c1	10 (18.87)	0 (0)	0 (0)	3 (21.43)	0 (0)	5 (50)	13 (19.40)	0 (0)	5 (50) a	
m2c2	39 (73.58)	8 (88.89)	0 (0)	10 (71.43)	0 (0)	4 (40)	49 (73.13)	8 (80)	4 (40)	
i1d1	43 (81.13)	7 (77.78)	0 (0)	11 (78.57)	1 (100)	8 (80)	54 (80.60)	8 (80)	8 (80)	
i2d2	5 (9.43)	1 (11.11)	0 (0)	1 (7.14)	0 (0)	1 (10)	6 (8.96)	1 (10)	1 (10)	
i1c1	10 (18.87)	0 (0)	0 (0)	3 (21.43)	0 (0)	5 (50)	13 (19.40)	0 (0)	5 (50) a	
i2c2	8 (15.09)	2 (22.22)	0 (0)	2 (14.29)	0 (0)	2 (20)	10 (14.93)	4 (40)	0 (0)	
d1c1	10 (18.87)	0 (0)	0 (0)	3 (21.43)	0 (0)	5 (50)	13 (19.40)	0 (0)	5 (50) a	
d2c2	7 (13.21)	1 (11.11)	0 (0)	2 (14.29)	0 (0)	1 (10)	9 (13.43)	1 (10)	1 (10)	
m1i1d1	14 (26.42)	1 (11.11)	0 (0)	4 (28.57)	1 (100)	6 (60)	18 (26.87)	2 (20)	6 (60) a	
m2i2d2	5 (9.43)	1 (11.11)	0 (0)	1 (7.14)	0 (0)	1 (10)	6 (8.96)	1 (10)	1 (10)	
m1i1c1	10 (18.87)	0 (0)	0 (0)	3 (21.43)	0 (0)	5 (50)	13 (19.40)	0 (0)	5 (50) a	
m2i2c2	8 (15.09)	2 (22.22)	0 (0)	2 (14.29)	0 (0)	2 (20)	10 (14.93)	2 (20)	2 (20)	
m1d1c1	10 (18.87)	0 (0)	0 (0)	3 (21.43)	0 (0)	5 (50)	13 (19.40)	0 (0)	5 (50) a	
m2d2c2	7 (13.21)	1 (11.11)	0 (0)	2 (14.29)	0 (0)	1 (10)	9 (13.43)	1 (10)	1 (10)	
i1d1c1	10 (18.87)	0 (0)	0 (0)	3 (21.43)	0 (0)	5 (50)	13 (19.40)	0 (0)	5 (50) a	
i2d2c2	5 (9.43)	1 (11.11)	0 (0)	1 (7.14)	0 (0)	1 (10)	6 (8.96)	1 (10)	1 (10)	
m1i1d1c1	10 (18.87)	0 (0)	0 (0)	3 (21.43)	0 (0)	5 (50)	13 (19.40)	0 (0)	5 (50) a	
m2i2d2c2	5 (9.43)	1 (11.11)	0 (0)	1 (7.14)	0 (0)	1 (10)	6 (8.96)	1 (10)	1 (10)	
s1m2i1d1c2	29 (54.72)	6 (66.67)	0 (0)	7 (50)	0 (0)	2 (20)	36 (53.73)	6 (60)	2 (20)	
s1m1i1d1c1	10 (18.87)	0 (0)	0 (0)	3 (21.43)	0 (0)	5 (50)	13 (19.40)	0 (0)	5 (50) a	
s1m1i1d1c2	4 (7.55)	1 (11.11)	0 (0)	1 (7.14)	1 (100)	1 (10)	5 (7.46)	2 (20)	1 (10)	
s1m2i2d2c2	5 (9.43)	1 (11.11)	0 (0)	1 (7.14)	0 (0)	1 (10)	6 (8.96)	1 (10)	1 (10)	
s1m2i2d1c2	3 (5.66)	1 (11.11)	0 (0)	1 (7.14)	0 (0)	1 (7.14)	4 (5.97)	1 (10)	1 (10)	
s1m2i1d2c2	2 (3.77)	0 (0)	0 (0)	1 (7.14)	0 (0)	0 (0)	3 (4.48)	0 (0)	0 (0)	
CG: chronic gastritis; PUD: peptic ulcer disease; GC: gastric cancer. Values in parentheses are percentages. a Boldface data indicate a significant difference.

The prevalence of the vacA m1 genotype was significantly greater in strains from GC patients (60%) than in those from CG patients (26.87%) (χ2 = 5.472, P < 0.05; Table 3). The vacA c1 genotype was significantly more prevalent in strains from GC patients (50%) than in those from CG patients (19.40%) (χ2 = 5.915, P < 0.05). The results of the univariate analysis revealed that vacA m1 and c1 genotypes were positively correlated with GC and increased the risk of GC (OR = 4.275; 95% CI, 1.093–16.720; P = 0.027; and OR = 4.923; 95% CI, 1.244–19.482; P = 0.015, respectively). In contrast, the presence of vacA m2 and c2 genotypes was negatively correlated with GC and significantly decreased the risk of GC (OR = 0.234; 95% CI, 0.060–0.915; P = 0.027; and OR = 0.203; 95% CI, 0.051–0.804; P = 0.015, respectively). There was no significant association between the other vacA genotypes and different diseases (P > 0.05, Table 4). The presence of the vacA m1 and c1 genotypes in combination with the other genotypes further increased the risk of GC. The ORs for vacA m1i1 were 4.275 (95% CI, 1.093–16.720; P = 0.027), m1d1 4.275 (95% CI, 1.093–16.720; P = 0.027), m1c1 4.923 (95% CI, 1.244–19.482; P = 0.015), i1c1 4.923 (95% CI, 1.244–19.482; P = 0.015), d1c1 4.923 (95% CI, 1.244–19.482; P = 0.015), m1i1d1 4.275 (95% CI, 1.093–16.720; P = 0.027), m1i1c1 4.923 (95% CI, 1.244–19.482; P = 0.015), m1d1c1 4.923 (95% CI, 1.244–19.482; P = 0.015), i1d1c1 4.923 (95% CI, 1.244–19.482; P = 0.015), m1i1d1c1 4.923 (95% CI, 1.244–19.482; P = 0.015), and s1m1i1d1c1 4.923 (95% CI, 1.244–19.482; P = 0.015). The associations of the other vacA genotype combinations with clinical outcomes are shown in Table 4. We used multivariate analysis to examine the relative importance of the vacA m and c genotypes as risk factors for GC. The results demonstrated that the only factor with a significant adjusted OR was the vacA c1 genotype, and the OR was 5.174 (95% CI, 1.402–20.810; P = 0.012). The statistical analysis revealed a significantly greater frequency of the vacA c1 genotype in male patients with GC aged ≥55 years than in male patients with CG aged ≥55 years, with a multivariate analysis OR of 4.386 (95% CI, 1.341–19.248; P = 0.023).

10.1371/journal.pone.0309844.t004 Table 4 The relationship between H. pylori vacA genotypes and clinical outcomes.

Genotypes	CG	PUD	GC a	
OR	95%CI	P	OR	95%CI	P	OR	95%CI	P	
m1	0.551	0.194–1.567	0.260	0.552	0.109–2.798	0.468	4.275	1.093–16.720	0.027	
m2	1.815	0.638–5.160	0.260	1.811	0.357–9.178	0.468	0.234	0.060–0.915	0.027	
i1	1.425	0.394–5.152	0.588	0.738	0.139–3.913	0.721	0.369	0.090–1.423	0.136	
i2	0.702	0.194–2.537	0.588	1.345	0.256–7.175	0.721	2.708	0.703–10.437	0.136	
d1	0.716	0.142–3.621	0.685	1.343	0.153–11.767	0.789	1.343	0.153–11.767	0.789	
d2	1.397	0.276–7.063	0.685	0.744	0.085–6.521	0.789	0.744	0.085–6.521	0.789	
c1	0.722	0.222–2.349	0.588	1.169	1.061–1.289	0.086	4.923	1.244–19.482	0.015	
c2	1.385	0.426–4.503	0.588	0.855	0.776–0.942	0.086	0.203	0.051–0.804	0.015	
m1i1	0.551	0.194–1.567	0.260	0.552	0.109–2.798	0.468	4.275	1.093–16.720	0.027	
m2i2	0.702	0.194–2.537	0.588	1.345	0.256–7.175	0.721	1.354	0.256–7.175	0.721	
m1d1	0.551	0.194–1.567	0.260	0.552	0.109–2.798	0.468	4.275	1.093–16.720	0.027	
m2d2	1.397	0.276–7.063	0.685	0.744	0.085–6.521	0.789	0.744	0.085–6.521	0.789	
m1c1	0.722	0.222–2.349	0.588	1.169	1.061–1.289	0.086	4.923	1.244–19.482	0.015	
m2c2	1.185	0.638–5.160	0.260	1.811	0.357–9.178	0.468	0.234	0.060–0.915	0.027	
i1d1	1.038	0.297–3.631	0.953	0.968	0.186–5.034	0.969	0.968	0.186–5.034	0.969	
i2d2	0.885	0.164–4.771	0.887	1.111	0.122–10.101	0.925	1.111	0.122–10.101	0.925	
i1c1	0.722	0.222–2.349	0.588	1.169	1.061–1.289	0.086	4.923	1.244–19.482	0.015	
i2c2	0.702	0.194–2.537	0.588	1.050	0.954–1.155	0.656	1.159	1.058–1.270	0.141	
d1c1	0.722	0.222–2.349	0.588	1.169	1.061–1.289	0.086	4.923	1.244–19.482	0.015	
d2c2	1.397	0.276–7.063	0.685	0.744	0.085–6.521	0.789	0.744	0.085–6.521	0.789	
m1i1d1	0.551	0.194–1.567	0.260	0.552	0.109–2.798	0.468	4.275	1.093–16.720	0.027	
m2i2d2	0.885	0.164–4.771	0.887	1.111	0.122–10.101	0.925	1.111	0.122–10.101	0.925	
m1i1c1	0.722	0.222–2.349	0.588	1.169	1.061–1.289	0.086	4.923	1.244–19.482	0.015	
m2i2c2	0.702	0.194–2.537	0.588	1.345	0.256–7.175	0.721	1.354	0.256–7.175	0.721	
m1d1c1	0.722	0.222–2.349	0.588	1.169	1.061–1.289	0.086	4.923	1.244–19.482	0.015	
m2d2c2	1.397	0.276–7.063	0.685	0.744	0.085–6.521	0.789	0.744	0.085–6.521	0.789	
i1d1c1	0.722	0.222–2.349	0.588	1.169	1.061–1.289	0.086	4.923	1.244–19.482	0.015	
i2d2c2	0.885	0.164–4.771	0.887	1.111	0.122–10.101	0.925	1.111	0.122–10.101	0.925	
m1i1d1c1	0.722	0.222–2.349	0.588	1.169	1.061–1.289	0.086	4.923	1.244–19.482	0.015	
m2i2d2c2	0.885	0.164–4.771	0.887	1.111	0.122–10.101	0.925	1.111	0.122–10.101	0.925	
s1m2i1d1c2	1.742	0.631–4.808	0.281	1.539	0.402–5.889	0.526	0.208	0.042–1.046	0.040	
s1m1i1d1c1	0.722	0.222–2.349	0.588	1.169	1.061–1.289	0.086	4.923	1.244–19.482	0.015	
s1m1i1d1c2	0.457	0.099–2.108	0.306	2.958	0.509–17.184	0.209	1.111	0.122–10.101	0.925	
s1m2i2d2c2	0.885	0.164–4.771	0.887	1.111	0.122–10.101	0.925	1.111	0.122–10.101	0.925	
s1m2i2d1c2	0.571	0.097–3.376	0.533	1.600	0.168–15.273	0.681	1.600	0.168–15.273	0.681	
s1m2i1d2c2	1.313	1.165–1.479	0.336	1.135	1.049–1.228	0.525	1.135	1.049–1.228	0.525	
CG: chronic gastritis; PUD: peptic ulcer disease; GC: gastric cancer. Values in parentheses are percentages. a Boldface data indicate a significant difference.

CagA sequences and EPIYA segment types

In addition to the four major segments originally designated, we previously defined several rare segments, including EPIYA-B’, EPIYA-B”, and EPIYA-D’ [47]. A total of 8 sequence types were obtained from 87 CagA strains. The predominant CagA type was the East Asian-type, with 90.79% (69/76) of East Asian-type CagA strains displaying the typical ABD types, whereas only 3.95% (3/76) were ABD’. Only 11 strains carried the Western-type CagA, which included the AB, ABC, ABCC, and C subtypes. The distributions of the EPIYA segment types of CagA in various clinical outcomes are shown in Table 5. The prevalence of ABD was 90% (9/10) in GC patients, which was higher than the percentages reported in CG (79.10%) and PUD patients (70%). However, the difference was not significant (χ2 = 1.226, P > 0.05).

10.1371/journal.pone.0309844.t005 Table 5 Association between EPIYA segment types of CagA and clinical outcomes.

Type	No. of isolates	
CG (67)	PUD (10)	GC (10)	Total (n = 87)	
East Asian-type CagA					
ABD	53 (79.10)	7 (70)	9 (90)	69 (79.31)	
ABD’	3 (4.48)	0 (0)	0 (0)	3 (4.84)	
BD	1 (1.49)	0 (0)	0 (0)	1 (1.15)	
D	2 (2.99)	1 (10)	0 (0)	3 (3.45)	
Total	59 (88.06)	8 (80)	9 (90)	76 (87.36)	
Western-type CagA					
AB*	1 (1.49)	0 (0)	0 (0)	1 (1.15)	
ABC	5 (7.46)	2 (20)	0 (0)	7 (8.05)	
ABCC	0 (0)	0 (0)	1 (10)	1 (1.15)	
C	2 (3.77)	0 (0)	0 (0)	2 (2.30)	
Total	8 (11.94)	2 (20)	1 (10)	11 (12.64)	
CG: chronic gastritis; PUD: peptic ulcer disease; GC: gastric cancer. Values in parentheses are percentages. *AB type was defined as Western-type CagA according to the sequence of B segment (TGQVANLEEPIYTQVAKKVKAKIDRLNQIASGLGGVGQAAG for Western-type B segment and TGQVASPEEPIYAQVAKKVSAKIDQLNEATS for East Asian-type B segment).

Through sequence alignment, variations in amino acid sequences were observed within the same segments, particularly in segments BC and BD. Furthermore, the amino acid sequences of segments C and D displayed distinct differences when analyzed via WebLogo 3 (Fig 1). The EPIYA motifs in these strains were also evaluated (Table 6). A total of 250 EPIYA motifs were obtained from the 87 CagA strains, including 4 types of EPIYA or EPIYA-like sequences. The three most frequent EPIYA motifs were EPIYA (231/250 = 92.4%), EPIYT (5.2%), and ESIYA (2.16%), which was consistent with our previous study that examined 503 CagA strains deposited in GenBank [47]. The EPIYA-B motif displayed the greatest degree of variation in the five amino acids (e.g., EPIYA, EPIYT, and ESIYA), with EPIYT being more prevalent than EPIYA in the Western-type CagA strains (90% versus 10%).

10.1371/journal.pone.0309844.g001 Fig 1 Variation in the CagA amino acid sequence of East Asian-type and Western-type CagA.

10.1371/journal.pone.0309844.t006 Table 6 Frequencies of the four types of EPIYA motifs.

Type	A motif	B motif	C or D motif	All motifs	
Motif	No.	Motif	No.	Motif	No.	Motif	No.	
All CagA type	EPIYA	80	EPIYA	65	EPIYA	86	EPIYA	231	
	KPIYA	1	EPIYT	13			EPIYT	13	
			ESIYA	5			ESIYA	5	
							KPIYA	1	
Total		81		83				250	
East Asian-type CagA	EPIYA	71	EPIYA	64	EPIYA	76	EPIYA	211	
	KPIYA	1	EPIYT	4			EPIYT	4	
			ESIYA	5			ESIYA	5	
							KPIYA	1	
Total		72		73		76		221	
Western-type CagA	EPIYA	9	EPIYA	1	EPIYA	10	EPIYA	20	
			EPIYT	9			EPIYT	9	
Total		9		10		10		29	

CM motifs and patterns

In total, 100 CM motifs were found in 87 cagA-positive strains (11 for the 1st CM motif, 88 for the 2nd CM motif, and 1 for the 3rd CM motif). These CM motifs were classified into 28 types, encompassing 8 types in the 1st CM motif, 24 in the 2nd CM motif, and 1 in the 3rd CM motif (Table 7). As shown in Fig 2, the most common Western CM motif type was FPLKRHDKVDDLSKVG, and the most common East Asian CM motif type was FPLRRSAAVNDLSKVG. In this study, sequences demonstrating four or more matching positions with the typical W-CM were designated W-CM motifs, and similarly, those with four or more matching positions with the typical E-CM were designated E-CM motifs. Other sequence types were categorized as different CM (D-CM) motifs. As shown in Table 7, in the 1st CM motif, 8 strains were W-CM, and 3 were D-CM. In the 2nd CM motif, 62 strains were E-CM, 11 were W-CM, and 15 were D-CM. In the 3rd CM motif, 1 strain was W-CM. The combinations of the 1st, 2nd, and 3rd CM motifs are shown in Table 8, with the three most common CM motif patterns being E (n = 58), followed by D (n = 14), and W-W (n = 5). Next, we analyzed the associations between CM motif patterns and clinical outcomes (Table 9). The CM pattern E was present in 68.66%, 80%, and 40% of the strains isolated from patients with CG, PUD, and GC, respectively. However, the difference was not significant (χ2 = 4.119, P > 0.05). Conversely, the CM pattern D was significantly more common in strains from GC (50%) patients than in those from CG patients (13.43%) (χ2 = 7.821, P < 0.01). W-W pattern was present in patients diagnosed with GC. These findings suggested that CagA proteins containing D-CM motifs or multiple W-CM motifs were more virulent than those containing other CM motifs.

10.1371/journal.pone.0309844.g002 Fig 2 The CM motifs in Western-type and East Asian-type CagA from Shandong strains.

10.1371/journal.pone.0309844.t007 Table 7 Peptide sequences and types of CM motif in H. pylori strains.

First motif	Second motif	Third motif	
Peptide sequences	Type	No.	Peptide sequences	Type	No.	Peptide sequences	Type	No.	
FPLKRHDKVGDLSKVG	W-CM	2	FPLRRYAPVDDLSKVG	D-CM	2	FPLKRHDKVDDLSKVG	W-CM	1	
FPLKKHDKVGDLSKVG	W-CM	1	FPLKKHDKVGDLSKVG	W-CM	2				
FSLKGHTKVDDLSKVG	D-CM	2	FPLRRSAAVNDLSKVG	E-CM	48				
FPLKRHDKVHDLSKVG	W-CM	1	FPLRRSTAVNDLSKVG	E-CM	4				
MKRHDKVDDLSKVG	W-CM	2	FPLRRSAAVNDLSKVR	E-CM	1				
FPLKKHDKVDDLSKVG	W-CM	1	FPLKRHDKVDDLSKVG	W-CM	7				
FPLKRHTKVDDLSKVG	D-CM	1	FPLMRSTAVNDLSKVG	E-CM	1				
FPLKRHDKVDDLSKVG	W-CM	1	FPLRRHAAVNDLSKVG	E-CM	1				
			FPLRRSAAVGNLSKVG	E-CM	1				
			FPLRRSATVNDLSKVG	E-CM	1				
			FPLRRYAGFDDLSKVG	D-CM	1				
			FPLRRSAGVNDLSKVG	E-CM	3				
			FPLKRHDKVHDLSKVG	W-CM	1				
			FPLRRYAAVGDLSKVG	D-CM	1				
			FPLRRYAAVNDLSKVG	E-CM	1				
			FPLRRAAAVNDLSKVG	E-CM	1				
			FPLRRSAGVGDLSKVG	D-CM	3				
			FPLKRHDKVGDLSKVG	W-CM	1				
			FPLRRHAGVGDLSKVG	D-CM	2				
			FPLRKYAGVDDLSKVG	D-CM	1				
			FPLRRYAGVNDLSKVG	D-CM	1				
			FPLRRYAGVGDLSKVG	D-CM	2				
			FPLTRHTKVDDLSKVG	D-CM	1				
			FSLKRYAGVNDLSKVG	D-CM	1				
Total		11	Total		88	Total		1	

10.1371/journal.pone.0309844.t008 Table 8 CM motif patterns in H. pylori strains.

CM motif pattern	Occurrence (n = 87)	Frequency (%)	
E	58	66.67	
D	14	16.09	
W-W	5	5.75	
W	4	4.6	
W-E	2	2.3	
D-E	1	1.15	
D-W	1	1.15	
W-D	1	1.15	
W-W-W	1	1.15	
CM motif patterns were determined according to the identification of CM sequences that were located before and after the EPIYA-C or EPIYA-D motifs. E: Strains with one East Asian CM motif in their CagA; D: Strains with one Different CM motif in their CagA; W-W: Strains with two Western CM motifs in their CagA; W: Strains with one Western CM motif in their CagA; W-E: Strains with one Western and one East Asian CM motif in their CagA; D-E: Strains with one Different and one East Asian CM motif in their CagA; D-W: Strains with one Different and one Western CM motif in their CagA; W-D: Strains with one Western and one Different CM motif in their CagA; W-W-W: Strains with three Western CM motifs in their CagA.

10.1371/journal.pone.0309844.t009 Table 9 Association between CM motif patterns and clinical outcomes.

CM motif pattern	No. of isolates	
CG (67)	PUD (10)	GC (10)	Total (n = 87)	
E	46 (68.66)	8 (80)	4 (40)	58 (66.67)	
D	9 (13.43)	0 (0)	5 (50) a	14 (16.09)	
W-W	4 (5.97)	1 (10)	0 (0)	5 (5.75)	
W	4 (5.97)	0 (0)	0 (0)	4 (4.60)	
W-E	2 (2.99)	0 (0)	0 (0)	2 (2.30)	
D-E	1 (1.49)	0 (0)	0 (0)	1 (1.15)	
D-W	0 (0)	1 (10)	0 (0)	1 (1.15)	
W-D	1 (1.49)	0 (0)	0 (0)	1 (1.15)	
W-W-W	0 (0)	0 (0)	1 (10)	1 (1.15)	
CG: chronic gastritis; PUD: peptic ulcer disease; GC: gastric cancer. Values in parentheses are percentages. a Boldface data indicate a significant difference.

Discussion

The enduring and intricate coexistence of H. pylori with humans is notable, with specific bacterial lineages intricately linked to human lineages in specific regions [48]. The genomic structure of H. pylori exhibits a remarkable degree of variability, revealing substantial differences among different strains. This high variability and polymorphism resulting from genetic mutations account for the variations in the virulence and pathogenicity of H. pylori [49]. Therefore, identifying the genetic characteristics and polymorphisms of H. pylori virulence factors is essential for identifying correlations between virulence gene profiles and gastrointestinal diseases. In this study, we determined the prevalence of the cagA and vacA genotypes in 87 H. pylori isolates from Shandong and explored their associations with clinical outcomes. These findings highlight significant associations between specific virulence factors and various clinical outcomes, emphasizing the pivotal role of these factors in the development of diseases.

There are large variations in the prevalence of H. pylori infection worldwide, which can vary depending on various factors, such as socioeconomic status, access to healthcare, and hygiene conditions. The global infection rate of H. pylori is approximately 50%, and the infection rates in some populations reach 80%-90%. H. pylori infection is widespread in developing countries, with the highest rate of 80% or more among adults in Africa [50]. America has a relatively low prevalence of H. pylori infection, and the prevalence is declining in Western countries because of better healthcare and improved living conditions [51]. In recent years, with economic development, improvements in sanitation, and the implementation of public health measures, the prevalence of H. pylori in China has been declining. In the present study, a relatively low H. pylori positivity rate of 28.52% was observed. According to the latest estimates, the prevalence of H. pylori infection in mainland China is 44.2%. In different geographical regions of China, the prevalence of H. pylori was also evaluated, and the highest rate was 66.4% in Xizang, followed by Gansu (57.2%) and Hebei (52.4%). In contrast, Chongqing, Tianjin, Hunan, and Jilin had the lowest prevalence rates of 35.4%, 36.3%, 37.0%, and 37.6%, respectively [1].

It is widely believed that cagA is one of the most important virulence factors intricately linked to increased susceptibility to CG, PUD, precancerous lesions, and GC [52, 53]. The prevalence of cagA ranges from 50% to 70% in Western countries [54, 55]; in contrast, almost all H. pylori strains in East Asian countries carry the cagA gene, which may be attributed to the higher incidence rate of GC in East Asian countries than in Western countries [1]. The prevalence of the cagA gene in the present study aligned with findings in other Asian countries and some regions of China where the prevalence of cagA-positive strains was above 90% [56–58]. Moreover, our investigation revealed a predominance of the East Asian-type cagA, with only 12.64% exhibiting the Western-type cagA. While previous studies in Japan, Spain, Iraq, and Turkey have demonstrated the association of cagA strains with GC or PUD [59–62], our study did not reveal any associations between the cagA genotypes and clinical outcomes, which was consistent with our previous study [40].

In the present study, no significant differences were observed between the frequencies of the vacA s1 genotype and clinical outcomes, which was inconsistent with previous studies where vacA s1 was related to an increased risk of both GC and PUD [36, 63]. Notably, the prevalence of the vacA m1 genotype was 60%, 26.87%, and 20% in patients with GC, CG, and PUD, respectively. Statistical analysis revealed a noteworthy association between the vacA m1 genotype and GC (OR = 4.275), whereas no such association was observed for CG or PUD. These results were in agreement with those of previous studies from Portugal, America, and the Netherlands [33, 44, 45, 64] but differed from those of other reports that identified an association between the vacA m1 genotype and PUD [36, 65], suggesting differences between strains from different regions. The vacA i-region, recognized as a key determinant in vacuole-creating activity, has been implicated in the risk for GC and PUD [34, 38, 66]. In contrast to studies in Western countries [44, 67, 68], the present study did not reveal any associations between the vacA i1 genotype and clinical outcomes. With respect to the d-region, the vacA d1 genotype, when associated with the s1, m1, and i1 genotypes, demonstrated an increased risk of GC [44]. Additionally, studies have shown that the vacA d1 genotype is significantly associated with GC [32, 45] and PUD [69]. In the present study, the frequency of the vacA d1 genotype was greater in patients with PUD and GC (90%) than in those with CG (86.57%), but the difference did not reach significance. Notably, the vacA c1 genotype was significantly associated with the risk of GC in Shandong (P < 0.05). Statistical analysis revealed that the frequency of the vacA c1 genotype in GC patients (50%) was greater than that in CG patients (19.4%), yielding an OR of 4.923. Additionally, the combined presence of the vacA m1 and c1 genotypes, along with the vacA i1 and d1 genotypes, further increased susceptibility to GC, with the vacA m1i1c1 genotype combination showing the highest risk (OR = 5.417). Despite these associations, the biological role of this genotype combination in terms of vacuolar production activity and disease incidence remains unclear. In summary, simple logistic regression model analyses demonstrated a significant association of the vacA m1 and c1 genotypes with the risk of GC, whereas the s1, i1, d1, and cagA genotypes did not exhibit such associations. However, multivariate analysis revealed that the vacA c1 genotype was most strongly associated with an increased risk of GC, with an OR of 5.174. Statistical analysis revealed a significant association in male patients with GC aged ≥55 years (OR = 4.386).

We confirmed the prevalent presence of the East Asian-type CagA in the H. pylori strains from Shandong, demonstrating an association with more severe gastric mucosal inflammation and a greater incidence of GC than the Western-type CagA. Among the East Asian-type CagA strains in Shandong, the CagA ABD type was predominant (90.79%). Previous studies have indicated a greater incidence of PUD and GC in patients infected with strains carrying multiple EPIYA-C segments than in those with a single segment [70, 71]. However, in our study, only one CagA sequence contained two EPIYA-C segments, and no significant correlation was detected between the number of EPIYA-C segments in the Western-type CagA strains and clinical outcomes. Additionally, single amino acid variations in EPIYA motifs exhibited differences, suggesting a potential role in the varying virulence of H. pylori strains. In Shandong, EPIYA (92.4%) was the predominant type, followed by EPIYT (5.2%) and ESIYA (2.16%). Previous studies reported that the EPIYA-B motif displayed the greatest variation in the Western-type CagA but was very rare in the East Asian-type CagA [72, 73]. Our previous study of 1,587 EPIYA motifs from 503 CagA strains revealed that 92.1% were EPIYA, followed by EPIYT (4.7%) and ESIYA (1.4%) [47]. Zhang et al. reported that there was a significant correlation between EPIYT sequences and GC [72]. The role of EPIYT sequences in the pathogenesis of H. pylori-associated disease needs further study.

The variations in Western (W-) and East Asian (E-) CM motifs and their correlation with clinical outcomes remain underexplored in Shandong. Our analysis revealed a substantial degree of heterogeneity in the arrangement of W- and E-CM motifs. Twenty-eight kinds of CM motifs were observed in 87 cagA-positive strains, which was greater in number than those in Myanmar, Thailand, and Bangladesh [74–76]. Conversely, the number of CM motifs in Shandong was comparable to findings in Colombia and America [25, 26]. The CM motif pattern with the greatest number of occurrences was E, followed by D and W-W. The analysis of the CM motif patterns in our study suggested that the CM pattern D was significantly greater in strains from GC patients than in those from CG patients, which was inconsistent with the findings of previous studies [25, 26]. Research has shown that CagA proteins with two or more W-CM motifs were associated with more severe gastric disorders, such as PUD and GC, which was consistent with our findings that the W-W pattern was present only in patients diagnosed with GC [25]. Consequently, the types and patterns of CM motifs may play crucial roles in the pathogenesis of H. pylori-associated diseases.

This report is the first study to elucidate in detail the prevalence of cagA and vacA genotypes, along with a comprehensive analysis of the characteristics of the CagA EPIYA and CM motif types in Shandong. Despite the valuable insights obtained, certain limitations necessitate consideration. First, the sample size of strains isolated from GC patients was limited, potentially impacting the generalizability of our findings. Second, our study focused on only two specific regions within Shandong, so our results may not fully encapsulate the entire spectrum of virulence factor distributions in Shandong, given the evident regional variations. Third, the number of female patients was small in the process of collecting gastric mucosa samples, resulting in an unbalanced proportion of male and female patients. Future investigations should aim to overcome these limitations by incorporating a larger sample size encompassing diverse gastrointestinal diseases in various regions within Shandong and ensuring that the sample collected is representative and can accurately reflect the characteristics of the population being studied.

Conclusions

In conclusion, we found that CagA proteins possessing CM motif pattern D were observed more frequently in patients with GC, and the profiling of diverse CM motifs has emerged as a potentially valuable tool for assessing the toxicity of H. pylori and predicting H. pylori-related diseases. Furthermore, a robust association was identified between the vacA c1 genotype and GC. We speculate that the vacA c1 genotype may serve as a particularly potent risk indicator for GC, particularly among male patients aged ≥55 years in Shandong. However, further studies are imperative to substantiate our hypothesis and enhance the understanding of these intricate associations.

Supporting information

S1 Table Frequency of 87 H. pylori virulence genotypes based on the distribution of age, sex, and disease.

CSG: chronic superficial gastritis; CAG: chronic atrophic gastritis; PUD: peptic ulcer disease; GC: gastric cancer. Values in parentheses are percentages.

(DOCX)
==== Refs
References

1 Ren S , Cai P , Liu Y , Wang T , Zhang Y , Li Q , et al . Prevalence of Helicobacter pylori infection in China: A systematic review and meta-analysis. J Gastroenterol Hepatol. 2022;37 :464–70. doi: 10.1111/jgh.15751 34862656
2 Salvatori S , Marafini I , Laudisi F , Monteleone G , Stolfi C . Helicobacter pylori and Gastric Cancer: Pathogenetic Mechanisms. Int J Mol Sci. 2023;24 :5–9. doi: 10.3390/ijms24032895 36769214
3 Xia C , Dong X , Li H , Cao M , Sun D , He S , et al . Cancer statistics in China and United States, 2022: profiles, trends, and determinants. Chin Med J (Engl). 2022;135 :584–90. doi: 10.1097/CM9.0000000000002108 35143424
4 Cao W , Chen HD , Yu YW , Li N , Chen WQ . Changing profiles of cancer burden worldwide and in China: a secondary analysis of the global cancer statistics 2020. Chin Med J (Engl). 2021;134 :783–91. doi: 10.1097/CM9.0000000000001474 33734139
5 Sung H , Ferlay J , Siegel RL , Laversanne M , Soerjomataram I , Jemal A , et al . Global Cancer Statistics 2020: GLOBOCAN Estimates of Incidence and Mortality Worldwide for 36 Cancers in 185 Countries. CA Cancer J Clin. 2021;71 :209–49. doi: 10.3322/caac.21660 33538338
6 Baj J , Forma A , Sitarz M , Portincasa P , Garruti G , Krasowska D , et al . Helicobacter pylori Virulence Factors-Mechanisms of Bacterial Pathogenicity in the Gastric Microenvironment. Cells. 2020;10 :27. doi: 10.3390/cells10010027 33375694
7 Sukri A , Hanafiah A , Mohamad Zin N , Kosai NR . Epidemiology and role of Helicobacter pylori virulence factors in gastric cancer carcinogenesis. APMIS. 2020;128 :150–61. doi: 10.1111/apm.13034 32352605
8 Boonyanugomol W , Kongkasame W , Palittapongarnpim P , Baik SC , Jung MH , Shin MK , et al . Genetic variation in the cag pathogenicity island of Helicobacter pylori strains detected from gastroduodenal patients in Thailand. Braz J Microbiol. 2020;51 :1093–101. doi: 10.1007/s42770-020-00292-3 32410092
9 Vannini A , Roncarati D , Spinsanti M , Scarlato V , Danielli A . In depth analysis of the Helicobacter pylori cag pathogenicity island transcriptional responses. PLoS One. 2014;9 :e98416. doi: 10.1371/journal.pone.0098416 24892739
10 Hatakeyama M. Helicobacter pylori CagA and gastric cancer: a paradigm for hit-and-run carcinogenesis. Cell Host Microbe. 2014;15 :306–16. doi: 10.1016/j.chom.2014.02.008 24629337
11 Park JY , Forman D , Waskito LA , Yamaoka Y , Crabtree JE . Epidemiology of Helicobacter pylori and CagA-Positive Infections and Global Variations in Gastric Cancer. Toxins (Basel). 2018;10 :163. doi: 10.3390/toxins10040163 29671784
12 Merino E , Flores-Encarnacion M , Aguilar-Gutierrez GR . Functional interaction and structural characteristics of unique components of Helicobacter pylori T4SS. FEBS J. 2017;284 :3540–9. doi: 10.1111/febs.14092 28470874
13 Ansari S , Yamaoka Y . Helicobacter pylori Virulence Factor Cytotoxin-Associated Gene A (CagA)-Mediated Gastric Pathogenicity. Int J Mol Sci. 2020;21 :7430. doi: 10.3390/ijms21197430 33050101
14 Atrisco-Morales J , Martinez-Santos VI , Roman-Roman A , Alarcon-Millan J , De Sampedro-Reyes J , Cruz-Del Carmen I , et al . vacA s1m1 genotype and cagA EPIYA-ABC pattern are predominant among Helicobacter pylori strains isolated from Mexican patients with chronic gastritis. J Med Microbiol. 2018;67 :314–24. doi: 10.1099/jmm.0.000660 29458667
15 Tissera K , Kim MA , Lai J , Angulmaduwa S , Kim A , Merrell DS , et al . Characterization of East-Asian Helicobacter pylori encoding Western EPIYA-ABC CagA. J Microbiol. 2022;60 :207–14. doi: 10.1007/s12275-022-1483-7 34757586
16 Vianna JS , Ramis IB , Halicki PC , Gastal OL , Silva RA , Junior JS , et al . Detection of Helicobacter pylori CagA EPIYA in gastric biopsy specimens and its relation to gastric diseases. Diagn Microbiol Infect Dis. 2015;83 :89–92. doi: 10.1016/j.diagmicrobio.2015.05.017 26144892
17 Ferreira Junior M , Batista SA , Vidigal PV , Cordeiro AA , Oliveira FM , Prata LO , et al . Infection with CagA-positive Helicobacter pylori strain containing three EPIYA C phosphorylation sites is associated with more severe gastric lesions in experimentally infected Mongolian gerbils (Meriones unguiculatus). Eur J Histochem. 2015;59 :2489. doi: 10.4081/ejh.2015.2489 26150158
18 Papadakos KS , Sougleri IS , Mentis AF , Sgouras DN . A mutagenesis method for the addition and deletion of highly repetitive DNA regions: the paradigm of EPIYA motifs in the cagA gene of Helicobacter pylori. Helicobacter. 2013;18 :229–41. doi: 10.1111/hel.12029 23190444
19 Vaziri F , Peerayeh SN , Alebouyeh M , Maghsoudi N , Azimzadeh P , Siadat SD , et al . Novel effects of Helicobacter pylori CagA on key genes of gastric cancer signal transduction: a comparative transfection study. Pathog Dis. 2015;73 :ftu021. doi: 10.1093/femspd/ftu021 25743471
20 Naito M , Yamazaki T , Tsutsumi R , Higashi H , Onoe K , Yamazaki S , et al . Influence of EPIYA-repeat polymorphism on the phosphorylation-dependent biological activity of Helicobacter pylori CagA. Gastroenterology. 2006;130 :1181–90. doi: 10.1053/j.gastro.2005.12.038 16618412
21 Xia Y , Yamaoka Y , Zhu Q , Matha I , Gao X . A comprehensive sequence and disease correlation analyses for the C-terminal region of CagA protein of Helicobacter pylori. PLoS One. 2009;4 :e7736. doi: 10.1371/journal.pone.0007736 19893742
22 Ren S , Higashi H , Lu H , Azuma T , Hatakeyama M . Structural basis and functional consequence of Helicobacter pylori CagA multimerization in cells. J Biol Chem. 2006;281 :32344–52. doi: 10.1074/jbc.M606172200 16954210
23 Suzuki M , Mimuro H , Kiga K , Fukumatsu M , Ishijima N , Morikawa H , et al . Helicobacter pylori CagA phosphorylation-independent function in epithelial proliferation and inflammation. Cell Host Microbe. 2009;5 :23–34. doi: 10.1016/j.chom.2008.11.010 19154985
24 Hatakeyama M . Anthropological and clinical implications for the structural diversity of the Helicobacter pylori CagA oncoprotein. Cancer Sci. 2011;102 :36–43. doi: 10.1111/j.1349-7006.2010.01743.x 20942897
25 Ogorodnik E , Raffaniello RD . Analysis of the 3’-variable region of the cagA gene from Helicobacter pylori strains infecting patients at New York City hospitals. Microb Pathog. 2013;56 :29–34. doi: 10.1016/j.micpath.2012.10.003 23117095
26 Sicinschi LA , Correa P , Peek RM , Camargo MC , Piazuelo MB , Romero-Gallo J , et al . CagA C-terminal variations in Helicobacter pylori strains from Colombian patients with gastric precancerous lesions. Clin Microbiol Infect. 2010;16 :369–78. doi: 10.1111/j.1469-0691.2009.02811.x 19456839
27 Phan TN , Santona A , Tran VH , Tran TNH , Le VA , Cappuccinelli P , et al . Genotyping of Helicobacter pylori shows high diversity of strains circulating in central Vietnam. Infect Genet Evol. 2017;52 :19–25. doi: 10.1016/j.meegid.2017.04.014 28434988
28 Saadat I , Higashi H , Obuse C , Umeda M , Murata-Kamiya N , Saito Y , et al . Helicobacter pylori CagA targets PAR1/MARK kinase to disrupt epithelial cell polarity. Nature. 2007;447 :330–3. doi: 10.1038/nature05765 17507984
29 Foegeding NJ , Caston RR , McClain MS , Ohi MD , Cover TL . An Overview of Helicobacter pylori VacA Toxin Biology. Toxins (Basel). 2016;8 :173. doi: 10.3390/toxins8060173 27271669
30 Thi Huyen Trang T , Thanh Binh T , Yamaoka Y . Relationship between vacA Types and Development of Gastroduodenal Diseases. Toxins (Basel). 2016;8 :182. doi: 10.3390/toxins8060182 27294955
31 Whitmire JM , Merrell DS . Helicobacter pylori Genetic Polymorphisms in Gastric Disease Development. Adv Exp Med Biol. 2019;1149 :173–94. doi: 10.1007/5584_2019_365 31016629
32 Abdi E , Latifi-Navid S , Zahri S , Yazdanbod A , Safaralizadeh R . Helicobacter pylori genotypes determine risk of non-cardia gastric cancer and intestinal- or diffuse-type GC in Ardabil: A very high-risk area in Northwestern Iran. Microb Pathog. 2017;107 :287–92. doi: 10.1016/j.micpath.2017.04.007 28390977
33 Bakhti SZ , Latifi-Navid S , Zahri S , Bakhti FS , Hajavi N , Yazdanbod A . Are Helicobacter pylori highly cytotoxic genotypes and cardia gastric adenocarcinoma linked? Lessons from Iran. Cancer Biomark. 2017;21 :235–46. doi: 10.3233/CBM-170701 29036792
34 Liu X , He B , Cho WC , Pan Y , Chen J , Ying H , et al . A systematic review on the association between the Helicobacter pylori vacA i genotype and gastric disease. FEBS Open Bio. 2016;6 :409–17. doi: 10.1002/2211-5463.12046 27419046
35 Pormohammad A , Ghotaslou R , Leylabadlo HE , Nasiri MJ , Dabiri H , Hashemi A . Risk of gastric cancer in association with Helicobacter pylori different virulence factors: A systematic review and meta-analysis. Microb Pathog. 2018;118 :214–9. doi: 10.1016/j.micpath.2018.03.004 29510208
36 Matos JI , de Sousa HA , Marcos-Pinto R , Dinis-Ribeiro M . Helicobacter pylori CagA and VacA genotypes and gastric phenotype: a meta-analysis. Eur J Gastroenterol Hepatol. 2013;25 :1431–41. doi: 10.1097/MEG.0b013e328364b53e 23929249
37 Basso D , Zambon CF , Letley DP , Stranges A , Marchet A , Rhead JL , et al . Clinical relevance of Helicobacter pylori cagA and vacA gene polymorphisms. Gastroenterology. 2008;135 :91–9. doi: 10.1053/j.gastro.2008.03.041 18474244
38 Rhead JL , Letley DP , Mohammadi M , Hussein N , Mohagheghi MA , Eshagh Hosseini M , et al . A new Helicobacter pylori vacuolating cytotoxin determinant, the intermediate region, is associated with gastric cancer. Gastroenterology. 2007;133 :926–36. doi: 10.1053/j.gastro.2007.06.056 17854597
39 Wang Y , Yan Q , Fan C , Mo Y , Wang Y , Li X , et al . Overview and countermeasures of cancer burden in China. Sci China Life Sci. 2023;66 :2515–26. doi: 10.1007/s11427-022-2240-6 37071289
40 Xue Z , Yang H , Su D , Song X , Deng X , Yu C , et al . Geographic distribution of the cagA, vacA, iceA, oipA and dupA genes of Helicobacter pylori strains isolated in China. Gut Pathog. 2021;13 :39. doi: 10.1186/s13099-021-00434-4 34130751
41 Chen CY , Wang FY , Wan HJ , Jin XX , Wei J , Wang ZK , et al . Amino acid polymorphisms flanking the EPIYA-A motif of Helicobacter pylori CagA C-terminal region is associated with gastric cancer in east China: experience from a single center. J Dig Dis. 2013;14 :358–65. doi: 10.1111/1751-2980.12056 23517408
42 Inagaki T , Nishiumi S , Ito Y , Yamakawa A , Yamazaki Y , Yoshida M , et al . Associations Between CagA, VacA, and the Clinical Outcomes of Helicobacter Pylori Infections in Okinawa, Japan. Kobe J Med Sci. 2017;63 :E58–E67.29434176
43 Atherton JC , Cao P , Peek RM Jr , Tummuru MK , Blaser MJ , Cover TL . Mosaicism in vacuolating cytotoxin alleles of Helicobacter pylori. Association of specific vacA types with cytotoxin production and peptic ulceration. J Biol Chem. 1995;270 :17771–7. doi: 10.1074/jbc.270.30.17771 7629077
44 Ogiwara H , Sugimoto M , Ohno T , Vilaichone RK , Mahachai V , Graham DY , et al . Role of deletion located between the intermediate and middle regions of the Helicobacter pylori vacA gene in cases of gastroduodenal diseases. J Clin Microbiol. 2009;47 :3493–500. doi: 10.1128/JCM.00887-09 19726606
45 Bakhti SZ , Latifi-Navid S , Mohammadi S , Zahri S , Bakhti FS , Feizi F , et al . Relevance of Helicobacter pylori vacA 3’-end Region Polymorphism to Gastric Cancer. Helicobacter. 2016;21 :305–16. doi: 10.1111/hel.12284 26612250
46 Mi Y , Dong H , Sun X , Ren F , Tang Y , Zheng P . The association of Helicobacter pylori CagA EPIYA motifs and vacA genotypes with homologous recombination repair markers during the gastric precancerous cascade. Int J Biol Markers. 2020;35 :49–55. doi: 10.1177/1724600820914935 32286927
47 Xue Z , You Y , He L , Gong Y , Sun L , Han X , et al . Diversity of 3’ variable region of cagA gene in Helicobacter pylori strains isolated from Chinese population. Gut Pathog. 2021;13 :23. doi: 10.1186/s13099-021-00419-3 33849660
48 Linz B , Balloux F , Moodley Y , Manica A , Liu H , Roumagnac P , et al . An African origin for the intimate association between humans and Helicobacter pylori. Nature. 2007;445 :915–8. doi: 10.1038/nature05562 17287725
49 Suerbaum S , Achtman M . Helicobacter pylori: recombination, population structure and human migrations. Int J Med Microbiol. 2004;294 :133–9. doi: 10.1016/j.ijmm.2004.06.014 15493823
50 Smith SI , Seriki A , Ndip R , Pellicano R . Helicobacter pylori infection in Africa: 2018 literature update. Minerva Gastroenterol Dietol. 2018;64 :222–34. doi: 10.23736/S1121-421X.18.02464–9 29327819
51 Hooi JKY , Lai WY , Ng WK , Suen MMY , Underwood FE , Tanyingoh D , et al . Global Prevalence of Helicobacter pylori Infection: Systematic Review and Meta-Analysis. Gastroenterology. 2017;153 :420–9. doi: 10.1053/j.gastro.2017.04.022 28456631
52 Nomura AM , Lee J , Stemmermann GN , Nomura RY , Perez-Perez GI , Blaser MJ . Helicobacter pylori CagA seropositivity and gastric carcinoma risk in a Japanese American population. J Infect Dis. 2002;186 :1138–44. doi: 10.1086/343808 12355365
53 Ono T , Cruz M , Nagashima H , Subsomwong P , Akada J , Matsumoto T , et al . Discovery of unique African Helicobacter pylori CagA-multimerization motif in the Dominican Republic. World J Gastroenterol. 2020;26 :7118–30. doi: 10.3748/wjg.v26.i45.7118 33362372
54 de Brito BB , da Silva FAF , Soares AS , Pereira VA , Santos MLC , Sampaio MM , et al . Pathogenesis and clinical management of Helicobacter pylori gastric infection. World J Gastroenterol. 2019;25 :5578–89. doi: 10.3748/wjg.v25.i37.5578 31602159
55 Plummer M , de Martel C , Vignat J , Ferlay J , Bray F , Franceschi S . Global burden of cancers attributable to infections in 2012: a synthetic analysis. Lancet Glob Health. 2016;4 :e609–16. doi: 10.1016/S2214-109X(16)30143-7 27470177
56 Pan ZJ , Berg DE , van der Hulst RW , Su WW , Raudonikiene A , Xiao SD , et al . Prevalence of vacuolating cytotoxin production and distribution of distinct vacA alleles in Helicobacter pylori from China. J Infect Dis. 1998;178 :220–6. doi: 10.1086/515601 9652444
57 Yang H , Wu SV , Pichuantes S , Song M , Wang J , Zhou D , et al . High prevalence of cagA-positive strains in Helicobacter pylori-infected, healthy, young Chinese adults. J Gastroenterol Hepatol. 1999;14 :476–80. doi: 10.1046/j.1440-1746.1999.01892.x 10355513
58 Kim YS , Kim N , Kim JM , Kim MS , Park JH , Lee MK , et al . Helicobacter pylori genotyping findings from multiple cultured isolates and mucosal biopsy specimens: strain diversities of Helicobacter pylori isolates in individual hosts. Eur J Gastroenterol Hepatol. 2009;21 :522–8. doi: 10.1097/meg.0b013e3283196af0 19373969
59 Gonzalez CA , Figueiredo C , Lic CB , Ferreira RM , Pardo ML , Ruiz Liso JM , et al . Helicobacter pylori cagA and vacA genotypes as predictors of progression of gastric preneoplastic lesions: a long-term follow-up in a high-risk area in Spain. Am J Gastroenterol. 2011;106 :867–74. doi: 10.1038/ajg.2011.1 21285949
60 Hussein NR , Mohammadi M , Talebkhan Y , Doraghi M , Letley DP , Muhammad MK , et al . Differences in virulence markers between Helicobacter pylori strains from Iraq and those from Iran: potential importance of regional differences in H. pylori-associated disease. J Clin Microbiol. 2008;46 :1774–9. doi: 10.1128/JCM.01737-07 18353934
61 Saribasak H , Salih BA , Yamaoka Y , Sander E . Analysis of Helicobacter pylori genotypes and correlation with clinical outcome in Turkey. J Clin Microbiol. 2004;42 :1648–51. doi: 10.1128/JCM.42.4.1648–1651.2004 15071020
62 Yamazaki S , Yamakawa A , Okuda T , Ohtani M , Suto H , Ito Y , et al . Distinct diversity of vacA, cagA, and cagE genes of Helicobacter pylori associated with peptic ulcer in Japan. J Clin Microbiol. 2005;43 :3906–16. doi: 10.1128/JCM.43.8.3906–3916.2005 16081930
63 Zhang BB , Li Y , Liu XQ , Wang PJ , Yang B , Bian DL . Association between vacA genotypes and the risk of duodenal ulcer: a meta-analysis. Mol Biol Rep. 2014;41 :7241–54. doi: 10.1007/s11033-014-3610-y 25063579
64 Figueiredo C , Machado JC , Pharoah P , Seruca R , Sousa S , Carvalho R , et al . Helicobacter pylori and interleukin 1 genotyping: an opportunity to identify high-risk individuals for gastric carcinoma. J Natl Cancer Inst. 2002;94 :1680–7. doi: 10.1093/jnci/94.22.1680 12441323
65 Sahara S , Sugimoto M , Vilaichone RK , Mahachai V , Miyajima H , Furuta T , et al . Role of Helicobacter pylori cagA EPIYA motif and vacA genotypes for the development of gastrointestinal diseases in Southeast Asian countries: a meta-analysis. BMC Infect Dis. 2012;12 :223. doi: 10.1186/1471-2334-12-223 22994150
66 Yordanov D , Boyanova L , Markovska R , Gergova G , Mitov I . Significance of Helicobacter pylori vacA intermediate region genotyping-a Bulgarian study. Diagn Microbiol Infect Dis. 2012;74 :253–7. doi: 10.1016/j.diagmicrobio.2012.07.008 22951332
67 Ferreira RM , Machado JC , Letley D , Atherton JC , Pardo ML , Gonzalez CA , et al . A novel method for genotyping the Helicobacter pylori vacA intermediate region directly in gastric biopsy specimens. J Clin Microbiol. 2012;50 :3983–9. doi: 10.1128/JCM.02087-12 23035185
68 Mottaghi B , Safaralizadeh R , Bonyadi M , Latifi-Navid S , Somi MH . Helicobacter pylori vacA i region polymorphism but not babA2 status associated to gastric cancer risk in northwestern Iran. Clin Exp Med. 2016;16 :57–63. doi: 10.1007/s10238-014-0327-0 25472424
69 Basiri Z , Safaralizadeh R , Bonyadi MJ , Somi MH , Mahdavi M , Latifi-Navid S . Helicobacter pylori vacA d1 genotype predicts risk of gastric adenocarcinoma and peptic ulcers in northwestern Iran. Asian Pac J Cancer Prev. 2014;15 :1575–9. doi: 10.7314/apjcp.2014.15.4.1575 24641370
70 Argent RH , Kidd M , Owen RJ , Thomas RJ , Limb MC , Atherton JC . Determinants and consequences of different levels of CagA phosphorylation for clinical isolates of Helicobacter pylori. Gastroenterology. 2004;127 :514–23. doi: 10.1053/j.gastro.2004.06.006 15300584
71 Azuma T , Yamakawa A , Yamazaki S , Fukuta K , Ohtani M , Ito Y , et al . Correlation between variation of the 3’ region of the cagA gene in Helicobacter pylori and disease outcome in Japan. J Infect Dis. 2002;186 :1621–30. doi: 10.1086/345374 12447739
72 Zhang XS , Tegtmeyer N , Traube L , Jindal S , Perez-Perez G , Sticht H , et al . A specific A/T polymorphism in Western tyrosine phosphorylation B-motifs regulates Helicobacter pylori CagA epithelial cell interactions. PLoS Pathog. 2015;11 :e1004621. doi: 10.1371/journal.ppat.1004621 25646814
73 Matsunari O , Shiota S , Suzuki R , Watada M , Kinjo N , Murakami K , et al . Association between Helicobacter pylori virulence factors and gastroduodenal diseases in Okinawa, Japan. J Clin Microbiol. 2012;50 :876–83. doi: 10.1128/JCM.05562-11 22189111
74 Aftab H , Miftahussurur M , Subsomwong P , Ahmed F , Khan AKA , Matsumoto T , et al . Two populations of less-virulent Helicobacter pylori genotypes in Bangladesh. PLoS One. 2017;12 :e0182947. doi: 10.1371/journal.pone.0182947 28797101
75 Myint T , Miftahussurur M , Vilaichone RK , Ni N , Aye TT , Subsomwong P , et al . Characterizing Helicobacter pylori cagA in Myanmar. Gut Liver. 2018;12 :51–7. doi: 10.5009/gnl17053 29069889
76 Subsomwong P , Miftahussurur M , Uchida T , Vilaichone RK , Ratanachu-Ek T , Mahachai V , et al . Prevalence, risk factors, and virulence genes of Helicobacter pylori among dyspeptic patients in two different gastric cancer risk regions of Thailand. PLoS One. 2017;12 :e0187113. doi: 10.1371/journal.pone.0187113 29084246
