
==== Front
eLife
Elife
eLife
eLife
2050-084X
eLife Sciences Publications, Ltd

39115289
80687
10.7554/eLife.80687
version of record
Research Article
Chromosomes and Gene Expression
Genetics and Genomics
BRCA1/BRC-1 and SMC-5/6 regulate DNA repair pathway engagement during Caenorhabditis elegans meiosis
Toraason Erik https://orcid.org/0000-0003-0500-955X
1
Salagean Alina https://orcid.org/0000-0002-5377-9375
1
Almanzar David E 2
Brown Jordan E 1
Richter Colette M 1
Kurhanewicz Nicole A https://orcid.org/0000-0003-2023-9310
1
Rog Ofer https://orcid.org/0000-0001-6558-6194
2
Libuda Diana E https://orcid.org/0000-0002-4944-1814
dlibuda@uoregon.edu
1
1 https://ror.org/0293rh119 Institute of Molecular Biology, Department of Biology, University of Oregon Eugene United States
2 https://ror.org/03r0ha626 School of Biological Sciences and Center for Cell and Genome Sciences, University of Utah Salt Lake City United States
de Massy Bernard Reviewing Editor https://ror.org/02feahw73 CNRS UM France

Weigel Detlef Senior Editor https://ror.org/0243gzr89 Max Planck Institute for Biology Tübingen Germany

08 8 2024
2024
13 e8068731 5 2022
07 8 2024
This manuscript was published as a preprint at .14 6 2022

© 2024, Toraason et al
2024
Toraason et al
https://creativecommons.org/licenses/by/4.0/ This article is distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use and redistribution provided that the original author and source are credited.

The preservation of genome integrity during sperm and egg development is vital for reproductive success. During meiosis, the tumor suppressor BRCA1/BRC-1 and structural maintenance of chromosomes 5/6 (SMC-5/6) complex genetically interact to promote high fidelity DNA double strand break (DSB) repair, but the specific DSB repair outcomes these proteins regulate remain unknown. Using genetic and cytological methods to monitor resolution of DSBs with different repair partners in Caenorhabditis elegans, we demonstrate that both BRC-1 and SMC-5 repress intersister crossover recombination events. Sequencing analysis of conversion tracts from homolog-independent DSB repair events further indicates that BRC-1 regulates intersister/intrachromatid noncrossover conversion tract length. Moreover, we find that BRC-1 specifically inhibits error prone repair of DSBs induced at mid-pachytene. Finally, we reveal functional interactions of BRC-1 and SMC-5/6 in regulating repair pathway engagement: BRC-1 is required for localization of recombinase proteins to DSBs in smc-5 mutants and enhances DSB repair defects in smc-5 mutants by repressing theta-mediated end joining (TMEJ). These results are consistent with a model in which some functions of BRC-1 act upstream of SMC-5/6 to promote recombination and inhibit error-prone DSB repair, while SMC-5/6 acts downstream of BRC-1 to regulate the formation or resolution of recombination intermediates. Taken together, our study illuminates the coordinated interplay of BRC-1 and SMC-5/6 to regulate DSB repair outcomes in the germline.

meiosis
DNA repair
sister chromatid
recombination
DNA double strand breaks
germline
TMEJ
Research organism

C. elegans
http://dx.doi.org/10.13039/100000057 National Institute of General Medical Sciences R35GM128890 Libuda Diana E http://dx.doi.org/10.13039/100009633 Eunice Kennedy Shriver National Institute of Child Health and Human Development R00HD076165 Libuda Diana E http://dx.doi.org/10.13039/100000057 National Institute of General Medical Sciences T32GM007413 Toraason Erik http://dx.doi.org/10.13039/100009633 Eunice Kennedy Shriver National Institute of Child Health and Human Development R25HD070817 Salagean Alina http://dx.doi.org/10.13039/100000057 National Institute of General Medical Sciences T32GM007464 Almanzar David E http://dx.doi.org/10.13039/100000057 National Institute of General Medical Sciences R35GM128804 Rog Ofer Advancing Science in America Foundation Award Toraason Erik http://dx.doi.org/10.13039/100000048 American Cancer Society Pilot Project Award Rog Ofer http://dx.doi.org/10.13039/100007747 University of Utah start-up funds Rog Ofer The funders had no role in study design, data collection and interpretation, or the decision to submit the work for publication.Author impact statementTo maintain genomic integrity during oocyte development, the tumor suppressor BRCA1/BRC-1 and the SMC-5/6 complex both repress intersister crossover recombination events while BRCA1/BRC-1 also specifically inhibits error prone repair of DNA breaks during meiotic prophase I.
==== Body
pmcIntroduction

Meiosis is the specialized form of cell division by which most sexually reproducing organisms generate haploid gametes. In a diploid organism, each meiotic cell begins prophase I with four copies of the genome – two homologous chromosomes (homologs) and identical copies of each homolog called sister chromatids. As mutations incurred in the gamete genome will be passed on to the resultant progeny, it is crucial that genome integrity be maintained during meiosis. Despite this risk, a highly conserved feature of the meiotic program is induction of DNA double strand breaks (DSBs) by the topoisomerase-like protein Spo11 (Keeney et al., 1997; Bergerat et al., 1997). A limited subset of DSBs must engage the homologous chromosome as a recombination partner and be repaired as a crossover event to forge a physical connection between homologs that facilitates accurate chromosome segregation at the meiosis I division. DSBs are incurred in excess of the number of eventual crossovers and other pathways must therefore be utilized to repair residual DSBs. How meiotic cells regulate repair pathway engagement to both accurately and efficiently resolve DSBs is a critical question in the field of genome integrity.

In many organisms, the majority of meiotic DSBs are repaired through interhomolog noncrossover recombination mechanisms (Hunter, 2015). Multiple models are proposed for how meiotic noncrossover repair occurs. Evidence in Drosophila suggests that both interhomolog noncrossovers and crossovers may be generated by differential processing of similar joint molecule intermediates (Crown et al., 2014). Work in budding yeast, mammals, and Arabidopsis indicates that the majority of interhomolog noncrossovers are generated via synthesis-dependent strand annealing (SDSA) with the homolog (Hunter, 2015). In SDSA, one or both resected end(s) of the DSB invades a repair template, new sequence is synthesized, the strand dissociates from its repair template, and finally utilizes the synthesized sequence to anneal to the other resected end of the DSB.

Meiotic DSBs may also be repaired by recombination with the sister chromatid (Goldfarb and Lichten, 2010; Toraason et al., 2021c; Almanzar et al., 2021; Schwacha and Kleckner, 1997). In budding yeast, DSB repair by intersister recombination is disfavored so as to promote recombination with the homologous chromosome (Goldfarb and Lichten, 2010; Schwacha and Kleckner, 1997; Humphryes and Hochwagen, 2014; Kim et al., 2010; Schwacha and Kleckner, 1994). In metazoan meiosis, however, the engagement of intersister repair has proven challenging to detect and quantify. While recombination between polymorphic homologs may be readily studied via sequence conversions in final repair products, the identical sequences of sister chromatids preclude the detection of intersister recombination by sequencing-based approaches. Recently, two methods have been developed in the nematode Caenorhabditis elegans to enable direct detection of homolog-independent meiotic recombination (Toraason et al., 2021c; Almanzar et al., 2021). Toraason et al., 2021c constructed an intersister/intrachromatid repair (ICR) assay that exploits nonallelic recombination at a known locus in the genome to identify homolog-independent repair events in resultant progeny (Figure 1-figure supplement 1 A). Almanzar et al., 2021 designed an EdU labeling assay to cytologically identify sister chromatid exchanges (SCEs) in compacted chromosomes at diakinesis. Together, these studies demonstrated that: (1) homolog-independent meiotic recombination occurs in C. elegans; (2) the sister chromatid and/or same DNA molecule is the exclusive recombination repair template in late prophase I; and, (3) intersister crossovers are rare and represent a minority of homolog-independent recombination products (Toraason et al., 2021c; Almanzar et al., 2021).

While meiotic cells primarily utilize homologous recombination to resolve DSBs, error prone repair pathways are also available in meiosis to repair DSBs at the risk of introducing de novo mutations (Gartner and Engebrecht, 2022). These error prone mechanisms are repressed in wild type contexts to promote recombination repair but are activated in mutants that disrupt recombination (Macaisne et al., 2018; Yin and Smolikove, 2013; Kamp et al., 2020; Lemmens et al., 2013). Non-homologous end joining (NHEJ), which facilitates the ligation of blunt DNA ends by the DNA ligase IV homolog LIG-4, is active in the C. elegans germline (Macaisne et al., 2018; Yin and Smolikove, 2013). Recent studies have revealed that microhomology-mediated end-joining facilitated by the DNA polymerase θ homolog POLQ-1 (theta-mediated end-joining, TMEJ) is the primary pathway by which small mutations are incurred in C. elegans germ cells and somatic cells (Kamp et al., 2020; van Schendel et al., 2015). Since neither NHEJ nor TMEJ are required for successful meiosis (Kamp et al., 2020; Lemmens et al., 2013; Volkova et al., 2020; Colaiácovo et al., 2003), recombination is likely sufficient for meiotic DSB repair and gamete viability under normal conditions.

The structural maintenance of chromosomes 5/6 complex and tumor suppressor BRCA1 (SMC-5/6 and BRC-1 respectively in C. elegans) are highly conserved and regulate meiotic DSB repair in C. elegans (Kamp et al., 2020; Bickel et al., 2010; Hong et al., 2016; Li et al., 2018; Janisiw et al., 2018; Odiba et al., 2024). The SMC-5/6 complex is vital for preservation of meiotic genome integrity, as C. elegans mutants for smc-5 exhibit a transgenerational sterility phenotype (Bickel et al., 2010). Although null mutations of smc-5, smc-6, and brc-1 revealed that they are not required for development nor reproduction in C. elegans (Bickel et al., 2010; Li et al., 2018; Janisiw et al., 2018; Adamo et al., 2008), both SMC-5/6 and BRC-1 are required for efficient DSB repair, as smc-5 and brc-1 null mutants both display meiotic chromosome fragmentation at diakinesis indicative of unrepaired DSBs (Bickel et al., 2010). In C. elegans, BRC-1 has also been shown to repress error prone DSB repair via NHEJ and TMEJ (Kamp et al., 2020; Li et al., 2020), and acts in parallel with the tumor suppressor 53BP1/HSR-9 (Hariri et al., 2023). Further, SMC-5/6 and BRC-1 may promote genome integrity in part by facilitating efficient recombination, as smc-5 and brc-1 mutants exhibit persistent DSBs marked by the recombinase RAD-51 (Kamp et al., 2020; Bickel et al., 2010; Adamo et al., 2008; Boulton et al., 2004), suggesting that early recombination steps are disrupted in these mutants. BRC-1 further prevents recombination between heterologous templates to promote accurate recombination repair (León-Ortiz et al., 2018). Despite these apparent DNA repair defects, interhomolog crossover formation is largely unaffected by smc-5 and brc-1 mutations (Bickel et al., 2010; Li et al., 2018; Janisiw et al., 2018; Adamo et al., 2008). Taken together, these data have contributed to the model that that SMC-5/6 and BRC-1 are required for intersister repair in C. elegans.

SMC-5/6 and BRC-1 genetically interact to regulate germline DSB repair. The incidence of unrepaired DSBs observed in both smc-5 and brc-1 single mutants are not additive in the double smc-5;brc-1 mutant context, which suggests that SMC-5/6 and BRC-1 may share some DSB repair functions (Bickel et al., 2010). Other experiments, however, indicate opposing functions for SMC-5/6 and BRC-1, as both the mitotic DNA replication defects in smc-5 mutants and the synthetic lethality of smc-5;him-6 (BLM helicase) double mutants are suppressed by brc-1 mutation (Hong et al., 2016; Wolters et al., 2014). Crucially, the specific steps of recombination regulated by SMC-5/6 and BRC-1 that intersect to influence DNA repair outcomes remain unknown.

To determine the DSB repair functions of SMC-5 and BRC-1 that regulate DNA repair outcomes during C. elegans meiosis, we employed a multipronged approach utilizing genetic assays, cytology, sequence analysis of recombinant loci, and functional DSB repair assays in smc-5 and brc-1 mutants. We find that SMC-5 and BRC-1 function to repress meiotic intersister crossover recombination, and that BRC-1 specifically regulates homolog-independent noncrossover intermediate processing. Through these experiments, we also find that BRC-1 prevents mutagenic DSB repair at the mid-pachytene stage of meiotic prophase I. By assessing germ cell capacity to resolve exogenous DSBs, we demonstrate that meiotic nuclei become more dependent on BRC-1 for DSB repair in late stages of meiotic prophase I. Finally, we reveal that smc-5 mutant DSB repair defects are suppressed by loss of brc-1, which impedes gamete viability in part by repressing error prone repair pathways and promoting recombination. Taken together, our study defines specific functions and interactions of BRC-1 and SMC-5 that regulate meiotic DSB repair outcomes across meiotic prophase I.

Results

BRC-1 restricts intersister crossovers

To directly assess the functions of BRC-1 in homolog-independent DSB repair, we employed the recently developed intersister/intrachromatid (ICR) assay (Toraason et al., 2021c; Toraason et al., 2021b). The ICR assay enables: (1) the controlled generation of a single DSB in C. elegans meiotic nuclei via heat shock inducible mobilization of a Mos1 transposon (Bessereau et al., 2001; Robert and Bessereau, 2007); (2) detection of the repair outcome of the induced DSB with the sister chromatid or same DNA molecule by reconstituting GFP fluorescence in resultant progeny; and, (3) delineation of homolog-independent crossover and noncrossover recombination outcomes (Toraason et al., 2021c; Figure 1—figure supplement 1A). Since the C. elegans germline is organized in a spatial-temporal gradient in which nuclei move progressively through the stages of meiotic prophase I along the distal-proximal axis (Rosu et al., 2011; Jaramillo-Lambert et al., 2007; Cahoon and Libuda, 2021), oocytes at all stages of meiotic prophase I can be affected simultaneously by a specific treatment, such as heat shock or irradiation. As the rate of meiotic progression in the C. elegans germline is known (Rosu et al., 2011; Jaramillo-Lambert et al., 2007; Cahoon and Libuda, 2021), we can score resultant progeny at specific timepoints post heat shock to distinguish oocytes that incurred a Mos1-excision induced DSB at the stages of prophase I when the homologous chromosome is available as a repair partner (the ‘interhomolog window’, leptotene-mid pachytene, 22–58 hr post heat shock) from the stages when the homolog is not readily engaged for DSB repair (the ‘non-interhomolog window’, late pachytene-diplotene, 10–22 hr post heat shock) (Rosu et al., 2011).

We performed the ICR assay in a brc-1(xoe4) mutant, which removes the entire brc-1 coding sequence (Li et al., 2018). If BRC-1 is required for efficient intersister repair, then we expected the overall frequency of ICR assay GFP+ recombinant progeny to be reduced. Contrary to this hypothesis, we found that GFP+ progeny were elevated at all interhomolog window timepoints and were not reduced within the non-interhomolog window (Figure 1—figure supplement 2A). Since the ICR assay restricts DSB recombination repair to homolog-independent repair and should therefore represent the ‘ceiling’ for recombination frequencies, this increase in GFP+ recombinant progeny was unexpected. Given that BRC-1 represses heterologous recombination (León-Ortiz et al., 2018) and that polymorphisms, such as those contained in the GFP repair template in the ICR assay (Toraason et al., 2021c), reduce the likelihood of recombination between templates, we hypothesized that this increase in GFP+ recombinants may represent relaxed bias for the allelic repair template in the ICR assay. However, msh-2 mutants, which are defective in heteroduplex recognition and rejection (Chakraborty and Alani, 2016), did not display increased ICR assay recombinants (Figure 1—figure supplement 2C), suggesting that altered repair template bias does not underpin this effect. Increased recombinants could also be derived from elevated rates of Mos1 excision; however, we did not observe an overall increase in recombinant progeny in a parallel Mos1-based assay in brc-1 mutants (Figure 1—figure supplements 1B and 3A), which suggests that Mos1 does not excise more frequently in brc-1 mutants. As we cannot be certain of the source of increased recombinants in the brc-1 ICR assay, we refrain from making any inference that requires comparing the absolute levels of homolog-independent recombination events in our brc-1 ICR assay data. Regardless of the absolute number of ICR assay GFP+ recombinant progeny, we identified both crossover and noncrossover recombinants in the interhomolog window (Figure 1—figure supplement 2A), demonstrating that BRC-1 alone is not essential for intersister/intrachromatid crossover or noncrossover repair. Notably, the overall proportion of crossover progeny among recombinants identified was increased at all timepoints scored for the brc-1(xoe4) null mutant (Figure 1A), which is similar to the increase in the proportion of ICR assay crossover events we also found in the classical brc-1(tm1145);brd-1(dw1) mutants (Figure 1—figure supplement 2B). Taken together, these data collectively suggest that BRC-1 functions in C. elegans meiosis to repress intersister/intrachromatid crossover events.

Figure 1. BRC-1 represses intersister crossovers and error-prone repair.

(A) Bar plot displaying the percent of crossover recombinant progeny identified in wild type and brc-1 ICR assays out of all recombinant progeny scored. Frequencies of recombinants identified overall in ICR assays is displayed in Figure 1—figure supplement 2A. Wild type ICR assay data is shared in A and Figures 2A, B, 4A, Figure 1—figure supplement 2, Figure 2—figure supplement 1, and Figure 4—figure supplement 1. brc-1 ICR assay data is shared in A and Figure 4A, Figure 1—figure supplement 2, and Figure 4—figure supplement 1. The total number of recombinant progeny scored in each dataset are (10–22 hr/22–34 hr/34–46 hr/46–58 hr timepoints) wild type: 28/25/22/15, brc-1(xoe4) 24/43/36/9. Specific progeny counts separated by experimental replicate are presented in Figure 1—source data 1. (B) Images of wild type and brc-1(xoe4) mutant bivalent chromosomes displaying an absence or presence of sister chromatid exchanges (SCEs). Scale bars represent 1 μm. Dashed bordered insets contain cartoon depictions of the SCE and non-SCE bivalents that are outlined with dashed lines in the images to aid in visualizing exchange events. (C) Frequency of SCEs identified among wild type (n=49) or brc-1 mutant (n=26) chromatid pairs scored. (D–E) Tables displaying the percent of sequenced GFP+ progeny in wild type and brc-1 ICR assays (D) or non-Unc progeny IH assays (E) that showed signatures of mutagenic repair. Numbers in parentheses indicate the number of mutant worms out of the total number of sequenced progeny. Shaded boxes indicate timepoints in which mutant progeny were identified. The overall frequency of interhomolog assay non-Unc progeny is displayed in Figure 1—figure supplement 3. In panels (D) and (E), note that only mutations that allow for translation of functional GFP (panel D) or UNC-5 (panel E) protein can be detected (see Methods). In all panels, error bars represent 95% Binomial confidence intervals, dashed vertical lines delineate between timepoints within the interhomolog window (22–58 hr post heat shock) and non-interhomolog window (10–22 hr post heat shock), and p values were calculated using Fisher’s Exact Test.

Figure 1—source data 1. The source data for Figure 1A is provided.

The total number of ICR assay progeny with GFP+ or non-GFP+ phenotypes are listed. Wild type data is shared with Figure 1—figure supplement 2, Figure 2, Figure 2—figure supplement 1, Figure 4, and Figure 4—figure supplement 1.

Figure 1—source data 2. The source data for Figure 1C is provided.

The number of scorable chromatid pairs with SCE or no SCE events (no_SCE) are listed for each image assessed in generating this dataset. Wild type data is shared with Figure 2.

Figure 1—source data 3. The source data for Figure 1E is provided.

The total number of IH assay progeny with recombinant or mutant nonUnc phenotypes or Unc nonrecombinant phenotypes are listed. Wild type data is shared with Figure 1—figure supplement 3, Figure 2, and Figure 2—figure supplement 2.

Figure 1—figure supplement 1. Diagram of the Intersister/Intrachromatid and Interhomolog assays.

Cartoon depictions of how noncrossover and crossover events can be generated in the Intersister/Intrachromatid Repair assay (A) (Toraason et al., 2021c) and Interhomolog assay (B) (Rosu et al., 2011). Panel A is adapted from Toraason et al., 2021c.

Figure 1—figure supplement 2. Intersister/intrachromatid repair (ICR) assay GFP+ progeny are elevated in brc-1 and brc-1;brd-1 mutants.

Stacked bar plots displaying the percent of all progeny scored in wild type and brc-1(xoe4) (A), brc-1(tm1145);brd-1(dw1) (B), and msh-2(ok2410) (C) ICR assays that were determined to be GFP+ noncrossover recombinants, crossover recombinants, or mutants. Error bars represent the 95% Binomial confidence intervals for the frequencies of GFP+ progeny. Wild type ICR assay data is shared in Figures 1A, 2A, B, 4A, Figure 1—figure supplement 2, Figure 2—figure supplement 1, and Figure 4—figure supplement 1. brc-1 ICR assay data is shared in Figures 1A and 4A, Figure 1—figure supplement 1, and Figure 4—figure supplement 1. The total number of progeny scored in each dataset are (10–22 hr/22–34 hr/34–46 hr/46–58 hr timepoints) wild type: 3921/3359/3664/2383, brc-1(xoe4) 2042/2017/2005/467, (10–22 hr/22–46 hr) brc-1(tm1145);brd-1(dw1) 1562/2340, msh-2(ok2410) 460/711. Specific progeny counts separated by experimental replicate are presented in Figure 1—source data 1. p values were calculated by Fisher’s Exact Test comparing the sum totals of GFP+ progeny between groups. Vertical dashed lines demarcate the interhomolog window (≥22 hr post heat shock) and non-interhomolog window (10–22 hr post heat shock) timepoints.

Figure 1—figure supplement 3. Interhomolog repair is largely unperturbed in brc-1 mutants.

(A) Stacked bar plot displaying the percent of all progeny scored in wild type and brc-1 IH assays that were determined to be noncrossover recombinants, crossover recombinants, non-Unc mutants, or undetermined non-Unc. The vertical dashed line demarcates the interhomolog window (22–58 hr post heat shock) and non-interhomolog window (10–22 hr post heat shock) timepoints. (B) Percent of all recombinant progeny identified within the interhomolog window of wild type and brc-1 IH assays that were crossover recombinants. Error bars represent the 95% Binomial confidence intervals for the frequencies of non-Unc progeny. Wild type data is shared between Figures 1E and 2E, Figure 1—figure supplement 3, and Figure 2—figure supplement 2. The total number of progeny scored in each dataset are (10–22 hr/22–34 hr/34–46 hr/46–58 hr timepoints) wild type: 1308/1695/1592/562, brc-1 758/823/468/97. Specific progeny counts separated by experimental replicate are presented in Figure 1—source data 3. p values were calculated by Fisher’s Exact test comparing the overall frequency of non-Unc progeny (A) or proportion of crossover recombinants of all confirmed recombinant progeny (B, see Materials and Methods).

Figure 1—figure supplement 4. Illustrations of mutants identified in brc-1 ICR and IH assays.

(A) Illustrated depiction of ICR assay GFP+ mutant identified in a brc-1 mutant background (Figure 1D, Figure 1—figure supplement 2). The partial tandem duplication produced (bottom) can best be parsimoniously explained by two independent strand invasion and extension events on either end of the DSB. For simplicity, intersister recombination is depicted in this diagram. However, intrachromatid templates could also have been engaged to produce the final product. (B) Illustrations of unc-5 lesions identified in IH assay non-Unc progeny in brc-1 mutants (Figure 1E, Figure 1—figure supplement 3). Specific mutation signatures are separated by horizontal dashed grey lines. The wild type unc-5 locus sequence at the site of Mos1 excision and the DSB product generated by Mos1 excision are displayed on the top of panel (B). Blue letters indicate a duplicated TA at the site of Mos1 insertion in the unc-5(ox171) locus, while yellow letters indicate the 3 nt 3’ overhangs left following Mos1 excision (Robert et al., 2008). In the panels displaying mutations identified, purple letters with bars indicate complementary bases flanking the deletion site. Red letters struck through with red lines indicate bases in the damaged locus that were deleted to produce the final product. Green letters indicate sites of nucleotide substitution mutations.

To confirm that intersister crossovers are indeed more frequent in a brc-1 mutant, we employed a recently developed cytological assay that utilizes EdU incorporation to visualize sister chromatid exchanges (SCEs) in compacted diakinesis chromosomes (Figure 1B; Almanzar et al., 2021; Almanzar et al., 2022). Notably, this cytological assay detects SCEs from endogenous SPO-11 induced DSBs. While SCEs are found in only 4.1% of chromatid pairs in a wild type background (2/49 chromatid pairs scored, 95% Binomial CI 1.1–13.7%; Almanzar et al., 2021), we detected SCEs at an elevated rate of 19.2% in a brc-1(xoe4) mutant (Figure 1B–C, 5/26 chromatid pairs scored, 95% Binomial CI 8.5–37.9%, Fisher’s Exact Test p=0.045). When we compared the levels of SCEs cytologically identified with the frequency of ICR assay crossovers generated from Mos1-induced DSBs within the interhomolog window, the elevated frequency of SCEs (4.7-fold increase) closely mirrored the relative increase in crossovers as a proportion of all recombinants observed in the brc-1 mutant ICR assay (4.6-fold increase). Taken together, these results demonstrate that BRC-1 functions to repress intersister crossover recombination during C. elegans meiosis for both SPO-11- and Mos1-induced DSBs.

BRC-1 is not required for interhomolog recombination

Since BRC-1 acts to repress crossover recombination between sister chromatids, we next assessed if brc-1 mutants exhibit defects in interhomolog recombination, including interhomolog crossovers. To assess the overall rates of interhomolog noncrossover and crossover recombination, we employed an established interhomolog (IH) recombination assay (Figure 1—figure supplement 1B; Rosu et al., 2011) that enables: (1) controlled generation of a single DSB in meiotic nuclei via heat-shock inducible Mos1 excision (Robert and Bessereau, 2007; Rosu et al., 2011); (2) identification of interhomolog DSB repair of the induced DSB by reversion of an uncoordinated movement ‘Unc’ phenotype (non-Unc progeny, see Materials and methods); and (3) delineation of interhomolog noncrossover and crossover repair outcomes (see Materials and methods). Notably, DSB repair in the IH assay that produces in-frame insertions or deletions can also yield non-Unc progeny that are phenotypically indistinguishable from noncrossover recombinants (Robert et al., 2008). While mutagenic repair in the IH assay is rare in a wild type context (Robert et al., 2008), brc-1 mutants incur small mutations that could feasibly restore unc-5 function (Kamp et al., 2020; Meier et al., 2021). We therefore sequenced the repaired unc-5 locus of putative noncrossover non-Unc progeny in the IH assay to confirm whether the repaired sequence matched the homolog repair template or indicated mutations at the site of Mos1 excision (see Materials and methods). Non-Unc progeny that we were unable to sequence were designated as ‘undetermined non-Unc’.

When we performed the IH assay in the brc-1 mutant, we observed a significant increase in the proportion of non-Unc progeny only at the 22–34 hr timepoint, which corresponds to the mid pachytene stage of meiosis and the end of the interhomolog window (Figure 1—figure supplement 3A, Fisher’s Exact Test p<0.001). Mutants defective in crossover formation prolong access to the homolog as a repair template in the IH assay (Rosu et al., 2011), raising the possibility that brc-1 mutants exhibit delayed prophase progression. brc-1 mutants also exhibit delayed offloading of the early pachytene marker DSB-1 (Trivedi et al., 2022), and BRC-1 localizes to interhomolog recombination nodules and promotes interhomolog crossover formation (Li et al., 2018; Janisiw et al., 2018). Thus, our IH assay data is concordant with accumulating evidence that BRC-1 ensures timely meiotic prophase progression by promoting interhomolog crossover formation. However, the overall frequency of non-Unc progeny was not elevated relative to wild type within the non-interhomolog window (Figure 1—figure supplement 3A and 10–22 hr post heat shock, Fisher’s Exact Test p=0.303), indicating that ablation of brc-1 does not delay meiotic prophase I progression to an extent that interferes with our delineation of the interhomolog and non-interhomolog windows.

The ratio of IH assay crossover and noncrossover recombinant progeny within the interhomolog window between wild type and brc-1 mutants was not significantly altered (Figure 1—figure supplement 3B, Fisher’s Exact Test p=0.515). This result mirrors recombination assays previously performed in brc-1 mutants that provided no evidence for the presence of additional crossovers (Li et al., 2018). Thus, our data supports a role for BRC-1 in regulating crossover recombination specifically between sister chromatids.

BRC-1 prevents mutagenic DNA repair during the mid-pachytene stage

In both the ICR and IH assays performed in brc-1 mutants, we identified progeny that exhibited molecular signatures of mutagenic DSB repair at the Mos1 excision site (Figure 1D–E, Figure 1—figure supplement 4). These events were only identified within the 22–34 hr timepoint, which is composed of nuclei in mid pachytene at the time of heat shock. In the ICR assay, mutants were identified as 2.4% (95% Binomial CI 0.4–12.6%) of all sequenced GFP+ progeny at the 22–34 hr time point. In the IH assay, 17.2% (95% Binomial CI 7.6–34.5%) of all sequenced non-Unc progeny at the 22–34 hr time point were identified as mutant (Figure 1D–E). Notably, we only sequenced GFP+ and non-Unc progeny in the ICR and IH assays, respectively. The frequency of error prone pathway utilization in a brc-1 mutant is therefore likely much greater than our results suggest, as we could not detect mutations that disrupt the GFP or unc-5 open reading frames.

Of the five GFP+ mutant progeny that we identified in the brc-1 IH assay, four contained single mutations that could be attributed to meiotic repair of the Mos1-excision induced DSB (see Materials and methods), and 75% (3/4 mutations) of these meiotic mutations exhibited one or more complementary nucleotides on both ends of the deletion (Figure 1—figure supplement 4B). Further, the single mutant identified among brc-1 ICR assay GFP+ progeny displayed a particularly striking duplication joined at a position sharing microhomology (Figure 1—figure supplement 4A). Regions of microhomology present on either end of small (<50 bp) deletions and templated insertions are characteristic of theta-mediated end joining (TMEJ) (van Schendel et al., 2015). A previous study demonstrated that the rate of TMEJ-mediated germline mutagenesis is elevated in brc-1 mutants (Kamp et al., 2020). Our data is therefore concordant with elevated TMEJ engagement in brc-1 mutants and further reveals that the function of BRC-1 in preventing mutagenic repair events is specifically vital in the mid-pachytene stage of meiotic prophase I.

SMC-5/6 restricts intersister crossovers

The SMC-5/6 DNA damage complex has been hypothesized to function in homolog-independent DSB repair in C. elegans (Bickel et al., 2010). To directly assess the functions of SMC-5 in homolog-independent DSB repair, we performed the ICR assay in the smc-5(ok2421) null mutant. The smc-5(ok2421) deletion allele disrupts the final 6 exons of the 11 exons in the smc-5 coding sequence and prevents SMC-5/6 complex assembly, as evidenced by both biochemical and cytological experiments (Bickel et al., 2010). Nonetheless, smc-5(ok2421) homozygotes develop into fertile adults. SMC-5/6 is therefore not essential for viability in C. elegans, unlike many other organisms (Aragón, 2018). Similar to brc-1 mutants, we found that the frequency of GFP+ progeny in the ICR assay was elevated at all timepoints scored in smc-5(ok2421) null mutants (Figure 2—figure supplement 1A) and was not reduced relative to wild type in null smc-6(ok3294) mutants (Figure 2—figure supplement 1C). The incidence of recombinants in smc-5 null mutants was not dramatically elevated overall in the IH assay (Figure 2—figure supplement 2), suggesting that Mos1 excision is not increased in smc-5 null mutants. Since we cannot be certain of the cause of this increase in recombinants in the smc-5 ICR assay, we refrain from making conclusions regarding the absolute frequency of intersister repair events that occur within this mutant context. Regardless of the absolute number of ICR assay GFP+ recombinant progeny, we did identify both crossover and noncrossover recombinants at all timepoints scored in our smc-5 ICR assays, demonstrating that SMC-5/6 alone is not required for noncrossover nor crossover homolog-independent repair (Figure 2—figure supplement 1A).

To determine if SMC-5 regulates intersister/intrachromatid recombination outcomes, we examined occurrence of smc-5 ICR assay crossover recombinants as a proportion of all recombinants identified. While the proportion of crossovers was not significantly different than wild-type within the individual 12 hr timepoints we scored (Figure 2A), the frequency of crossover recombinants in smc-5 mutants was significantly elevated within the interhomolog window overall (Figure 2B, Fisher’s Exact Test p=0.037). Thus, our data suggests that a function of SMC-5 is to prevent homolog-independent crossovers arising from DSBs induced in early stages of meiotic prophase I. To cytologically affirm that intersister crossovers occur in smc-5 mutants, we assessed the frequency of SCEs in smc-5(ok2421) mutants by examining EdU labeled chromatids at diakinesis. Since mutants of smc-5 are known to have defects in chromosome compaction and produce misshapen bivalents (Bickel et al., 2010; Hong et al., 2016), the majority of chromatid pairs in the smc-5 null mutant were uninterpretable in the EdU labeling assay (See Methods). Despite these challenges, we identified SCEs in 35.7% of scored chromatid pairs (Figure 2C–D, 5/14 chromatid pairs scored, 95% Binomial CI 16.3–61.2%, Fisher’s Exact Test p=0.004) as compared to only 4.1% of wild type chromatid pairs (2/49 chromatid pairs scored, 95% Binomial CI 1.1–13.7%) (Almanzar et al., 2021). While we do not consider these results as an absolute metric for the rate of SCEs in smc-5 mutants due to limited sample size from chromosome morphology issues, our ICR assay and EdU labeling experiments nevertheless demonstrate that intersister repair still occurs in the absence of the fully assembled SMC-5/6 complex and indicate a role for SMC-5 in regulating intersister crossing over during C. elegans meiosis.

Figure 2. SMC-5 represses intersister crossovers.

(A) Bar plot displaying the percent of crossover recombinant progeny identified in wild type and smc-5 ICR assays out of all recombinant progeny scored within individual 12 hr timepoint periods. Frequencies of recombinants identified overall in ICR assays is displayed in Figure 2—figure supplement 1. Wild type ICR assay data is shared in Figures 1A, 2A, B, 4A, Figure 1—figure supplement 2, Figure 2—figure supplement 1, and Figure 4—figure supplement 1. The total number of progeny scored in each dataset are (10–22 hr/22–34 hr/34–46 hr/46–58 hr timepoints) wild type: 28/25/22/15, smc-5(ok2421) 18/37/21/8. Specific progeny counts separated by experimental replicate are presented in Figure 2—source data 1. (B) Bar plot displaying the percent of crossover recombinant progeny identified in wild type and smc-5 ICR assays out of all recombinant progeny scored within the interhomolog window (22–58 hr post heat shock) and non-interhomolog window (10–22 hr post heat shock). Data is shared with panel (A). (C) Images of wild type and smc-5(ok2421) mutant bivalent chromosomes displaying an absence or presence of SCEs. Scale bars represent 1 μm. Dashed bordered insets contain cartoon depictions of the SCE and non-SCE bivalents that are outlined with dashed lines in the images to aid in visualizing exchange events. (D) Frequency of SCEs identified among wild type (n=49) or smc-5(ok2421) mutant (n=14) chromatid pairs scored. (E) Table displaying the percent of sequenced non-Unc progeny in wild type and smc-5 IH assays that showed signatures of mutagenic repair. Numbers in parentheses indicate the number of mutant worms out of the total number of sequenced progeny. Colored boxes indicate timepoints in which mutant progeny were identified. The overall frequency of interhomolog assay non-Unc progeny is displayed in Figure 2—figure supplement 2. Note that only mutations that allow for translation of functional UNC-5 protein can be detected (see Methods). In all panels, error bars represent 95% Binomial confidence intervals, dashed vertical lines delineate between timepoints within the interhomolog window (22–58 hr post heat shock) and non-interhomolog window (10–22 hr post heat shock), and p values were calculated using Fisher’s Exact Test.

Figure 2—source data 1. The source data for Figure 2A is provided.

The total number of ICR assay progeny with GFP+ or non-GFP+ phenotypes are listed. Wild type data is shared with Figure 1, Figure 1—figure supplement 2, Figure 2, Figure 2—figure supplement 1, Figure 4, and Figure 4—figure supplement 1.

Figure 2—source data 2. The source data for Figure 2D is provided.

The number of scorable chromatid pairs with SCE or no SCE events are listed for each image assessed in generating this dataset. Wild type data is shared with Figure 1C.

Figure 2—source data 3. The source data for Figure 2E is provided.

The total number of IH assay nonrecombinant, recombinant, mutant, or undetermined non-Unc progeny are listed. Wild type data is shared with Figure 1, Figure 1—figure supplement 3, and Figure 2—figure supplement 2.

Figure 2—figure supplement 1. Intersister/intrachromatid repair (ICR) assay GFP+ progeny are elevated in smc-5 mutants.

Stacked bar plots displaying the percent of all progeny scored in wild type and smc-5(ok2421) (A) or smc-6(ok3294) (B) ICR assays that were determined to be GFP+ noncrossover or crossover recombinants. Error bars represent the 95% Binomial confidence intervals for the frequencies of GFP+ progeny. Wild type ICR assay data is shared in Figures 1A, 2A, B, 4A, Figure 1—figure supplement 2, Figure 2—figure supplement 1, and Figure 4—figure supplement 1. smc-5 ICR assay data is shared in Figure 2 and Figure 2—figure supplement 1. The total number of progeny scored in each dataset are (10–22 hr/22–34 hr/34–46 hr/46–58 hr timepoints) wild type: 3921/3359/3664/2383, smc-5(ok2421) 1350/1771/1450/449, smc-6(ok3294) (10–22 hr/22–46 hr) 1855/2129. Specific progeny counts separated by experimental replicate are presented in Figure 2—source data 1. p values were calculated by Fisher’s Exact test comparing the sum totals of GFP+ progeny between groups. Vertical dashed lines demarcate the interhomolog window (≥22 hr post heat shock) and non-interhomolog window (10–22 hr post heat shock) timepoints.

Figure 2—figure supplement 2. Interhomolog repair is largely unperturbed in smc-5 mutants.

(A) Stacked bar plots displaying the percent of all progeny scored in wild type and smc-5 IH assays that were determined to be noncrossover recombinants, crossover recombinants, non-Unc mutants, or undetermined non-Unc. (B) Percent of all recombinant progeny identified within the interhomolog window of wild type and smc-5 IH assays that were crossover recombinants. Error bars represent the 95% Binomial confidence intervals for the frequencies of non-Unc progeny. Wild type data is shared between Figures 1E and 2E, Figure 1—figure supplement 3, and Figure 2—figure supplement 2. The total number of progeny scored in each dataset are (10–22 hr/22–34 hr/34–46 hr/46–58 hr timepoints) wild type: 1308/1695/1592/562, smc-5 1031/1466/1369/596. Specific progeny counts separated by experimental replicate are presented in Figure 2—source data 3. p values were calculated by Fisher’s Exact Test comparing the overall frequency of non-Unc progeny (A) or proportion of crossover recombinants of all confirmed recombinant progeny (B, see Materials and methods). Vertical dashed lines demarcate the interhomolog window (22–58 hr post heat shock) and non-interhomolog window (10–22 hr post heat shock) timepoints.

Figure 2—figure supplement 3. Illustrations of mutants identified in smc-5 IH assays.

Illustrations of unc-5 lesions identified in IH assay non-Unc progeny in smc-5 mutants (Figure 2, Figure 2 - figure supplement 2). Specific mutation signatures are numbered and are separated by horizontal dashed grey lines. The wild type unc-5 locus sequence at the site of Mos1 excision and the DSB product generated by Mos1 excision are displayed on the top (Numbered 1). Blue letters indicate a duplicated TA at the site of Mos1 insertion in the unc-5(ox171) locus, while yellow letters indicate the 3 nt 3’ overhangs left following Mos1 excision (Robert et al., 2008). Purple letters with bars indicate complementary bases flanking the deletion site. Red letters struck through with red lines indicate bases in the damaged locus which were deleted to produce the final product.

SMC-5/6 is not required for efficient interhomolog recombination

To determine if SMC-5 regulates interhomolog recombination, we performed the IH assay in the smc-5(ok2421) null mutant. We identified both interhomolog crossover and noncrossover recombinants in the IH assay (Figure 2—figure supplement 2), indicating that SMC-5/6 is not required for either of these recombination pathways. Similar to brc-1 mutants, we noted elevated non-Unc progeny at the 22–34 hr time point in smc-5 mutants, implying that meiotic prophase progression may be slightly delayed when SMC-5/6 function is lost (Figure 2—figure supplement 2A, Fisher’s Exact Test p<0.001). Importantly, non-Unc progeny were not increased in the non-interhomolog window in smc-5 mutants (Figure 2—figure supplement 2A, Fisher’s Exact Test p=1.000), so any delay in meiotic prophase I that may be caused by smc-5 loss of function did not interfere with our delineation of the interhomolog the non-interhomolog windows. The proportion of interhomolog crossover recombinants among all recombinants identified also was not altered in an smc-5 mutant (Figure 2—figure supplement 2B, Fisher’s Exact Test p=0.495). Thus, the IH assay data does not provide evidence that SMC-5/6 has a major role in ensureing efficient interhomolog recombination.

Among all sequenced ICR and IH assay GFP+ and non-Unc progeny isolated in smc-5 mutants, we identified only one mutagenic DSB repair event at the 22–34 hr timepoint of the IH assay (Figure 2E, Figure 2—figure supplements 1A and 2A). Moreover, the frequency of smc-5 non-Unc mutants that we detected at this timepoint (1.32% of all sequenced non-Unc progeny, 95% Binomial CI 0.2–7.1%) is lower than the frequency observed in brc-1 mutants (Fisher’s Exact Test p=0.015). Profiling of meiotic mutagenic DNA repair events in smc-6 mutants has indicated that large structural variations are a primary class of mutations that arise in SMC-5/6 deficient germlines (Volkova et al., 2020). Thus, it is likely that a greater frequency of DSBs were repaired by mutagenic pathways in the smc-5 ICR and IH assays than we detected; if these products disrupted the coding sequence of GFP or unc-5 respectively, however, then they would have escaped detection in our assays.

BRC-1 promotes the formation of long homolog-independent noncrossover conversion tracts

Since we identified functions for BRC-1, and to a lesser extent SMC-5, in restricting intersister crossover recombination, we wanted to determine if recombination intermediate processing is altered in brc-1 and smc-5 mutants. Evaluation of sequence conversions have informed much of our understanding of recombination intermediate processing (Pâques and Haber, 1999; Szostak et al., 1983; Ahuja et al., 2021; Marsolier-Kergoat et al., 2018; Cole et al., 2010; Cole et al., 2014; Medhi et al., 2016; Hum and Jinks-Robertson, 2017). The ICR assay was engineered to contain multiple polymorphisms spanning 12 bp to 567bp 3’ from the site of Mos1 excision, enabling conversion tract analysis of homolog-independent recombination (Toraason et al., 2021c). In a wild type context, 74.2% of ICR assay noncrossover conversion tracts within the interhomolog window are ‘short’, which we define as tracts with a sequence conversion only at the most proximal polymorphism 12 bp downstream from the site of Mos1 excision (Figure 3A and C, wild type 74.2% short tracts 95% CI 62.6–83.3%). In contrast, 96.6% of brc-1 noncrossover tracts during the interhomolog window were ‘short’ (brc-1 interhomolog window 96.6% short tracts 95% CI 82.8–99.4%, Fisher’s Exact Test p=0.010). During the non-interhomolog window, we could not detect an effect of null mutation of brc-1 on the proportion of ‘short’ noncrossover tracts (Figure 3A and C, wild type 72.7% short tracts 95% CI 51.8–86.8%; brc-1 87.5% short tracts 95% CI 52.9–97.8%, Fisher’s Exact Test p=0.638). However, due to the low frequency of noncrossover events in brc-1 mutants within the single non-IH window timepoint, our dataset does not exclude the possibility that BRC-1 may also influence the mechanisms of noncrossover formation in later stages of prophase I.

Figure 3. BRC-1 is required for long noncrossover gene conversion.

(A–B) Plots of conversion tracts sequenced from recombinant ICR assay loci. Vertical grey lines indicate the positions of polymorphisms in the ICR assay with bp measurements given 3’ relative to the site of Mos1 excision (Toraason et al., 2021b; Toraason et al., 2021a;). Each horizontal line represents a single recombinant sequenced, ordered from smallest tract to largest tract within the interhomolog and non-interhomolog windows. Filled in points represent fully converted polymorphisms, while points with white interiors represent heteroduplex DNA sequences identified in conversion tracts. Tracts containing heteroduplex are marked with asterisks. High opacity horizontal lines within plots represent the minimum conversion tract length, or the distance from the most proximal to the most distal converted polymorphisms. Low opacity horizontal lines indicate the maximum conversion tract, extending from the most distal converted polymorphism to its most proximal unconverted polymorphism. Tracts from noncrossover recombinants are displayed in A, while tracts from crossover recombinants are displayed in (B). (C–D) Frequency of short noncrossover tracts (C, minimum tract length 1 bp converted at only the 12 bp polymorphism) or short crossover tracts (D, minimum tract length 198 bp) as a proportion of all tracts identified from progeny laid within the interhomolog and non-interhomolog windows. Error bars represent the 95% binomial confidence intervals of these proportions and p values were calculated using Fisher’s Exact Test. Diagrams above bar plots depict the sizes of tracts considered ‘long’ or ‘short’ in each respective group. In all panels, dashed grey lines delineate between the interhomolog window (22–58 hr post heat shock) and non-interhomolog window (10–22 hr post heat shock) timepoints.

Figure 3—source data 1. The source data for Figure 3 is provided.

The polymorphism conversions scored in individual sequenced ICR assay conversion tracts are listed.

We previously showed that wild type intersister/intrachromatid crossover conversion tracts in C. elegans tend to be larger than noncrossovers, with a median minimum conversion tract length (the distance from the most proximal to the most distal converted polymorphisms in bp) for intersister/intrachromatid crossovers being 198 bp (Figure 3B; Toraason et al., 2021c). Based on this median length for intersister/intrachromatid crossovers, we defined ‘short’ ICR assay crossover tracts as ≤198 bp in length. We found that the proportion of ‘short’ crossover tracts was not altered by brc-1 mutation within the interhomolog window (Figure 3B and D, wild type 80.0% short tracts 95% CI 62.7–90.5%; brc-1 74.1% short tracts 95% CI 61.1–83.9%, Fisher’s Exact Test P=1.000) nor within the non-interhomolog window (Figure 3B and D, wild type 55.6% short tracts 95% CI 37.3–72.4%; brc-1 68.8% short tracts 95% CI 44.4–58.8%, Fisher’s Exact Test p=0.657). Taken together, these results support a model in which BRC-1 regulates mechanisms of intersister/intrachromatid recombination that determine noncrossover gene conversion tract length (but not crossover tract length) during meiotic prophase I (see Discussion).

SMC-5 does not regulate the extent of homolog-independent gene conversion

To assess if SMC-5/6 influences recombination intermediates, we compared smc-5 mutant ICR assay conversion tracts to their wild type counterparts. We found that ICR assay noncrossover conversion tracts in smc-5 mutants exhibited a similar proportion of ‘short’ tracts to wild type in both the interhomolog (Figure 3A and C, wild type 74.2% short tracts 95% CI 62.6–83.3%; smc-5 82.6% short tracts 95% CI 69.3–90.9%, Fisher’s Exact Test p=0.360) and non-interhomolog windows (Figure 3A and C, wild type 72.7% short tracts 95% CI 51.8–86.8%; smc-5 70% short tracts 95% CI 39.7–89.2%). Thus, SMC-5/6 does not have a strong effect on the extent of noncrossover gene conversion in intersister/intrachromatid repair.

When we compared the proportion of ‘short’ smc-5 ICR assay crossover tracts to wild type, we similarly observed that there is no significant difference in the proportion of short and long crossover tracts in either the interhomolog (Figure 3B and D, wild type 80.0% short tracts 95% CI 62.7–90.5%; smc-5 57.9% short tracts 95% CI 36.3—76.9%, Fisher’s Exact Test p=1.000) or non-interhomolog windows (Figure 3B and D, wild type 55.6% short tracts 95% CI 37.3–72.4%; smc-5 62.5% short tracts 95% CI 30.6–86.3%, Fisher’s Exact Test p=1.000). Taken together, these results do not support a function for SMC-5/6 in regulating the extent of noncrossover and crossover gene conversion that yields functional GFP repair products.

In our wild type, brc-1, and smc-5 ICR assay conversion tracts, we additionally noted multiple instances of heteroduplex DNA in our sequencing (Figure 3A and B asterisks). DNA heteroduplex is a normal intermediate when recombination occurs between polymorphic templates but is usually resolved by the mismatch repair machinery (Ahuja et al., 2021; Guo et al., 2017). Our observation of these events across genotypes suggests that at a low frequency, mismatch repair may fail to resolve heteroduplex DNA during the course C. elegans meiotic DSB repair.

Depletion of SMC-5 does not enhance the homolog-independent recombination defects of brc-1 mutants

SMC-5/6 and BRC-1 genetically interact to regulate multiple processes that influence meiotic genomic fidelity, including mitotic DNA replication and chromosome compaction (Hong et al., 2016; Wolters et al., 2014). To test if SMC-5/6 and BRC-1 genetically interact to regulate homolog-independent DNA repair outcomes, we performed the ICR assay in a background where both BRC-1 and SMC-5 are absent. Since the genetic instability and sterility of smc-5;brc-1 double mutants precluded the use the ICR assay in this particular genetic background, we employed the auxin-inducible degron (AID) system (Zhang et al., 2015) to conditionally deplete SMC-5 in the germline of brc-1 mutants (smc-5(syb3065[AID*::3xFLAG]);brc-1(xoe4)). Importantly, the addition of a C-terminal AID* tag to the smc-5 coding sequence did not convey germline sensitivity to exogenous DSBs except in the presence of auxin (Figure 4—figure supplement 2A–B), indicating that this tag does not severely compromise the function of SMC-5 until conditional depletion. When we performed the ICR assay in smc-5::AID*::3xFLAG;brc-1 mutants following SMC-5 germline depletion, we identified GFP+ noncrossover and crossover ICR assay recombinant progeny in smc-5::AID*;brc-1 mutants (Figure 4—figure supplement 1), reinforcing that neither of these repair outcomes require SMC-5 or BRC-1. Further, the proportion of ICR assay crossover recombinants in smc-5::AID*;brc-1 mutants was elevated relative to wild type at both the 22–34 hr and 46–58 hr timepoints within the interhomolog window but was indistinguishable from brc-1 single mutants at all timepoints assayed (Figure 4A). Overall, this result suggests that depletion of SMC-5 does not grossly disrupt homolog-independent repair in brc-1 mutants and is consistent with a model in which BRC-1 acts in the same pathway with SMC-5/6 in regulating intersister repair outcomes.

Figure 4. Interactions of SMC-5/6 and BRC-1 in meiotic DSB repair.

(A) Bar plot displaying the percent of crossover recombinant progeny identified in wild type, brc-1, and smc-5::AID*::3xFLAG;brc-1 ICR assays out of all recombinant progeny scored within individual 12 hr timepoint periods. Frequencies of recombinants identified overall in ICR assays is displayed in Figure 4—figure supplement 1. Wild type ICR assay data is shared in Figures 1A, 2A, B, 4A, Figure 1—figure supplement 2, Figure 2—figure supplement 1, and Figure 4—figure supplement 1. brc-1 ICR assay data is shared in Figure 1A, Figure 1—figure supplement 2, and Figure 4—figure supplement 1. The total number of recombinant progeny scored in each dataset are (10–22 hr/22–34 hr/34–46 hr/46–58 hr timepoints) wild type: 28/25/22/15, brc-1(xoe4) 24/43/36/9, smc-5::AID*::3xFLAG;brc-1 9/16/13/6. Specific progeny counts separated by experimental replicate are presented in Figure 4—source data 3. (B) RAD-51 foci per nucleus displayed as a sliding window (window width 0.1 position units, step size 0.01 position units) across the length of the germline with germline position normalized to the length of pachytene (see Methods). Lines represent the mean RAD-51 foci per nucleus while the shaded area represents SEM within a given window. RAD-51 foci were compared between genotypes within six bins across the germline divided by germline distance: transition zone (−0.25–0), early pachytene (0–0.2), early/mid pachytene (0.2–0.4), mid pachytene (0.4–0.6), mid/late pachytene (0.6–0.8), and late pachytene (0.8–0.1). Heat maps below each bin display the p values for pairwise Mann-Whitney U tests with Holm-Bonferroni correction for multiple comparisons within each bin. For each genotype, n≥7 germlines derived from at least three experimental replicates were analyzed and combined. The number of nuclei scored in each bin (TZ, EP, E/MP, MP, M/LP, LP) are: wild type 258/137/135/121/114/95, smc-5 402/395/348/285/217/189, brc-1 231/170/161/186/159/121, smc-5;brc-1 202/182/167/157/122/82. The per-nucleus RAD-51 counts from this analysis are available in Figure 4—source data 2. (C) Brood viabilities of irradiated hermaphrodites. Bar plots represent the population brood viability and error bars indicate the 95% Binomial confidence interval of this value. The brood viabilities of individual hermaphrodites scored are indicated by data points. For all genotypes and radiation treatments presented in this panel, three experimental replicates were performed with n=5 hermaphrodites scored per condition in each replicate for a total of n=15 hermaphrodite broods scored for each genotype and condition combination. Individual hermaphrodite progeny counts are presented in Figure 4—source data 3. Statistical analysis of the data presented in this panel is depicted in Figure 4—figure supplement 3. Localization of BRC-1::GFP and SMC-5::AID*::3xFLAG in respective smc-5 and brc-1 mutants and in the presence of ionizing radiation is presented in Figure 4—figure supplements 4 and 5. A proposed molecular model for the interactions between BRC-1 and SMC-5/6 is presented in Figure 4—figure supplement 6.

Figure 4—source data 1. The source data for Figure 4A is provided.

The total number of ICR assay progeny with GFP+ or non-GFP+ phenotypes are listed. Wild type data is shared with Figure 1—figure supplement 2, Figure 2, Figure 2—figure supplement 1, Figure 4, and Figure 4—figure supplement 1.

Figure 4—source data 2. The source data for Figure 4B is provided.

The number of RAD-51 foci per nucleus scored are listed.

Figure 4—source data 3. The source data for Figure 4C is provided.

The number of hatched (Live), unhatched (Dead), or unfertilized F1 progeny scored in the brood viability experiment data used to generate Figure 4C and Figure 4—figure supplement 3. Wild type and smc-5(ok2421) data is shared with Figure 4—figure supplement 2A.

Figure 4—figure supplement 1. Intersister/intrachromatid repair (ICR) assay defects in brc-1 mutants are not exacerbated by SMC-5 depletion.

Stacked bar plots displaying the percent of all progeny scored in wild type, brc-1(xoe4), and smc-5(syb3065);brc-1(xoe4) ICR assays that were determined to be GFP+ noncrossover recombinants, crossover recombinants, or mutants. Error bars represent the 95% Binomial confidence intervals for the frequencies of GFP+ progeny. smc-5(syb3065);brc-1 assays were performed in the presence of 10 mM auxin (see methods). Wild type ICR assay data is shared in Figures 1A, 2A, B, 4A, Figure 1—figure supplement 2, Figure 2—figure supplement 1, and Figure 4—figure supplement 1. brc-1 ICR assay data is shared in Figures 1A and 4A, Figure 1—figure supplement 1, and Figure 4—figure supplement 1. smc-5;brc-1 ICR assay data is shared in Figure 4A and Figure 4—figure supplement 1. The total number of progeny scored in each dataset are (10–22 hr/22–34 hr/34–46 hr/46–58 hr timepoints) wild type 3921/3359/3664/2383, brc-1(xoe4) 2042/2017/2005/467, smc-5(syb3065);brc-1(xoe4) 905/737/842/529. Specific progeny counts separated by experimental replicate are presented in Figure 2—source data 1. p values were calculated by Fisher’s Exact Test comparing the sum totals of GFP+ progeny between groups. Vertical dashed lines demarcate the interhomolog window (≥22 hr post heat shock) and non-interhomolog window (10–22 hr post heat shock) timepoints.

Figure 4—figure supplement 2. Loss of BRC-1, but not endogenous tagging of SMC-5::AID*::3xFLAG, inhibits RAD-51 localization to irradiation-induced DSBs.

(A) Brood viabilities of wild type, smc-5(ok2421), or smc-5::AID*::3xFLAG (PHX3065) worms exposed to ionizing radiation. Wild type and smc-5 brood viability data is shared with Figure 4C. (B) Brood viability of DLW220 worms following SMC-5 depletion on 10 mM auxin and exposure to ionizing radiation. In (A) and (B), columns represent the population brood viability, error bars represent 95% Binomial confidence intervals, and p values were calculated by Fisher’s Exact Test (n.s.=not significant p>0.05, *** p<0.001). (C) Deconvolved images of whole extruded germlines stained for RAD-51 and DAPI. All germlines were exposed to 5000 Rads of ionizing radiation and were dissected within 1 hr of the radiation treatment. Loss of brc-1 impedes RAD-51 localization in mid/late pachytene (Janisiw et al., 2018; Li et al., 2018), and this phenotype is not recapitulated nor enhanced by the smc-5(syb3065) allele. Grey lines and labels demarcate the mitotic and meiotic stages of the germline. Scale bars represent 20 μm.

Figure 4—figure supplement 2—source data 1. The source data for Figure 4—figure supplement 2B is provided.

The number of hatched (Live), unhatched (Dead), or unfertilized F1 progeny scored in the brood viability experiment data used to generate Figure 4—figure supplement 2B. Wild type and smc-5(ok2421) data is shared with Figure 4—figure supplement 2A–B.

Figure 4—figure supplement 3. Bayesian analysis of brood viability following ionizing radiation treatment.

(A) Gamma metric estimates of radiation sensitivity inferred from a Beta-Binomial model fit to the irradiation data presented in Figure 4C and (B). For details on this calculation, see Methods. Bars indicate the bounds of the 95% Credible Interval for each Gamma estimate. (B) Brood viability results following irradiation at doses of 0, 2500, or 5000 Rads for nematodes mated to wild type unirradiated males or using endogenous sperm following irradiation. Bars represent the population brood viability, while points represent the brood viabilities of individual hermaphrodites scored. Error bars indicate 95% Binomial confidence intervals of the population brood viability. Parameter estimate summary statistics are presented in Figure 4—figure supplement 3—source data 1. The broods of three separate replicates of n=5 hermaphrodites were scored for each unirradiated condition (total n=15 hermaphrodite broods per condition), the broods of n=2 separate replicates of n=5 hermaphrodites were scored for polq-1 mated and smc-5;brc-1;polq-1 mated conditions (total n=10 hermaphrodite broods per condition), and n=1 replicate of n=5 hermaphrodite broods were scored for the smc-5;brc-1 mated condition. (C) Violin plots of the brood viabilities from individual hermaphrodites scored (black outlines, the same data is displayed as points in Figure 4B and in panel B) and 1500 simulated broods generated using the posterior parameter estimates of the Beta-Binomial model fit to the data (see Methods). (D) Genetic interaction diagram inferred from estimates presented in panel A. SMC-5/6 and BRC-1 both contribute to progeny viability following meiotic exposure to exogenous DSBs. However, BRC-1 also inhibits error prone repair, which can compensate for the DSB defects of smc-5 mutants when brc-1 is also ablated.

Figure 4—figure supplement 3—source data 1. The source data for Figure 4—figure supplement 3A is provided.

Summary statistics of Beta-Binomial model parameter estimates (see Materials and methods) output by RStan (see Figure 4—figure supplement 3—source code 1) are provided.

Figure 4—figure supplement 3—source code 1. The source code for Figure 4-figure supplement 3A and 3C is provided.

R code to perform Beta-Binomial model fitting and posterior predictive simulations is provided.

Figure 4—figure supplement 4. SMC-5/6 is not required for GFP::BRC-1 localization.

Deconvolved widefield images of germline nuclei stained for GFP (GFP::BRC-1), chromosome axis protein HTP-3, and DAPI (DNA) in a wild type or smc-5(ok2421) mutant background and treated with 0 or 5000 Rads of ionizing radiation. Scale bars represent 5 μm. Stages of meiotic nuclei were determined based on DAPI morphology and are listed on the top of the figure (PMT = premeiotic tip, TZ = transition zone, EP = early pachytene, MP = mid pachytene, LP = late pachytene, Dip = Diplotene). Arrowheads indicate GFP::BRC-1 foci.

Figure 4—figure supplement 5. BRC-1 is not required for SMC-5::AID*::3xFLAG localization.

Deconvolved images of germline nuclei stained for AID* (SMC-5::AID*::3xFLAG), chromosome axis protein HTP-3, or DAPI (DNA) in a wild type or brc-1(xoe4) mutant background and treated with 0 or 5000 Rads of ionizing radiation. Scale bars represent 5 μm. Stages of meiotic nuclei are determined based on DAPI morphology and are listed at the top of the figure. For each image, a max intensity projection of whole nuclei and single z-slices are displayed to demonstrate the relative localization of SMC-5 and HTP-3. Arrowheads indicate examples of colocalization between HTP-3 and SMC-5::AID*3xFLAG.

Figure 4—figure supplement 6. Proposed model of BRC-1 and SMC-5/6 function in C. elegans intersister DSB repair.

Displayed is a proposed model for the functions of BRC-1 and SMC-5/6 in regulating intersister DSB repair in the C. elegans germline. Under wild type conditions, BRC-1 promotes efficient resection of the damaged chromatid (blue) and facilitates strand invasion and extension with the sister chromatid (purple). BRC-1 also inhibits TMEJ either through direct antagonism of this pathway or indirectly by promoting efficient recombination. Following strand extension, the majority of D-loop intermediates are dissolved and repaired through SDSA, which is efficient due to BRC-1 promoted resection of the second end of the DSB. A minority of D-loops will proceed to form joint molecules, which may potentially be preferentially resolved as noncrossovers via the action of SMC-5/6 or as crossovers in an SMC-5/6 independent manner. In addition, SMC-5/6 inhibits the formation of toxic joint molecule intermediates, such as multi-chromatid joint molecules. In a brc-1 mutant, DSBs are not resected to wild type levels and strand invasion is inefficient. Reduced resection limits the efficiency of second end capture in SDSA, reducing noncrossovers through this pathway. Further, limited strand extension reduces the extent of gene conversion in noncrossovers generated by successful SDSA or joint molecule dissolution. Failure in SDSA leads to increased DSB reinvasion of repair templates, contributing to the tandem duplications observed in mutants for BRCA1 (Chandramouly et al., 2013; Kamp et al., 2020). In addition, either due to absence of direct inhibition by BRC-1 or inefficiencies in recombination, end joining (particularly TMEJ) becomes activated to resolve DSBs. However, reduced resection does not inhibit joint molecule formation, leading to more of these intermediates which are preferentially resolved as crossovers. Finally, in an smc-5 mutant, early steps in DSB repair proceed normally. However, absence of SMC-5/6 results in unconstrained joint molecule formation, including toxic intermediates. Failure in SMC-5/6 action to promote noncrossover repair further increases the proportion of joint molecules which are resolved as crossovers.

BRC-1 promotes recombinase loading to DSBs in smc-5 mutants

To determine the interactions of SMC-5 and BRC-1 in regulating early steps of meiotic DSB repair, we examined the localization of the recombinase RAD-51, which marks DSBs undergoing early steps of recombination (Colaiácovo et al., 2003), in smc-5, brc-1, and smc-5;brc-1 mutants (Figure 4B). The number of RAD-51 foci per nucleus are reduced at early-mid pachytene in brc-1 null mutants relative to wild type due to ectopic engagement of error-prone pathways that antagonize the formation of RAD-51 intermediates (Li et al., 2018; Janisiw et al., 2018; Li et al., 2020; Trivedi et al., 2022). In contrast, mutants for either smc-5 or smc-6 exhibit highly elevated levels of RAD-51 throughout prophase I (Bickel et al., 2010). Our results corroborate these previous studies, as we observed that brc-1 mutants exhibit reduced RAD-51 foci relative to wild type in early through mid pachytene (Figure 4B) and that smc-5 mutants exhibited elevated RAD-51 foci compared to wild type at all stages except late pachytene (Figure 4B). Strikingly, we observed that the increased number of RAD-51 foci per nucleus in smc-5 mutants was suppressed when brc-1 was also mutated (Figure 4B). This result is reminiscent of interactions between BRC-1 and SMC-5/6 in the mitotic germline, as BRC-1 is required for localization of RAD-51 to collapsed replication forks that arise in smc-5 mutants (Wolters et al., 2014). BRC-1 is required to load and/or maintain RAD-51 localization to DSBs at mid/late pachytene when interhomolog recombination is perturbed (Li et al., 2018; Janisiw et al., 2018) as well as following induction of exogenous DSBs from sources such as ionizing radiation (Figure 4—figure supplement 4C; Li et al., 2018; Janisiw et al., 2018). Our results expand upon these prior analyses and identify functions for BRC-1 in promoting recombination repair of DSBs throughout meiotic prophase I in the absence of the SMC-5/6 complex.

BRC-1 sensitizes smc-5 mutants to exogenous DSBs by restricting error-prone repair pathways

The genetic instability and defects in RAD-51 localization that we observed in smc-5;brc-1 mutants contrasted with the lack of a strong phenotype in ICR assay outcomes when SMC-5 was depleted in brc-1 mutants. This incongruity raised the possibility that SMC-5 and BRC-1 may interact to regulate recombination-independent DNA repair pathways. To determine the functional interplay of SMC-5/6 and BRC-1 in regulating meiotic DSB repair, we assessed the sensitivity of smc-5, brc-1, and smc-5;brc-1 mutant gametes to exogenous DSBs induced by ionizing radiation. Accordingly, we treated adult hermaphrodites of each genotype with 0, 2500, or 5000 Rads of ionizing radiation, which induces an estimated 9.8 and 19.6 DSBs/chromosome pair, respectively (Yokoo et al., 2012), and assayed the resultant progeny derived from their irradiated oocytes for larval viability (Figure 4C) during a similar reverse time course as was done in our ICR and IH assays (see Materials and methods), thereby enabling us to identify meiosis-stage-specific DNA repair defects in these mutants.

We noted differences in the brood viabilities of individual genotypes and variation between hermaphrodites within those genotypes even in unirradiated conditions (Figure 4C). These baseline disparities posed a challenge in interpreting the effects of ionizing radiation on brood viability, as the resilience of an irradiated cohort will be affected by both underlying fertility defects as well as the effects of the exogenous DNA damage that we sought to quantify. To estimate the effect of ionizing radiation on brood viability and to account for inter-hermaphrodite variance in our analysis, we employed a Bayesian hierarchical statistical modeling approach using our dataset (Figure 4—figure supplement 3, see Materials and methods). From this analysis, we calculated a metric termed ‘gamma’ for each genotype, representing the sensitivity of a given genotype to ionizing radiation (Figure 4—figure supplement 3A, see Materials and methods). A gamma estimate of 1 indicates that irradiation has no effect on brood viability, while a gamma estimate of 0 indicates that all progeny of a genotype are inviable following irradiation.

To assess the differential sensitivities of smc-5, brc-1, and smc-5;brc-1 mutants across meiotic prophase I, we compared the 95% credible intervals of the gamma estimates for each genotype within the interhomolog and the non-interhomolog windows for both moderate (2500 Rads) and high (5000 Rads) irradiation doses (Figure 4—figure supplement 3A). Across all irradiation doses and timepoints, we note that loss of smc-5 conveys a greater sensitivity to exogenous DNA damage than loss of brc-1 (Figure 4C, Figure 4—figure supplement 3A), emphasizing that the SMC-5/6 complex prevents catastrophic defects following exogenous DNA damage induction. The sensitivity of brc-1 mutants was greater in the non-interhomolog window at high doses of irradiation (Figure 4C, Figure 4—figure supplement 3A), suggesting that nuclei in late pachytene become more dependent upon BRC-1 to efficiently resolve DNA damage.

At 2500 Rad of ionizing radiation, we found that mutation of both smc-5 and brc-1 differentially impacted radiation resilience within the interhomolog and non-interhomolog windows. In the interhomolog window, the smc-5;brc-1 double mutant and smc-5 single mutant gamma estimates overlap, indicating that loss of BRC-1 does not alter smc-5 mutant sensitivity at this timepoint (Figure 4C, Figure 4—figure supplement 3A). Further, brc-1 mutant gamma estimates are indistinguishable from wild type within the interhomolog window (Figure 4C, Figure 4—figure supplement 3A); therefore, the absence of an interaction may reflect the dispensability of BRC-1 in early prophase I for progeny survival when DNA damage levels are not extreme. In the non-interhomolog window, however, we observed a striking suppression of sensitivity to exogenous DSBs in smc-5;brc-1 double mutants as compared to smc-5 single mutants (Figure 4C, Figure 4—figure supplement 3A). This synthetic suppression of sensitivity is recapitulated across meiotic prophase I at 5000 Rads of ionizing radiation in smc-5;brc-1 double mutants (Figure 4C, Figure 4—figure supplement 3A). Thus, our data indicates that DNA damage sensitivity observed in smc-5 mutants is enhanced by BRC-1-mediated functions.

The synthetic suppression of radiation-induced brood lethality and reduced RAD-51 foci in smc-5;brc-1 double mutants prompted us to hypothesize that recombination-independent pathways may be engaged to repair DSBs when both SMC-5 and BRC-1 are ablated, thereby alleviating the DSB repair defects of smc-5 mutants. BRC-1 is known to repress both TMEJ and NHEJ in multiple organisms, including C. elegans (Kamp et al., 2020; Li et al., 2020; Huen et al., 2010), and ablation of NHEJ or TMEJ is sufficient to partially rescue RAD-51 foci loading to DSBs in brc-1 mutants (Trivedi et al., 2022). To test whether TMEJ and/or NHEJ contribute to the ionizing radiation resilience observed in smc-5;brc-1 double mutants, we created smc-5;brc-1;polq-1 and smc-5;brc-1;lig-4 triple mutants that are defective in TMEJ and NHEJ respectively. lig-4 mutation did not fully suppress the synthetic radiation resilience of smc-5;brc-1 mutants, suggesting that NHEJ is not a primary mechanism of DNA repair in meiotic nuclei when both SMC-5/6 and BRC-1 are lost. However, we observed a striking effect in smc-5;brc-1;polq-1 mutants; even at the moderate dose of 2500 Rads, loss of POLQ-1 caused dramatic sensitization of smc-5;brc-1 mutants to ionizing radiation (Figure 4C, Figure 4—figure supplement 3A). This effect was particularly strong in the non-interhomolog window, where smc-5;brc-1;polq-1 mutants were nearly sterile following ionizing radiation treatment regardless of irradiation dose (Figure 4C, Figure 4—figure supplement 3A). These results strongly indicate that smc-5;brc-1 deficient germ cells exposed to exogenous DNA damage are dependent upon TMEJ for fertility.

Since irradiation of adult hermaphrodites also induces additional DSBs in mature sperm, we wanted to ensure impacts on brood viability were not due to sperm-specific defects. To test the contributions of sperm effects to our radiation sensitivity analysis, we determined the viability of oocytes from irradiated hermaphrodites mated to unirradiated wild type males (Figure 4—figure supplement 3B). DSBs induced in sperm are primarily repaired by TMEJ in the fertilized zygote and have minimal impact on F1 viability when POLQ-1 is present (Wang et al., 2023), so we focused our analysis on polq-1, smc-5;brc-1, and smc-5;brc-1;polq-1 null mutants. As has been previously reported (Wang et al., 2023), we found that at high doses of radiation polq-1 mutants exhibited a sperm-specific fertility defect (Figure 4—figure supplement 3A–B). A similar restoration of viability was observed in the interhomolog window of smc-5;brc-1;polq-1 mutants, indicating that the effect of polq-1 on oocytes irradiated in early stages of prophase I was primarily due to sperm-specific effects. However, the increased radiation sensitivity of smc-5;brc-1;polq-1 within the non-interhomolog window was not rescued by mating (Figure 4—figure supplement 3A–B). Thus, our data indicate that smc-5;brc-1 oocytes become dependent upon TMEJ for DSB repair in late stages of meiotic prophase I.

Taken together, the results of our irradiation analysis indicate that both SMC-5/6 and BRC-1 contribute to gamete viability following ionizing radiation treatment, with loss of SMC-5/6 having far greater consequences for the gamete than loss of BRC-1 (Figure 4C, Figure 4—figure supplement 3A). As brc-1 mutation confers synthetic resilience to radiation in smc-5 mutants, we provide evidence that some functions of BRC-1 contribute to the meiotic DSB repair defects associated with loss of smc-5. Further, we find that TMEJ is vital to radiation resilience in late meiotic prophase I in smc-5;brc-1 mutants, suggesting that this pathway compensates for the DNA repair deficiencies incurred when SMC-5/6 and BRC-1 are both lost (Figure 4—figure supplement 3D). Repression of TMEJ by BRC-1 may therefore be deleterious to reproductive success in smc-5 null mutants by enabling more severe DNA repair errors to occur.

BRC-1 localization is independent of SMC-5/6

To determine whether there is a co-dependency between BRC-1 and SMC-5/6 for localization, we first examined GFP::BRC-1 by immunofluorescence in both wild type and smc-5 mutant germlines. Similar to previous studies (Li et al., 2018; Janisiw et al., 2018), we observed that BRC-1 localizes as a nuclear haze in the premeiotic tip through early pachytene and becomes associated with the synaptonemal complex during the progression of pachytene in wild-type germlines (Figure 4—figure supplement 4). In late pachytene, BRC-1 relocates to the short arms of the bivalents, where it can be visualized at diplotene as short tracks on the compacted chromosome arms (Figure 4—figure supplement 4). When we examined smc-5 mutants, the general pattern of GFP::BRC-1 localization across meiotic prophase was similar to wild type, except in the premeiotic tip where GFP::BRC-1 formed bright foci (Figure 4—figure supplement 4). Given that BRD-1, the obligate heterodimeric partner of BRC-1, was found to form a similar localization in smc-5 mutants (Wolters et al., 2014), the bright GFP::BRC-1 foci in the pre-meiotic tip likely mark BRC-1 localization to collapsed replication forks (Bickel et al., 2010; Wolters et al., 2014). Our data therefore indicate that the localization of BRC-1 does not require SMC-5/6.

To assess if BRC-1 changes localization in response to exogenous DSBs, we exposed wild type and smc-5 mutant germlines to 5000 Rads of ionizing radiation and again examined germline GFP::BRC-1 by immunofluorescence. We found that the general pattern of GFP::BRC-1 localization was not altered following irradiation in both wild type and smc-5 mutants (Figure 4—figure supplement 4). Taken together, our results suggest that BRC-1 localization is not altered following the induction of exogenous DSBs even when SMC-5/6 complex function is lost.

SMC-5/6 localization is independent of BRC-1

To determine whether SMC-5/6 localization is dependent upon BRC-1, we examined the localization of SMC-5::AID*::3xFLAG in both wild type and brc-1 mutants (Figure 4—figure supplement 5). We observed that, similar to a prior study (Bickel et al., 2010), SMC-5/6 is present in meiotic nuclei within meiotic prophase I. Notably, we found that SMC-5 staining in early and mid-pachytene was primarily localized to the chromosome axis, marked with HTP-3 (Figure 4—figure supplement 5). This localization pattern was altered in the transition to the diplotene stage, when we observed that SMC-5 localizes to the chromatin on the compacting bivalent chromosomes, matching previous analysis (Figure 4—figure supplement 5; Bickel et al., 2010). The pattern of SMC-5 localization was not disrupted in a brc-1 mutant, and similarly was not altered following exposure to 5000 Rads of ionizing radiation (Figure 4—figure supplement 5). Thus, the localization of SMC-5/6 does not depend upon the activity of BRC-1 and is not altered following induction of exogenous DNA damage at the levels we tested.

Discussion

Meiotic cells must coordinate DNA repair pathway engagement to ensure both formation of interhomolog crossovers and repair of all DSBs. The highly conserved proteins SMC-5/6 and BRC-1 promote accurate DSB repair, but the specific DNA repair outcomes that these proteins regulate have remained unclear. We find that SMC-5/6 and BRC-1 act to repress intersister crossovers and further demonstrate that BRC-1 specifically promotes long homolog-independent noncrossover gene conversion. We also observe that mutants for brc-1 incur DNA repair defects at mid pachytene, as evidenced by increased engagement of error prone repair pathways and deficiencies in RAD-51 localization to DSBs. By comparing the germ cell resilience of smc-5, brc-1, and smc-5;brc-1 mutants to ionizing radiation, we reveal that BRC-1 enhances the meiotic DNA repair defects of smc-5 mutants and provide evidence that this interaction is in part underpinned by BRC-1 dependent repression of TMEJ and promotion of recombination. Taken together, our study illuminates specific functions and interactions of highly conserved DNA repair complexes in promoting germline genome integrity.

BRC-1 and SMC-5/6 as ‘intersister repair’ proteins

Foundational work defining the phenotypes of brc-1 and smc-5/6 loss-of-function mutants provided rationale that these proteins regulate homolog-independent DSB repair (Bickel et al., 2010; Adamo et al., 2008). Our study utilizes genetic and cytological technologies not available at the time of this initial work to specifically examine homolog-independent repair in the absence of brc-1 and smc-5. While we find that neither BRC-1 nor SMC-5/6 are necessary for intersister repair in C. elegans meiosis per se, we instead identified functions for both BRC-1 and SMC-5 in regulating intersister repair outcomes, thereby supporting the original conclusions of Adamo et al. and Bickel et al. that BRC-1 and SMC-5/6 function in homolog-independent repair. Importantly, we observed intersister repair in brc-1 and smc-5 mutants arising from both SPO-11 independent (ICR assay) and SPO-11 dependent (EdU labeling assay) DSBs, indicating that intersister repair in these mutants is not artifactual to Mos1 excision-derived DSBs but instead is engaged to resolve both endogenous and exogenous DNA damage.

A growing body of evidence has found that BRC-1 and SMC-5/6 exert subtle but important functions regulating interhomolog repair. BRC-1 physically interacts with the synaptonemal complex, localizes to recombination nodules, promotes efficient interhomolog crossover formation, and regulates the meiotic crossover landscape under conditions of meiotic dysfunction (Li et al., 2018; Janisiw et al., 2018; Li et al., 2020). Our observation that interhomolog recombinants in brc-1 were elevated in the IH assay specifically at the transition between the interhomolog and non-interhomolog windows parallels recent cytological analysis (Trivedi et al., 2022) indicating that BRC-1 promotes timely meiotic progression, perhaps by regulating efficient interhomolog crossover recombination. We identified a similar increase in IH assay recombinants at the end of the interhomolog window in smc-5 mutants, raising the possibility that SMC-5/6 may also function to promote meiotic progression.

SMC-5/6 acts redundantly with the BLM helicase HIM-6 and the RMI1 homolog RMH-1 to prevent or eliminate interchromosomal (including interhomolog) attachments (Hong et al., 2016; Jagut et al., 2016). In Arabidopsis, loss-of-function mutations in multiple SMC5/6 subunits reduces crossover interference; similarly, smc-5;him-6 C. elegans mutants form additional interhomolog crossovers with reduced interference (Hong et al., 2016; Zhu et al., 2021). Taking our data in the context of this accumulating evidence, we suggest that BRC-1 and SMC-5/6 have diverse functions for regulating multiple pathways of DSB repair, including intersister recombination, interhomolog recombination, and the engagement of error-prone pathways.

Functions of BRC-1 in C. elegans meiotic DNA repair

We find that meiotic cells deficient in BRC-1 exhibit multiple DNA repair defects, including reduced noncrossover conversion tract length, elevated rates of intersister crossovers, and engagement of error prone DSB repair mechanisms at the mid-pachytene stage. What functions of BRC-1 may underpin these phenotypes? BRCA1 is thought to regulate many early steps in recombination including DSB resection, strand invasion, and D-loop formation in other model systems (Kamp et al., 2020; Zhao et al., 2017; Chen et al., 2008; Cruz-García et al., 2014; Chandramouly et al., 2013). We propose that many of these functions are conserved in C. elegans BRC-1.

While research in budding yeast, mammalian systems, and Arabidopsis suggests that SDSA is the primary pathway for the formation of noncrossovers in meiosis (Hunter, 2015; Ahuja et al., 2021; Marsolier-Kergoat et al., 2018) and that processing of joint molecular intermediates can generate noncrossovers during Drosophila meiosis (Crown et al., 2014), the mechanisms by which C. elegans noncrossover recombination occurs is unknown. Our finding that brc-1 mutation affects the extent of ICR assay noncrossover gene conversion, but not crossover gene conversion, suggests that homolog-independent noncrossovers arise from a distinct intermediate or undergo differential processing from crossovers in C. elegans. This result is consistent with a model in which either SDSA or joint molecule dissolution is a primary mechanism of intersister noncrossover recombination in the C. elegans germline (Figure 4—figure supplement 6).

The size of an SDSA or dissolution noncrossover conversion tract is primarily determined by the length of DNA strand extension (Marsolier-Kergoat et al., 2018; Guo et al., 2017; Keelagher et al., 2011). Human BRCA1 promotes strand invasion and D-loop formation (Zhao et al., 2017), which may influence the efficiency of strand extension. Our conversion tract data therefore raises the possibility that C. elegans BRC-1 influences the formation and/or stability of strand invasion intermediates, thereby promoting the formation of long ICR assay noncrossover gene conversion events (Figure 4—figure supplement 6). Our data also demonstrate that brc-1 mutants exhibit elevated intersister crossovers. If BRC-1 only functions to promote strand invasion and D-loop formation, then we would expect brc-1 mutation to reduce intersister crossovers and not increase their occurrence. Previous studies have also suggested that BRCA1/BRC-1 regulates DSB resection (Chen et al., 2008; Cruz-García et al., 2014), and we propose that this function better accounts for our observed increase in intersister crossovers in the brc-1 null mutant. Specifically, BRCA1-promoted long range DSB resection may be important for the efficiency of SDSA by ensuring sufficient single stranded DNA is exposed on the second end of the DSB to facilitate strand annealing (Kamp et al., 2020; Chandramouly et al., 2013). While sufficient resection may be critical in resolving SDSA noncrossovers, long range resection is not required for the efficient formation of joint molecules (Zakharyevich et al., 2010). Thus, reduced length of DNA resection due to a brc-1 mutation may impede SDSA and therefore increase the probability that DSBs will form joint molecule intermediates, thereby promoting intersister crossover outcomes.

Reduced resection in conjunction with inefficient strand invasion and synthesis during recombination may further explain the ectopic engagement of TMEJ observed in brc-1 mutants (Kamp et al., 2020). Short range resection provides sufficient substrate for TMEJ (Ramsden et al., 2022), which in combination with inefficient homology search may provide more opportunity for TMEJ engagement. Polymerase θ helicase activity is also sufficient to remove recombinases from single-stranded DNA to promote end-joining repair (Schaub et al., 2022). BRC-1 may promote recombination and prevent TMEJ by stabilizing RAD-51 on resected DNA or antagonizing this activity of polymerase θ. Notably, the timepoint at which we identified mutants in the brc-1 ICR and IH assays correlate to the stage of meiotic prophase I at which BRC-1 is also required in late meiotic prophase I for the loading and/or maintenance of RAD-51 (Li et al., 2018; Janisiw et al., 2018). Overall, our data is consistent with a model in which BRC-1 promotes multiple DSB repair steps, including resection and the formation of early strand invasion intermediates, to facilitate intersister noncrossover repair (Figure 4—figure supplement 6).

Functions of SMC-5/6 in C. elegans meiotic DSB repair

C. elegans deficient in SMC-5/6 exhibit severe meiotic genome instability and become sterile over successive generations (Volkova et al., 2020; Bickel et al., 2010). Despite these stark phenotypes, our ICR and IH assays identified only relatively subtle phenotypes in smc-5 mutants. It should be noted, however, that the ICR and IH assays only detect DSB repair outcomes that encode a functional protein product. Thus, many of the severe DSB repair mutations associated with SMC-5/6 deficiency (Volkova et al., 2020) may disrupt the coding sequence in the ICR or IH assays and therefore escape detection.

In budding yeast, Smc5/6 prevents the accumulation of toxic interchromosomal attachments and recombination intermediates (Bonner et al., 2016; Chen et al., 2009; Peng et al., 2018; Xaver et al., 2013; Lilienthal et al., 2013; Copsey et al., 2013). Prior evidence in C. elegans suggests that some of these functions are likely conserved, as double mutants for smc-5 and the BLM helicase homolog him-6 are sterile and display chromatin bridges indicative of persistent interchromosomal attachments (Hong et al., 2016). This synthetic phenotype suggests that these two complexes act in parallel to prevent the accumulation of joint molecules. A previous study (Almanzar et al., 2021) and the data we present here reveal that both SMC-5 and HIM-6 repress intersister crossovers. The synthetic sterility associated with loss of both SMC-5 and HIM-6 then may be a product of parallel functions for these proteins in limiting and/or resolving joint molecules. Although BLM is known to play multiple roles in regulating recombination, a core function of this helicase is in antagonism of joint molecule formation and promotion of noncrossover recombination (Schvarzstein et al., 2014; McVey et al., 2004; Weinert and Rio, 2007). SMC-5/6 in C. elegans meiosis may therefore act as a second line of defense to ensure the elimination of inappropriate joint molecule intermediates that have formed more stable configurations. We also did not observe a large increase in ICR assay crossover products in smc-6 mutants (Figure 2—figure supplement 1B). Thus, it is possible that even in the absence of fully assembled SMC-5/6 complex, SMC-5 and SMC-6 may independently exert some functions that subtly impact DSB repair outcomes.

Our observation that smc-5 mutation does not alter ICR assay conversion tracts is also consistent with a model in which SMC-5/6 influences recombination following joint molecule formation. Recent work has shown that SMC5/6 is capable of DNA loop-extrusion, indicating a function by which the complex may organize chromatin to facilitate efficient DSB repair (Pradhan et al., 2022). Specific subunits of SMC-5/6 also exhibit enzymatic function, such as the E3 SUMO ligase Nse2/Mms21 (Andrews et al., 2005), suggesting that SMC-5/6 may act to post-translationally modify target proteins to regulate DNA repair. In summary, our data indicates that SMC-5/6 is not necessary for C. elegans intersister recombination and opens the door to future investigation into its molecular roles in regulating efficient DSB repair.

Temporal regulation of error-prone meiotic DSB repair

In the ICR and IH assays that we performed in brc-1 mutants, we identified mutagenic repair events specifically at the 22–34 hr timepoint, corresponding to oocytes in mid pachytene at the time of Mos1-excision induced DSB formation. Further, the repair events that we identified frequently displayed microhomologies flanking the deletion site – a characteristic signature of TMEJ. The limited temporal window in which we identified these events suggests that TMEJ may be relegated to later stages of meiotic prophase I. There are a number of important events that coincide with the mid/late pachytene transition of C. elegans meiosis, including a MAP kinase phosphorylation cascade, designation of interhomolog crossovers, a switch from RAD-50 dependence to independence for loading of RAD-51 to resected DNA, and loss of access to the homolog as a ready repair template (Rosu et al., 2011; Yokoo et al., 2012; Hayashi et al., 2007; Nadarajan et al., 2016; Church et al., 1995; Lee et al., 2007; Kritikou et al., 2006). In mitotic human cell culture, Polθ is phosphorylated and activated in specific stages of mitosis by polo-like kinase 1 (PLK1; Gelot et al., 2023). The C. elegans meiotic polo-like kinase ortholog PLK-2 acts in mid-late pachytene to antagonize CHK-2 activity, thereby promoting interhomolog crossover designation and halting DSB induction (Zhang et al., 2023). We raise the hypothesis that C. elegans meiotic POLQ-1 may be activated in late stages of meiotic prophase I by PLK-2 analogously to mitotic human Polθ activation by PLK1. These regulatory events may confer a switch in cellular ‘priorities’ from ensuring formation of interhomolog recombination intermediates to promoting repair of all residual DSBs even through error prone mechanisms. By repairing all residual DSBs (even in the wake of sequence errors), germ cells avoid catastrophic chromosome fragmentation during the meiotic divisions.

During the mid to late pachytene transition, an important function of BRC-1 (and to a lesser extent SMC-5/6) may be to prevent TMEJ either by antagonizing this pathway or facilitating efficient recombination. Our irradiation experiments revealed that both brc-1 and smc-5 mutant oocytes exhibit greater sensitivity to exogenous DNA damage in late stages of prophase I, suggesting that cellular requirements for efficacious DSB repair change during the transition to late pachytene. Moreover, during the mid-late pachytene stage, several changes regarding BRC-1 occur: (1) BRC-1 protein localization changes; and, (2) BRC-1 is required to load (and/or stabilize) RAD-51 filaments (Li et al., 2018; Janisiw et al., 2018; Figure 4—figure supplement 2C). We found that brc-1 mutants incur mutations with characteristic TMEJ signatures specifically at the mid/late pachytene stage, suggesting that the changes in BRC-1 localization and function at this stage may coincide with changes in the availability and/or regulation of error prone repair mechanisms. Our irradiation experiments demonstrated that smc-5;brc-1 double mutant oocytes in late meiotic prophase I are dependent upon TMEJ DNA polymerase θ homolog polq-1 for viability. If BRC-1 functions that repress TMEJ (Kamp et al., 2020) are specific to late prophase, then this result suggests that many DSBs in smc-5;brc-1 mutants induced in early prophase may not be repaired until mid/late pachytene, when TMEJ is active. Spatiotemporal transcriptomic analysis has shown that polq-1 is expressed throughout meiotic prophase I (Tzur et al., 2018). As we only identified error-prone resolution of DSBs induced at mid pachytene, our findings raise the possibility that BRC-1 independent mechanisms may repress TMEJ in early/mid pachytene. Our results in brc-1 mutants therefore lay the groundwork for future research delineating the temporal regulation of error-prone meiotic DSB repair. Taken together, our study reveals that the engagement of error-prone and recombination DSB repair pathways are differentially regulated during the course of C. elegans meiotic prophase I.

Interaction between BRC-1 and SMC-5/6 in meiotic DNA repair

Our observation of multiple genetic interactions in brc-1 and smc-5 double mutants, but no coincident change in either SMC-5/6 or BRC-1 localization in their respective null mutants, suggests that the phenotypes of smc-5, brc-1, and smc-5;brc-1 mutants are likely not derived from direct physical interactions between these complexes nor action on shared substrates. Instead, we propose that BRC-1 and SMC-5/6 exert sequential roles in regulation of DSB repair. A similar model was proposed by Hong et al., 2016 which postulated that early recombination defects in brc-1 mutants may alleviate the toxic recombination intermediates formed in smc-5;him-6 double mutants.

How might DNA repair defects in brc-1 mutants ameliorate genomic instability associated with smc-5 mutation? Our observation that brc-1 mutation suppresses the increased RAD-51 foci in smc-5 mutants suggests that BRC-1 acts to promote recombination repair of DSBs even in contexts where recombination is defective (such as in smc-5 null mutants). Ablation of NHEJ and TMEJ proteins in brc-1 mutants rescues RAD-51 foci formation, indicating that BRC-1 acts to promote recombinase loading at the exclusion of error-prone DSB repair (Trivedi et al., 2022). Thus, it is likely that many DSBs in smc-5;brc-1 mutants are repaired by recombination-independent pathways and circumvent smc-5 mutant defects.

brc-1 mutant defects in DSB resection and strand invasion may also contribute to suppressing smc-5 mutant phenotypes. In budding yeast, the additional ssDNA generated by long range resectioning of a DSB is used for homology search (Chung et al., 2010). Inefficient resection in brc-1 mutants may reduce the extent of homology that could anneal to heterologous templates and contribute to toxic joint molecules (Figure 4—figure supplement 6). Compromised strand invasion and D-loop formation in brc-1 mutants could also limit the capacity for DSBs to form multi-chromatid engagements. Conversely, resection defects of brc-1 mutants may increase the risk for toxic recombination intermediates in smc-5 mutants by limiting the efficiency of SDSA and therefore biasing DSBs to form joint molecules. Future studies assessing the specific recombination intermediates formed in brc-1 and smc-5 mutants is needed to distinguish between these possibilities.

In summary, our data suggest that BRC-1 acts upstream of SMC-5/6 to promote recombination by facilitating early DSB processing and strand invasion. SMC-5/6, then, likely functions downstream of BRC-1 to stabilize or regulate joint molecules, consistent with its functions in preventing the accumulation of toxic interchromosomal attachments (Hong et al., 2016; Jagut et al., 2016). Our work reveals interplay between these highly conserved DNA repair complexes in regulating DNA repair pathway engagement and outlines targets for future research to determine the molecular basis of these interactions.

Materials and methods

Caenorhabditis elegans strains and maintenance

Caenorhabditis elegans strains were maintained at 15°C or 20°C on nematode growth medium (NGM) plates seeded with OP50 bacteria. All experiments were performed in the N2 genetic background of C. elegans and animals were maintained at 20 °C for at least two generations preceding an experiment.

Strains used in this study include:

N2 (wild type)

AV554 (dpy-13(e184sd) unc-5(ox171::Mos1)/ nT1 (qIs51) IV; krIs14 (phsp-16.48::MosTransposase; lin-15B; punc-122::GFP) / nT1 (qIs51) V)

CB791 (unc-5(e791) IV),

DLW14 (unc-5(lib1[ICR assay pmyo-3::GFP(-); unc-119(+); pmyo-2::GFP(Mos1)]) IV; krIs14 (phsp-16.48::MosTransposase; lin-15B; punc-122::GFP) V)

DLW23 (smc-5(ok2421)/mIn1 [dpy-10(e128) mIs14] II; unc-5(lib1[ICR assay pmyo-3::GFP(-); unc-119(+); pmyo-2::GFP(Mos1)]) IV; krIs14 (phsp-16.48::MosTransposase; lin-15B; punc-122::GFP) V)

DLW76 (brc-1(tm1145) brd-1(dw1) III; unc-5(lib1[ICR assay pmyo-3::GFP(-); unc-119(+); pmyo-2::GFP(Mos1)]) IV; krIs14 (phsp-16.48::MosTransposase; lin-15B; punc-122::GFP) V)DLW81 (smc-5(ok2421)/mIn1[dpy-10(e128) mIs14] II; unc-5(e791) IV)

DLW100 (brc-1(tm1145) brd-1(dw1) III; unc-5(e791) IV)DLW131 (smc-5(ok2421)/mIn1[dpy-10(e128) mIs14] II; lig-4(ok716) brc-1(xoe4) III)

DLW134 (smc-5(ok2421)/mIn1[dpy-10(e128) mIs14] II; polq-1(tm2572) brc-1(xoe4) III)

DLW137 (smc-5(ok2421)/mIn1 [mIs14 dpy-10(e128)] II; brc-1(xoe4) III)

DLW157 (brc-1(xoe4) III; unc-5(e791) IV)

DLW175 (smc-5(syb3065 [::AID*::3xFLAG]) II; brc-1(xoe4) III)

DLW182 (smc-5(ok2421)/mIn1[dpy-10(e128) mIs14] II; GFP::brc-1 III)

DLW202 (smc-5(ok2421)/mIn1 [dpy-10(e128) mIs14] II; dpy-13(e184sd) unc-5(ox171::Mos1) IV; krIs14 [phsp-16.48::MosTransposase; lin-15B?; punc-122::GFP] V)

DLW203 (brc-1(xoe4) III; dpy-13(e184sd) unc-5(ox171::Mos1) IV; krIs14 [phsp-16.48::MosTransposase; lin-15B; punc-122::GFP] V)

DLW220 (smc-5(syb3065[::AID*::3xFLAG]) ieSi65 [sun-1p::TIR1::sun-1 3'UTR, Cbr-unc-119(+)] II)

DLW221 (msh-2(ok2410)/tmC20[unc-14(tmIs1219) dpy-5(tm9715)] I)

DLW222 (smc-6(ok3294)/mIn1 [dpy-10(e128) mIs14] II; unc-5(lib1[ICR assay pmyo-3::GFP(-); unc-119(+); pmyo-2::GFP(Mos1)]) IV; krIs14 (phsp-16.48::MosTransposase; lin-15B; punc-122::GFP) V)

DLW223 (smc-6(ok3294)/mIn1[dpy-10(e128) mIs14] II; unc-5(e791) IV)

DLW231 (msh-2(ok2410)/tmC20[unc-14(tmIs1219) dpy-5(tm9715)] I; unc-5(lib1[ICR assay pmyo-3::GFP(-); unc-119(+); pmyo-2::GFP(Mos1)]) IV; krIs14 (phsp-16.48::MosTransposase; lin-15B; punc-122::GFP) V)

DLW232 (msh-2(ok2410)/tmC20[unc-14(tmIs1219) dpy-5(tm9715)] I; unc-5(e791) IV)

DLW243 (smc-5(syb3065[::AID*::3xFLAG]) ieSi65 [sun-1p::TIR1::sun-1 3'UTR, Cbr-unc-119(+)] II; brc-1(xoe4) III; unc-5(lib1[ICR assay pmyo-3::GFP(-); unc-119(+); pmyo-2::GFP(Mos1)]) IV; krIs14 (phsp-16.48::MosTransposase; lin-15B; punc-122::GFP) V)

DLW244 (smc-5(syb3065[::AID*::3xFLAG]) ieSi65 [sun-1p::TIR1::sun-1 3'UTR, Cbr-unc-119(+)] II; brc-1(xoe4) III; unc-5(e791) IV)

DLW247 (smc-5(syb3065[::AID*::3xFLAG]) ieSi65 [sun-1p::TIR1::sun-1 3'UTR, Cbr-unc-119(+)] II; brc-1(xoe4) III)

DW102 (brc-1(tm1145) brd-1(dw1) III)

JEL515 (GFP::brc-1 III)

JEL730 (brc-1(xoe4) III)

PHX3065 (smc-5(syb3065 [::AID*::3xFLAG]) II)

YE57 (smc-5(ok2421)/mIn1 [mIs14 dpy-10(e128)] II)

YE58 (smc-6(ok3294)/mIn1 [mIs14 dpy-10(e128)] II)

Double and triple mutants that carried the smc-5(ok2421) and brc-1(xoe4) alleles incurred mutations within ~6–10 generations of propagation, as indicated by progeny with movement defects, body morphology defects, or the presence of male offspring. To minimize the risk of de novo suppressor or enhancer mutations influencing the phenotypes we observed in these mutants, we froze stocks of these double and triple mutants at –80 °C within three generations of the strains’ construction. All experiments using these strains were carried out on stocks which had been maintained for less than 1–2 months. If a strain began to segregate mutant phenotypes, a new isolate of the freshly generated strain was thawed from frozen stocks.

CRISPR/Cas9 genome editing

CRISPR/Cas9 genome editing was performed by SUNY Biotech to generate the smc-5(syb3065) allele in which the endogenous sequence of smc-5 is modified at its C terminus to code for both an AID* tag (peptide sequence PKDPAKPPAKAQVVGWPPVRSYRKNVMVSCKSSGGPEAAAFVK) and a 3xFLAG tag (peptide sequence DYKDHDGDYKDHDIDYKDDDDK). The coding sequence of smc-5, the AID* tag, and the 3xFLAG tag were respectively connected by flexible GAGS peptide linkers. The repair template for this insertion was synthesized as a single strand oligo and was injected with Cas9 enzyme and a single guide RNA targeting the 12th exon of the smc-5 locus. Successful integration was confirmed by PCR and Sanger sequencing. CRISPR edited strains were backcrossed three times to N2 before experiments were performed.

C. elegans brood viability assays and Bayesian hierarchical modeling analysis

L4 stage hermaphrodite nematodes of each genotype to be scored were isolated 16–18 hr before irradiation was to be performed and were maintained at 15 °C on NGM plates seeded with OP50. These worms were then exposed to 0, 2500, or 5000 Rads of ionizing radiation from a Cs137 source (University of Oregon). Following irradiation, n=5 hermaphrodites of each genotype and treatment combination were placed onto individual NGM plates seeded with OP50 and were maintained at 20 °C. If plates were to be mated, n=3 young adult N2 males were also added to the plate at this timepoint and were discarded at the 10 hr transfer. At 10 hr, 22 hr, and 46 hr post irradiation, the irradiated hermaphrodites were transferred to new NGM plates seeded with OP50. Fifty-eight hours after irradiation, the parent hermaphrodites were discarded. The proportion of F1 progeny that hatched, did not hatch (‘dead eggs’ indicating embryonic lethality), or were unfertilized on each plate was scored 36–48 hr after the removal of the parent hermaphrodite from a plate. The brood size of each hermaphrodite was calculated as (hatched progeny) + (dead eggs). Brood viability at each timepoint was calculated as (hatched progeny) / (brood size). Brood viability experiments were conducted in triplicate for the following genotypes: unmated N2, unmated smc-5, unmated brc-1, unmated smc-5;brc-1, unmated smc-5;brc-1;lig-4, and unmated smc-5;brc-1;polq-1. Brood viability assays were conducted in duplicate for the following genotypes: mated smc-5;brc-1;polq-1, mated polq-1, and unmated polq-1 and unmated smc-5(syb3065). Brood viability was assessed in one replicate for mated smc-5;brc-1 mutants.

Brood viabilities of individual hermaphrodites for each given genotype and irradiation treatment were analyzed using RStan (Stan Development Team, 2021). The brood viability data of individual hermaphrodites (h) for each genotype (g), timepoint scored (t), and irradiation treatment (i) was fit to a Beta-Binomial model. To facilitate model fitting, the Beta distribution was parameterized using the mean (φ) and shape parameter sum (λ).ϕg,t,i=αg,t,i(αg,t,i+βg,t,i)

λg,t,i=αg,t,i+βg,t,i

pg,t,i∼Beta(λg,t,i×ϕg,t,i,λg,t,i×(1−ϕg,t,i))

HatchedProgenyg,t,i,h∼Binomial(n=Broodsizeg,t,i,h,pg,t,i)

A metric (termed “gamma”) for the effect of ionizing radiation on the observed brood viability of each genotype was calculated in the Generated Quantities block during MCMC sampling from the posterior probability distribution of the parameter p, defined as:gammag,t,i=pg,t,ipg,t,0Rads

In addition to the model fit statistics output from Stan, model fit was assessed by posterior simulations. The expected brood viability for 1500 parent hermaphrodites from each genotype, timepoint, and irradiation treatment were simulated (Figure 4—figure supplement 3C). For each simulated parent hermaphrodite, a brood size was simulated from a Poisson distribution with a rate parameter equal to the mean brood size of the corresponding experimental group, values for φ and λ were sampled from the respective posterior probability distributions, and a value for p was simulated from a Beta distribution with of the sampled φ and λ. The number of hatched progeny were simulated ~Binomial (brood size, p).

Intersister/intrachromatid repair assay (ICR Assay)

ICR assays were performed as described in Toraason et al., 2021c; Toraason et al., 2021b. Parent (P0) hermaphrodites for the ICR assay for each genotype were generated by crossing (see cross schemes detailed below).

ICR assay cross schemes:

Wild type (N2): P0 hermaphrodites were generated by crossing: (1) N2 males to DLW14 hermaphrodites to generate unc-5(lib1)/+IV; krIs14/+V males; (2) F1 males to CB791 hermaphrodites to generate unc-5(lib1)/unc-5(e791) IV; krIs14/+V hermaphrodites.

brc-1 mutant: P0 hermaphrodites were generated by crossing: (1) JEL730 males to DLW156 hermaphrodites to generate brc-1(xoe4) III; unc-5(lib1)/+IV; krIs14/+V males; (2) F1 males to DLW157 hermaphrodites to generate brc-1(xoe4) III; unc-5(lib1)/unc-5(e791) IV; krIs14/+V hermaphrodites.

smc-5 mutant: P0 hermaphrodites were generated by crossing: (1) YE57 males to DLW23 hermaphrodites to generate smc-5(ok2421)/mIn1 II; unc-5(lib1)/+IV; krIs14/+V males; (2) F1 males to DLW81 hermaphrodites to generate smc-5(ok2421) II; unc-5(lib1)/unc-5(e791) IV; krIs14/+V hermaphrodites.

brc-1;brd-1 mutant: P0 hermaphrodites were generated by crossing: (1) DW102 males to DLW76 hermaphrodites to generate brc-1(tm1145) brd-1(dw1) III;; unc-5(lib1)/+IV; krIs14/+V males; (2) F1 males to DLW100 hermaphrodites to generate brc-1(tm1145) brd-1(dw1) III; unc-5(lib1)/unc-5(e791) IV; krIs14/+V hermaphrodites.

smc-6 mutant: P0 hermaphrodites were generated by crossing: (1) YE58 males to DLW222 hermaphrodites to generate smc-6(ok3294)/mIn1 II; unc-5(lib1)/+IV; krIs14/+V males; (2) F1 males to DLW223 hermaphrodites to generate smc-6(ok3294) II; unc-5(lib1)/unc-5(e791) IV; krIs14/+V hermaphrodites.

msh-2 mutant: P0 hermaphrodites were generated by crossing: (1) YE57 males to DLW23 hermaphrodites to generate msh-2(ok2410)/tmC20 I; unc-5(lib1)/+IV; krIs14/+V males; (2) F1 males to DLW81 hermaphrodites to generate msh-2(ok2410); unc-5(lib1)/unc-5(e791) IV; krIs14/+V hermaphrodites.

smc-5::AID*::3xFLAG;brc-1 mutant: P0 hermaphrodites were generated by crossing: (1) DLW220 males to DLW243 hermaphrodites to generate smc-5(syb3065) ieSi51 II; brc-1(xoe4) III; unc-5(lib1)/+IV; krIs14/+V males; (2) F1 males to DLW244 hermaphrodites to generate smc-5(syb3065) ieSi51 II; brc-1(xoe4) III; unc-5(lib1)/unc-5(e791) IV; krIs14/+V hermaphrodites.

In brief, P0 hermaphrodites of the desired genotype were isolated 16–18 hr before heat shock and were maintained at 15°C. For this step and all subsequent transfers, worms were maintained on NGM plates seeded with OP50 with the exception of smc-5(syb3065);brc-1(xoe4) mutants, which were transferred to NGM plates with 10 mM auxin 16–18 hr before heat shock and were maintained on plates containing 10 mM auxin at all subsequent steps. Heat shock was performed in an air incubator (refrigerated Peltier incubator, VWR Model VR16P) for one hour. The P0 worms were then allowed to recover at 20°C for nine hours. For wildtype, brc-1(xoe4), and smc-5(ok2421) ICR assays, P0 hermaphrodites were placed onto individual plates and were maintained at 20°C and were transferred to new plates at 22 hr, 34 hr, and 46 hr after heat shock. Fifty-eight hours after heat shock, these P0 hermaphrodites were removed from their NGM plates and discarded. smc-6(ok3294), brc-1(tm1145);brd-1(dw1), and msh-2(ok2410) assays were performed identically, except that n=3 P0 hermaphrodites were placed onto individual plates and P0 hermaphrodites were transferred to new plates 22 hr after heat shock and were discarded 46 hr after heat shock. For smc-5(syb3065);brc-1(xoe4) assays, n=3 P0 hermaphrodites were placed onto individual plates and were transferred 22 hr, 34 hr, and 46 hr after heat shock and then were discarded 58 hr after heat shock. In all assays, plates with P0 hermaphrodites were maintained at 20°C, while plates with F1 progeny were placed at 15 °C.

F1 progeny were scored for GFP fluorescence ~54–70 hr after the P0 hermaphrodite was removed. Approximately 18 hr before scoring, plates with F1 progeny were placed at 25°C to enhance GFP expression. Fluorescent phenotype scoring was performed on a Axio Zoom v16 fluorescence stereoscope (Zeiss). F1 progeny which expressed recombinant fluorescence phenotypes were isolated and lysed for sequencing (see Sequencing and analysis of ICR assay conversion tracts). Nonrecombinant progeny were discarded. If all progeny on a plate were in larval developmental stages at the time of scoring, then the number of dead eggs and unfertilized oocytes were additionally recorded.

Due to the strict temporal timeline of the ICR assay (Toraason et al., 2021b; Toraason et al., 2021c, see above), these experiments were not performed in parallel. All displayed frequencies represent the combined sums of multiple replicates. ICR assays in brc-1(xoe4), smc-5(ok2421), and smc-5(syb3065);brc-1 mutants were replicated 4 times, brc-1(tm1145);brd-1(dw1) and smc-6(ok3294) mutants were replicated 3 times, and msh-2(ok2410) mutants were replicated twice. In all assays, the broods of at least 20 parent hermaphrodites were scored in each replicate. The ICR assay in a wild type genetic background was performed once and combined with previous data (Toraason et al., 2021c). For detailed information on the number of progeny scored in individual replicates, see Figure 1—source data 1, Figure 2—source data 1, and Figure 4—source data 1.

Sequencing and analysis of ICR assay conversion tracts

Recombinant ICR assay progeny were placed in 10 μL of 1 x Worm Lysis Buffer for lysis (50 mM KCl, 100 mM TricHCl pH 8.2, 2.5 mM MgCl2, 0.45% IGEPAL, 0.45% Tween20, 0.3 μg/μL proteinase K in ddH2O) and were iteratively frozen and thawed three times in a dry ice and 95% EtOH bath and a 65 °C water bath. Samples were then incubated at 60°C for 1 hr and 95°C for 15 min to inactive the proteinase K. Final lysates were diluted with 10 μL ddH2O.

Conversion tracts were PCR amplified using OneTaq 2 x Master Mix (New England Biolabs). Noncrossover recombination products were amplified using forward primer DLO822 (5’-ATTTTAACCCTTCGGGGTACG-3’) and reverse primer DLO823 (5’-TCCATGCCATGTGTTAATCCCA-3’). Crossover recombination products were amplified using forward primer DLO824 (5’-AGATCCATCTAGAAATGCCGGT-3’) and reverse primer DLO546 (5’-AGTTGGTAATGGTAGCGACC-3’). PCR products were run on an Agarose gel and desired bands were isolated by gel extraction (QIAquick Gel Extraction Kit, New England Biolabs) and were eluted in ddH2O. Amplicons were submitted for Sanger sequencing (Sequetech) with three primers. Noncrossovers were sequenced using DLO822, DLO823, and DLO1077 (5’-CACGGAACAGGTAGGTTTTCCA-3’) and crossovers were sequenced using DLO824, DLO546, and DLO1077.

Sanger sequencing chromatograms were analyzed using Benchling alignment software (Benchling) to determine converted polymorphisms. Heteroduplex DNA signals were identified by two prominent peaks in the chromatogram at the site of a known polymorphism. Putative heteroduplex samples were PCR amplified and submitted for sequencing a second time for confirmation as described above.

Samples that produced PCR products of the expected size but did not yield interpretable sequencing were subsequently analyzed using TOPO cloned amplicons. ICR assay locus amplicons were PCR amplified as described above but were immediately cloned into pCR2.1 vector using the Original TOPO-TA Cloning Kit (Invitrogen) following kit instructions. Putative successful amplicon clones were identified by PCR amplification using 2xOneTaq Master Mix (New England Biolabs) with primers DLO883 (5’-CAGGAAACAGCTATGACCATG-3’) and DLO884 (5’-TGTTAAAACGACGGCCAGGT-3’). Plasmids containing amplicon inserts were isolated from 2 mL LB + Amp cultures using the GENEJET Miniprep kit (Thermo Fischer Scientific) and were submitted for Sanger sequencing (Sequetech) using primers DLO883 and DLO884.

To acquire additional wild type ICR assay crossover tracts for our analyses, three ‘bulk’ replicates of the wild type ICR assay were performed following the protocol described in the ‘Intersister/intrachromatid repair assay’ with the following exceptions: (1) n=3 hermaphrodites were passaged together on individual plates during the experiment; (2) transfers were only performed at 10 hr, 22 hr, and 46 hr following heat shock; and, (3) plates were screened for body wall GFP+ crossover recombinants but the frequency of pharynx GFP+ and GFP- nonrecombinant progeny were not scored. Body wall GFP+ crossover progeny were lysed following the preceding protocol.

Not all lysed recombinant yielded successful PCR products or sequences. Of the additional wild type ICR assay recombinants sequenced for this manuscript, 11 of 11 noncrossover and 52 of 52 crossover lysates were successfully sequenced. Among lysates from brc-1 mutant ICR assays, 37 of 37 noncrossover and 70 of 73 crossover lysates were successfully sequenced. Among lysates from smc-5 mutant ICR assays, 56 of 56 noncrossover and 27 of 28 crossover lysates were successfully sequenced.

Interhomolog assay (IH assay)

IH assays were performed as described in Rosu et al., 2011. In brief, P0 hermaphrodites were generated by crossing (see cross schemes detailed below). The IH assay was performed twice for each genotype.

IH assay cross schemes:

Wild type (N2): P0 hermaphrodites were generated by crossing: (1) N2 males to AV554 hermaphrodites to generate dpy-13(e184sd) unc-5(ox171::Mos1)/+IV; krIs14/+V males; (2) F1 males to CB791 hermaphrodites to generate dpy-13(e184sd) unc-5(ox171::Mos1)/unc-5(e791) IV; krIs14/+V hermaphrodites.

brc-1 mutant: P0 hermaphrodites were generated by crossing: (1) JEL730 males to DLW203 hermaphrodites to generate brc-1(xoe4) III; dpy-13(e184sd) unc-5(ox171::Mos1)/+IV; krIs14/+V males; (2) F1 males to DLW157 hermaphrodites to generate brc-1(xoe4) III; dpy-13(e184sd) unc-5(ox171::Mos1)/unc-5(e791) IV; krIs14/+V hermaphrodites.

smc-5 mutant: P0 hermaphrodites were generated by crossing: (1) YE57 males to DLW202 hermaphrodites to generate smc-5(ok2421)/mIn1 II; dpy-13(e184sd) unc-5(ox171::Mos1)/+IV; krIs14/+V males; (2) F1 males to DLW81 hermaphrodites to generate smc-5(ok2421) II; dpy-13(e184sd) unc-5(ox171::Mos1)/unc-5(e791) IV; krIs14/+V hermaphrodites.

The heat shock and timing at which parent hermaphrodites were transferred to new NGM plates was performed identically to the ICR assay (see ‘Intersister/Intrachromatid repair assay (ICR assay)’ above). However, the number of eggs and unfertilized oocytes laid by each hermaphrodite was recorded immediately following the removal of the parent hermaphrodite at each timepoint and plates carrying F1 progeny were maintained at 20 °C. Plates were scored for F1 wild type moving (non-Unc) progeny ~84–96 hr after parent hermaphrodites were removed. F1 Unc progeny were discarded.

F1 non-Unc progeny were placed on single NGM plates seeded with OP50 bacteria. Dpy non-Unc progeny (putative noncrossover recombinants) were lysed following the protocol described in ‘Sequencing and analysis of SCR assay conversion tracts’. If Dpy non-Unc progeny died before the time of lysis and had laid F2 progeny, non-Unc segregant F2s were lysed instead. Non-Dpy non-Unc progeny (potential crossover recombinants) were allowed to lay F2 progeny. If progeny were laid and Dpy non-Unc F2 segregants were identified, these Dpy non-Unc F2s were lysed and the F1 was inferred not to be a crossover recombinant. If >50 F2 progeny were on the plate and no Dpy non-Unc segregants were identified, the F1 was assumed to be a crossover recombinant and no worms were lysed. If very few progeny were laid and no Dpy non-Unc segregants were identified, the F1 non-Unc or its non-Unc F2 offspring were lysed and subsequently subjected to PCR genotyping analysis using OneTaq 2 x Master Mix (New England Biolabs) to determine the genotype of unc-5 and dpy-13. The presence of Mos1 in the unc-5 locus was assessed using primers DLO987 (5’-TCTTCTTGCCAAAGCGATTC-3’) and DLO1082 (5’-TTCTCTCCGAGCAATGTTCC-3’). The dpy-13 locus was assessed using primers DLO151 (5’-ATTCCGGATGCGAGGGAT-3’) and DLO152 (5’-TCTCCTCGCAAGGCTTCTGT-3’). Lysed F1 nUnc nDpy progeny were inferred to be crossover recombinants if the worms (1) carried the Mos1 transposon at the unc-5 locus and were heterozygous for the dpy-13(e184) allele, or; (2) did not carry the Mos1 transposon at the unc-5 locus and were homozygous wild type for dpy-13.

The unc-5 locus was amplified for sequencing by PCR using OneTaq 2 x Master Mix (NEB) with primers DLO1081 (5’-TCTTTTCAGGCTTTGGCACTG-3’) and DLO1082. PCR products were run on an agarose gel and desired bands were isolated by gel extraction (QIAquick Gel Extraction Kit, New England Biolabs) and were eluted in ddH2O. These amplicons were submitted for Sanger sequencing (Sequetech) with primer DLO1082 or DLO150 (5’-GTTCCATGTTTGATGCTCCAAAAG-3’). Sanger sequencing chromatograms were compared to the wild type unc-5 sequence using Benchling alignment software. Samples that showed a reversion to wild-type unc-5 sequence at the site of Mos1 excision were inferred to be noncrossover recombinants. Samples that showed mutations that preserved the reading frame of the unc-5 locus were considered ‘mutant non-Unc’. One of the five brc-1 IH assay mutant non-Uncs we sequenced carried two distinguishable mutagenic repair products. These two mutations likely represent the outcomes of both a meiotic DSB repair event and an additional somatic repair event in the progeny. We have previously observed analogous somatic Mos1 excision events in F1 progeny in the ICR assay (Toraason et al., 2021c; Toraason et al., 2021b). As we cannot distinguish the source of the respective repair events, this mutant was excluded from subsequent sequence analysis.

Samples which showed mixed sequences despite a clear amplicon being generated in the PCR were subsequently TOPO cloned, as described in ‘Sequencing and analysis of ICR assay conversion tracts’, except that the amplicon used in the reaction was generated using primers DLO1081 and DLO1082.

Not all interhomolog assay non-Unc progeny were able to be confirmed as recombinants by sequencing. Of the wild type IH assay non-Unc progeny identified, 176 of 178 putative noncrossovers were successfully sequenced. Among lysates from brc-1 mutant IH assays, 72 of 76 putative noncrossovers were successfully sequenced. Among lysates from smc-5 mutant IH assays, 213 of 229 putative noncrossovers were successfully sequenced. Non-Unc progeny whose unc-5 DNA repair events could not be identified by sequencing were considered ‘undetermined non-Unc’ in subsequent analyses of this data.

EdU sister chromatid exchange assay

EdU Sister Chromatid Exchange assays were performed as described in Almanzar et al., 2021; Almanzar et al., 2022. For the smc-5 null mutants, uninterpretable bivalents were excluded due to stochasticity in EdU incorporation, progression of nuclei in the gonad, and orientation of the bivalent in the xy-axis of the microscope.

Immunofluorescence localization of SMC-5/6 and BRC-1

Immunofluorescence was performed as in Libuda et al., 2013 or Howe et al., 2001. For both protocols, L4 staged hermaphrodites were isolated 18–22 hours before dissection and maintained at 20 °C on NGM plates seeded with OP50. Nematodes that were irradiated preceding an immunofluorescence experiment were exposed to a Cs137 source (University of Oregon) and were dissected less than an hour after irradiation. Samples prepared for GFP::BRC-1 or RAD-51 visualization were dissected in 1 x Egg Buffer (118mMNaCl, 48mM KCl2, 2mM CaCl2, 2mM MgCl2, 25mM HEPES pH7.4, 0.1% Tween20) and were fixed in 1 x Egg Buffer with 1% paraformaldehyde for 5 min on a Superfrost Plus slide (VWR). Samples prepared for SMC-5::AID*::3xFLAG visualization were dissected in 1 x Sperm Salts (50mM PIPES pH7, 25mM KCl, 1mM MgSO4, 45mM NaCl, 2mM CaCl2) and an equal volume of 1 x Sperm Salts with 3% paraformaldehyde was applied for 5 min before samples were affixed to a Superfrost Plus slide (VWR). For both protocols, gonads were then flash frozen in liquid nitrogen and the cover slip was removed. Germlines stained for GFP::BRC-1 or RAD-51 were then fixed for 1 min in ice cold MeOH and then were washed in 1 x PBST (1 x PBS, 0.1% Tween20), while germlines stained for SMC-5::AID*::3xFLAG were fixed for 1 min in ice cold 95% EtOH and then were washed in 1xPBST* (1 x PBS, 0.5% Triton-X100, 1 mM EDTA pH8). Slides were then washed 3 x in PBST or PBST* respectively before being placed in Block (1xPBST or 1xPBST* with 0.7% bovine serum albumin) for at least 1 hr.

Primary antibody staining was performed by placing 50 μL of antibody diluted in PBST for samples in which GFP::BRC-1 or RAD-51 were to be visualized or PBST* if the sample was to be stained for SMC-5::AID*::3xFLAG (see below for specific dilutions of primary antibodies). A parafilm coverslip was placed on each sample and the slides were incubated for 16–18 hr in a dark humidifying chamber. Slides were then washed 3 x in PBST or PBST* for 10 min. Fifty μL of secondary antibody diluted in PBST for samples in which GFP::BRC-1 or RAD-51 were to be visualized or PBST* if the sample was to be stained for SMC-5::AID*::3xFLAG (see below for specific dilutions of primary antibodies) was then placed on each slide. Slides were incubated for 2 hr in a dark humidifying chamber with a parafilm coverslip. Slides were then washed 3 x in PBST or PBST* for 10 min in a dark chamber. 50μL of 2μg/mL DAPI was then applied to each slide. Slides were incubated in a dark humidifying chamber with parafilm coverslips for 5 min. Slides were then washed 1 x in PBST or PBST* for 5 min in a dark chamber before being mounted in VectaShield with a No. 1.5 coverslip (VWR) and sealed with nail polish.

Slides were maintained at 4°C until imaging. All slides stained for SMC-5::AID*::3xFLAG were imaged within 48 hr of mounting. Immunofluorescence images were acquired at 512x512 pixel dimensions on an Applied Precision DeltaVision microscope. All images were acquired in 3D using Z-stacks at 0.2μm intervals and were deconvolved with Applied Precision softWoRx deconvolution software. Individual images of whole germlines were stitched as 3D Z-stacks in FIJI using the Grid/Collection Stitching plugin (Preibisch et al., 2009) or as maximum intensity projections using Photoshop (Adobe). The intensity levels of images displayed in this manuscript were adjusted in Photoshop for clarity.

The following primary antibodies were used in this study at the given dilutions: Chicken αRAD-51 (1:1000; Kurhanewicz et al., 2020), Rabbit αRAD-51 (1:5000, Kurhanewicz et al., 2020), Mouse αmini-AID M214-3 (1:500, MBL International), Rat αHTP-3 (1:1000, this study), Rabbit αGFP (1:500 Yokoo et al., 2012). The following secondary antibodies were used in this study at the given dilutions: Alexa Fluor 488 Goat αRabbit (1:200, Invitrogen A21428), Alexa Fluor 488 Goat αMouse (1:200, Invitrogen A11001), Alexa Fluor 555 Goat αRat (1:200, Invitrogen A48263) Alexa Fluor 647 Goat αChicken (1:200, Invitrogen A21449).

Immunofluorescence staining of SMC-5/6 was further attempted using previously published antibodies (Bickel et al., 2010). We were unable to generate samples with specific staining using these antibodies, potentially due to their age. We additionally attempted to raise new antibodies using the previously published epitopes (Bickel et al., 2010) (synthesized by GenScript) in chickens (SMC-5) or rabbits (SMC-6). Neither of these antibodies exhibited specific staining.

RAD-51 foci quantification

RAD- 51 foci per nucleus were quantified using Imaris (Bitplane) as described in detail in Toraason et al., 2021a. RAD-51 foci were defined as Spot objects (estimated XY diameter 0.1, model PSF-elongation 1.37, background subtraction enabled) and nuclei were defined using the DAPI channel as Surface objects (smooth 0.1–0.15, background 3–4, seed point diameter 2.5–4). Manual thresholding was performed to best represent the foci and nuclei in each image. The number of RAD-51 foci per nucleus was calculated using the ‘losest Distance to Surface’ statistic to find the total number of Spots within 0.4μm of a given nucleus. The length of each germline was delineated using the Measurement Points tool, and specific points were placed at the beginning of the transition zone, end of the transition zone, and end of pachytene. Nuclei positions were transformed from 3D coordinates to a liner order as previously described (Toraason et al., 2021a). The length of each germline was normalized to pachytene such that the beginning of pachytene was position 0 and the end of pachytene was position 1.

Antibody generation

The HTP-3 antibody used in this study was generated from an identical C-terminal segment of the HTP-3 protein (synthesized by GenScript) as was used by MacQueen et al., 2005. Antibodies were produced in rats and affinity purified by Pocono Rabbit Farms.

Statistics

All statistics were calculated in R (v4.0.3). Specific tests utilized are described in text or in the figure legends. Data wrangling was performed using the Tidyverse (v1.3.0) package (Wickham et al., 2019). Bayesian hierarchical models were fit using Rstan (v2.21.2) (Stan Development Team, 2021). Binomial Confidence Intervals were calculated using the DescTools package (v 0.99.38).

Funding Information

This paper was supported by the following grants:

http://dx.doi.org/10.13039/100000057 National Institute of General Medical Sciences R35GM128890 to Diana E Libuda.

http://dx.doi.org/10.13039/100009633 Eunice Kennedy Shriver National Institute of Child Health and Human Development R00HD076165 to Diana E Libuda.

http://dx.doi.org/10.13039/100000057 National Institute of General Medical Sciences T32GM007413 to Erik Toraason.

http://dx.doi.org/10.13039/100009633 Eunice Kennedy Shriver National Institute of Child Health and Human Development R25HD070817 to Alina Salagean.

http://dx.doi.org/10.13039/100000057 National Institute of General Medical Sciences T32GM007464 to David E Almanzar.

http://dx.doi.org/10.13039/100000057 National Institute of General Medical Sciences R35GM128804 to Ofer Rog.

Advancing Science in America Foundation Award to Erik Toraason.

http://dx.doi.org/10.13039/100000048 American Cancer Society Pilot Project Award to Ofer Rog.

http://dx.doi.org/10.13039/100007747 University of Utah start-up funds to Ofer Rog.

Acknowledgements

We thank the CGC (funded by National Institutes of Health P40 OD010440) for providing strains. We also thank J Engebrecht for generously sharing strains carrying the brc-1(xoe4) and GFP::brc-1 alleles. We thank C Cahoon, A Naftaly, and N Kurhanewicz for thoughtful comments on this manuscript. We also thank G Csankovszki for sharing antibodies for SMC-5 and SMC-6. This work was supported by the National Institutes of Health T32GM007413 to ET and JEB; Advancing Science in America (ARCS) Foundation Award to ET; National Institutes of Health R25HD070817 to AS; Genetics Training Grant T32M007464 to DEA; a Pilot Project Award from the American Cancer Society, R35GM128804 grant from NIGMS, and start-up funds from the University of Utah to OR; and National Institutes of Health R00HD076165 and R35GM128890 to DEL. DEL is also a recipient of a March of Dimes Basil O’Connor Starter Scholar award and Searle Scholar Award.

Additional information

Competing interests

Author contributions

Additional files

MDAR checklist

Data availability

All data generated or analyzed in this study are included in the manuscript and supporting files. Source data files have been provided for Figures 1A, 1C, 1D, 1E, 2A, 2B, 2C, 2D, 3, 4, Figure 1 - figure supplements 2-3, Figure 2 - figure supplements 1-2, and Figure 4 - figure supplements 1-3. Source code files have been provided for Figure 4 - figure supplement 3.

Appendix 1

Appendix 1—key resources table Reagent type (species) or resource	Designation	Source or reference	Identifiers	Additional information	
Gene (C. elegans)	brc-1	https://wormbase.org/species/c_elegans/gene/WBGene00000264	WormBase ID: WBGene00000264		
Gene (C. elegans)	brd-1	https://wormbase.org/species/c_elegans/gene/WBGene00000265	WormBase ID: WBGene00000265		
Gene (C. elegans)	smc-5	https://wormbase.org/species/c_elegans/gene/WBGene00016151	WormBase ID: WBGene00016151		
Gene (C. elegans)	smc-6	https://wormbase.org/species/c_elegans/gene/WBGene00010056	WormBase ID: WBGene00010056		
Gene (C. elegans)	polq-1	https://wormbase.org/species/c_elegans/gene/WBGene00020964	WormBase ID: WBGene00020964		
Gene (C. elegans)	lig-4	https://wormbase.org/species/c_elegans/gene/WBGene00002986	WormBase ID: WBGene00002986		
Gene (C. elegans)	unc-5	https://wormbase.org/species/c_elegans/gene/WBGene00006745	WormBase ID: WBGene00006745		
Gene (C. elegans)	rad-51	https://wormbase.org/species/c_elegans/gene/WBGene00004297	WormBase ID: WBGene00004297		
Strain, strain background (C. elegans)	For C. elegans alleles and strain information, see strain list in Methods (C. elegans strains and maintenance)	This paper		See strain list in Methods (C. elegans strains and maintenance)	
Genetic reagent (C. elegans)	Details on C. elegans CRISPR/Cas9 editing are detailed in the Methods (CRISPR/Cas9 genome editing)	This paper		CRISPR/Cas9 transgenics were generated by InVivo Biosystems	
Antibody	Anti-RAD-51 (chicken polyclonal)	Kurhanewicz et al., 2020		IF (1:1000)	
Antibody	Anti-RAD-51 (rabbit polyclonal)	Yokoo et al., 2012		IF (1:5000)	
Antibody	Anti-mini-AID M214-3 (mouse monoclonal)	MBL International		IF (1:500)	
Antibody	Anti-HTP-3 (rat polyclonal)	This study		IF (1:1000)	
Antibody	Anti-GFP (rabbit polyclonal)	Yokoo et al., 2012		IF (1:500)	
Antibody	Alexa Fluor 488 anti-rabbit (goat polyclonal)	Thermo Fisher	Cat# A21428	IF (1:200)	
Antibody	Alexa Fluor 488 anti-mouse (goat polyclonal)	Thermo Fisher	Cat# A11001	IF (1:200)	
Antibody	Alexa Fluor 555 anti-rat (goat polyclonal)	Thermo Fisher	Cat# A48263	IF (1:200)	
Antibody	Alexa Fluor 647 anti-chicken (goat polyclonal)	Thermo Fisher	Cat# A21449	IF (1:200)	
Sequence-based reagent	PCR primers for amplifying ICR and IH assay recombinants are described in Methods (Sequencing and analysis of ICR assay conversion tracts, Interhomolog assay (IH assay))	Toraason et al., 2021c, This Paper	PCR Primers	See Methods (Sequencing and analysis of ICR assay conversion tracts, Interhomolog assay (IH assay))	
Chemical compound, drug	Naphthaleneacetic acid (auxin)	PhytoTechnology Laboratories	Cat# N610	10 mM	
Software, algorithm	Whole Gonad Analysis (R script) v1.0	Toraason et al., 2021a; Toraason et al., 2021d	https://github.com/libudalab/Gonad-Analysis-Pipeline		
Software, algorithm	RStan	Stan Development Team	https://mc-stan.org/		
Software, algorithm	Imaris 9	Oxford Instruments	https://imaris.oxinst.com/products		
Software, algorithm	FIJI	Schindelin et al., 2012	https://imagej.net/software/fiji/		
Software, algorithm	FIJI plug in – Stitcher	Preibisch et al., 2009	https://imagej.net/plugins/image-stitching		

10.7554/eLife.80687.sa0
Editor's evaluation
de Massy Bernard Reviewing Editor https://ror.org/02feahw73 CNRS UM France

This study provides an important insight in the regulation of DSB repair during meiosis in C. elegans. The analysis is based on genetic, genomic and cytological approaches allowing to monitoring distinct DNA repair pathways and providing compelling evidence for their regulation and genetic controls.

10.7554/eLife.80687.sa1
Decision letter
de Massy Bernard Reviewing Editor https://ror.org/02feahw73 CNRS UM France

de Massy Bernard Reviewer https://ror.org/02feahw73 CNRS UM France

Gartner Anton Reviewer https://ror.org/017cjz748 IBS for Genomic Integrity. UNIST Republic of Korea

Our editorial process produces two outputs: i) public reviews designed to be posted alongside the preprint for the benefit of readers; ii) feedback on the manuscript for the authors, including requests for revisions, shown below. We also include an acceptance summary that explains what the editors found interesting or important about the work.

Decision letter after peer review:

Thank you for submitting your article "BRCA1/BRC-1 and SMC-5/6 regulate DNA repair pathway engagement during C. elegans meiosis" for consideration by eLife. Your article has been reviewed by 3 peer reviewers, including Bernard de Massy as the Reviewing Editor and Reviewer #1, and the evaluation has been overseen by Jessica Tyler as the Senior Editor. The following individual involved in the review of your submission has agreed to reveal their identity: Anton Gartner (Reviewer #2).

The reviewers have discussed their reviews with one another, and the Reviewing Editor has drafted this synthetic review with "Essential revisions" and "Other revisions" to help you prepare a revised submission.

Essential revisions:

1) Understanding the assays is important for the readers. Even though the information is available in previous publications, a supplementary figure describing the assays (ICR and IH) and recombination products and their detection is suggested.

2) As noted by the authors, the inter-sister CO increase was not expected and seems to contradict the previous publications by Adamo et al. and Bickel et al. Have the authors thought about testing intersister recombination with another allele of their mutants to exclude effects due to unknown mutations? This issue needs to be addressed and discussed.

3) L303-304: The interpretation of the increased GFP progeny is a major issue and cannot be redirected to a few sentences in the methods section as this is the major topic of this study. The methods section outlines several alternatives, whereas the main text seems to prioritize some. This seems arbitrary and should be clarified with experimental data (for instance testing the SNP hypothesis).

4) The authors cannot conclude that both assays (L 323 support a function for SMC-5 in repressing intersister crossover in C. elegans meiosis: Data from Edu is supported by only 6 bivalents coming from 2 oocytes. In addition, could the authors demonstrate that those exchanges are taking place during meiosis? (as performed for him-6, this may require to analyze a smc-5 spo-11 mutant).

5) L361: the potential delay should be shown. Assigning the two time-windows as inter homolog and non interhomolog is at the basis of the experimental approach and whether it is altered in the mutants or not must be known and taken into account for interpretations.

6) Analysis of ICR and IH in brc-1 smc-5 double mutant. The authors could use balancers for both loci to maintain the strain, and minimize accumulation of genomic instability (from the strain list, a balancer was used for smc-5 but not for brc-1). Alternatively, the Smc-5 degron allele could be used.

7) Irradiation experiments: Please provide cytological data of DSB repair detection (ie RPA or Rad-51) in the different mutant contexts and information about the number of DSBs induced at the different doses of IR (14 DSB per homolog pair for 5000 rads as from Almanzar et al?). Also provide information about the γ sensitivity of germ cells of wt, single and double mutants.

The readout of the irradiation experiments is brood viability. One major problem with the interpretation is that sperm is also irradiated and can contribute to the phenotype. To avoid this issue, the authors should irradiate hermaphrodites and mate with non-irradiated males. This could be tested at least for one genotype (ie brc-1 smc-5) to evaluate the potential impact of sperm irradiation.

8) The main figure (figure 4) should present brood viability, and the fit to the model as supplementary figure, as qualitatively the effects can be visualized by examining the brood viability: i) greater sensitivity of smc-5 compared to brc-1 (the claim for a greater sensitivity in the non-interhomolog window is not convincing as the differences of the γ parameter are quite small, may be excepted for the brc-1 mutant at 5000 rads; in addition, no statistical test is validating the differences),ii) dispensability of BRC-1 at early prophase in low IR, iii) suppression of smc-5 sensitivity by brc-1 in the interhomolog window, iv) sensitization by polq-1.

9) Discussion:

The discussion is mostly reiterating the data from the results and should be more focused on the conclusions that can be drawn, novel points or questions to be addressed, and relating to current knowledge on Brc-1 and Smc-5 in other species.

The question of chromosome fragmentation in Smc-5 and discussion about the data from this manuscript (L 674…) is unclear. How could the mutations detected in smc-5 (Volkova et al.) explain the efficient recovery of HR events by the ICR and IH assays? As indicated above (point 2), the authors should discuss the previous study concluding that Brc-1 is required for intersister recombination (Adamo et al., 2008).

After citing this work in the introduction, the authors ignore this opposite conclusion from the discussion. May be the chromatid fragments in brc-1 msh-4 are products of TMEJ ? Similarly, Bickel et al. 2010, proposed that Smc-5 is required for homolog-independent (presumably intersister) events. The authors must solve this apparent contradiction.

The question of potential differences between Spo11 and Mos1 induced breaks should be discussed and thus with alternative interpretations.

10) The model presented in Figure 5, with the molecular intermediates is only indirectly supported by the data which does not allow determining which steps of the reaction are affected besides for the resection phenotype from the gene conversion tract analysis. The model would be better suited to be presented as a supplementary figure.

11) Box plots: Plot data points instead of box plots: Figure 1A, 1c, supfig2b, 2d, Figure 2B, 2d, Figure 3C, d

Other revisions:

12) Abstract: L21: SMC-5 was not shown to limit error prone repair.

13) The authors should introduce more widely the current knowledge about Brca1 and Smc5/6 with information from other species. Their results should also be integrated into a larger context.

14) It is unclear whether each mutant was analyzed in parallel with a wild-type control. In principle to control for experimental variations (temperature…) this should be done. As presented in figures, one has the impression that wild-type and mutants were done in parallel. Please explain clearly the experimental procedures in the methods, and provide relevant information in the legends.

15) In several figures (ie Figure 1C and others), sample sizes and duplicates are not clearly indicated: how many animals, how many oocytes. It would be easier to have N values on the figures. It is mentioned in the methods that ICR assays were repeated 4 times with at least 20 parents each (what about the IH assays ?), but the source data shows only the total pool of progeny tested. What is the inter-parent and inter-replicate variation?

16) For counting bivalents, some with visually interpretable bivalents were counted. Likely some bivalents either DAPI or Edu staining was difficult to interpret. How to exclude a selection bias in this analysis?

17) Fig1D: some numbers do not match the table: 1/41 instead of 1/43…, same for 1E.

And the mutant non-unc is 17.2% in the figure but 13.2% in the text.

18) Figure 3 A and C: The number of noncrossover conversion tracts in the non-IH window for smc-5 and brc-1 seems to be too low (with one long event in brc-1) to be statistically valid, even though a p value was calculated by the Fisher's exact test. The authors should dampen their conclusion that Brc-1 only affects tract length in the IH window or alternatively increase sample size.

19)

L 39: SPo11 references: Keeney et al. 1997; Bergerat et al. 1997.

L 44: The use of "resolve" for DSB is odd (also L 55, 74).

L 51: "In SDSA, one resected end" might be better than "the resected end".

L 74: Utilize homologous recombination.

L 104-5: vague; not additive could mean synergistic or unchanged.

L 121 (and L514-515). For clarity, it would be good to use 'more genetic language. Eg 'the hypersensitivity of smc-5 mutations towards IR is suppressed/bypassed by brc-1 (mutation). L514: Could the term resilience be avoided, replaced by Eg:.…strains or more sensitive to IR than WT,.. are hypersensitive to IR,.. the IR sensitivity of smc-5 mutants is suppressed by brc-1….

L 176-177: seem out of place, please revise.

L179: "Does not necessarily represent recombinant progeny". The meaning is unclear. Please clarify.

Line 198 and elsewhere: "is not required for" could be understood to mean "is not involved in." The intended meaning is "is not essential for."

L 210. More frequently is vague please provide quantitative information.

L 246: "a slight delay in the rate of meiotic progression" the rate is not delayed.

L 261: "at the time of Mos1 excision" perhaps should say "at the time of heat shock" since there is likely some delay between heat shock and transposase expression and transposon excision.

L 269 suppl figure 3B. It would be better to precisely refer to the events shown in the text. Eg label (1-4) and refer to (3B.1) 3B.2 etc etc.

L 283: 5 not 4 mutants have been identified (Figure 1E), but only 4 are reported?

Line 299: "SMC-5/6 is therefore not required for viability in C. elegans…" this conclusion does not follow from the data presented in the preceding sentences.

L 318: intersister in smc-5. "Among a limited sample", please clarify, does it refer to 6 individuals?

Supplemental Figure 3B: using a monospaced font in the DNA sequences would ensure that the nucleotides in each strand were properly aligned.

Figure 2C-D: it would be helpful to see an image of an "uninterpretable" bivalent in the SCE assay and to know what percentage of bivalents were discarded as uninterpretable in wt, brc-1, and smc-5 animals.

Line 380: could be more specific. "in restricting/limiting intersister CO recombination".

L 389: Figure 3A not 4A.

L 428: This conclusion is confusing. Brca-1 mutant were shown above to have more CO (intersister). How can one conclude that it does not regulate CO recombination?

L 448: Where is the heteroduplex DNA information? Please provide this data.

Figure 3C and D (graphs): font is too small.

Figure 4, supplemental figure 4: it would be interesting to see controls with for example polq-1 single mutants and polq-1 double mutants with brc-1 and smc-5. These controls might shed some light on what is going on and get closer to mechanism.

Sup Figure 4: What is the sample size ? Wild type: no point is visible; brc-1, only 1 point is visible at 0 rad ? Please clarify. In panel B, the simulation is probably the distribution shown in black, please clarify.

In some cases (smc-5 2500 rad) the simulation does not fit the data. This is problematic because the validity of the γ parameter is therefore uncertain. The source data do not show the individual data points (ie brood viability of individual hermaphrodites), please revise.

Supplemental Figure 7 is never referred to in the manuscript.

What is smc-5 (phx3065) ? PHX3065 seems to be a strain name.

L 642: "influences noncrossover intermediate processing" is vague.

Are the most important strains for measuring inter-sister and interhomolog recombination deposited in the GCG strain collection?

Reviewer #1 (Recommendations for the authors):

Figure 1: The number of biological duplicates is unclear and single-point data cannot be found in the tables. It is said that assays were replicated 4 times and at least 20 parents each, but sup table 1 only show the total progeny. What is the inter-parent and inter-replicate variation?

Fig1D: some numbers do not match the table: 1/41 instead of 1/43.…, same for 1E

And the mutant non-unc is 17.2% in the figure but 13.2% in the text ?

L171: "Does not necessarily represent recombinant progeny". The meaning is unclear. Please clarify.

L 222. More frequently is vague please provide quantitative information.

L 252: 5 not 4 mutants have been identified, but only 4 are reported?

Interhomolog assay: the progeny is referred to as non-unc or unc-5 (+). This is confusing , please use one of the two. It seems that referring to unc-5 (+) is better even if this can include some mutational events.

L228 and sup2A: increase of interhomolog !!

L287: The interpretation of the increased GFP progeny is a major issue and cannot be redirected to a few sentences in the methods section as this is the major topic of this study. The methods section outlines several alternatives, whereas the main text seems to prioritize some. This seems arbitrary and should be clarified with experimental data (for instance testing the SNP hypothesis).

L324: intersister in smc-5. "Among a limited sample", please clarify, does it refer to 6 individuals?

L 232: What are the other defects?

L338: the potential delay should be shown.

L343: It is not because the mutant has no defect in the IH homolog assay that smc-5 does not have a function in IH repair. Please revise.

Figure 2: A and B: why 2 graphs: the data 10-22hr is plotted twice.

L365: Figure 3A not 4A

Figure 3C and D (graphs) : letter sizes are too small

L388: The numbers for non-crossovers in the IH window is too low (8 events) to draw a convincing comparison between wt and brc-1.

L402: This conclusion is confusing. Brca-1 mutant were shown above to have more CO (intersister). How can one conclude that it does not regulate CO recombination?

L422: Where is the heteroduplex DNA information? Please provide.

Sup Figure 4: What is the sample size ? Wild type: no point is visible; brc-1, only 1 point is visible at 0 rad ? Please clarify. In panel B, the simulation is probably the distribution shown in black, please clarify. In some cases (smc-5 2500 rad) the simulation does not fit the data. This is problematic because the validity of the γ parameter is therefore uncertain. The sup. table 3 and 4 do not show the individual data points, please revise.

What is smc-5 (phx3065) ? PHX3065 seems to be a strain name.

Figure 4: A DSB repair defective control would be important to evaluate how severe the defect in smc-5 mutant is, may be Rad-51 or Rad-54 mutants could be used. The conclusion that the sensitivity (estimated by Γ parameter, 4A) is greater in the non-interhomolog window is not supported by a statistical test. Please revise.

The authors should analyze the phenotypes of the brc-1 smc-5 double mutant with the ICR and IH assays.

Also a more direct monitoring of DSB repair must be done, for instance by detection of RPA and/or RAD51 foci in the different mutants (especially double and triple mutants) with and without the different doses of radiation. How many breaks are induced by 2500 and 5000 rads ?

L 40: SPo11 references: Keeney et al. 1997; Bergerat et al. 1997

L 45: The use of "resolve" for DSB is odd (also L 58)

L75: utilize homologous recombination

Comment on the Discussion

The discussion is mostly reiterating the data from the results and should be more focused on the conclusions that can be drawn, novel points or questions to be addressed.

The question of chromosome fragmentation in Smc-5 and discussion about the data from this manuscript (L 674…) is unclear. How could the mutations detected in smc-5 (Volkova et al.) explain the efficient recovery of HR events by the ICR and IH assays?

The authors should discuss the previous study concluding that Brc-1 is required for intersister recombination (Adamo et al., 2008). After citing this work in the introduction, the authors ignore this opposite conclusion from the discussion. May be the chromatid fragments in brc-1 msh-4 are products of TMEJ ?

Similarly, Bickel et al. 2010, proposed that Smc-5 is required for homolog-independent (presumably intersister) events. The authors must solve this apparent contradiction. Differences between assays and/or Spo11 vs Mos1 induced breaks or other features should be tested.

The model presented in Figure 5 is not supported by the data which does not allow determining which steps of the reaction are affected beside a support for a resection phenotype from the gene conversion tract analysis. The authors could speculate on the different alternatives for the activities of Brc-1 and Smc-5 (and they are many) but presenting a synthetic model is misleading not coherent with the content of the data. It should be removed. If the authors want to keep this visualization, it should be in supplementary data.

A schematic representation of the key assays: the meiotic progression in the gonad to show the reverse kinetic principle, the ICR and the IH assays as a sup figure would help understanding the data.

Reviewer #2 (Recommendations for the authors):

Importantly, data on sister chromatid repair by CO and non-CO data are both supported by GFP reporter assays as well as by directly observing sister chromatid exchanges of EDU-marked chromatids. Having this said, the reviewer struggled to deduce how the reporter system used, allows for distinguishing CO and non-CO outcomes. Could a Suppl model; Figure showing the detailed intermediates be provided? I did not find this in the original C. elegans paper either.

Would it be possible to analyze sister chromatid recombination (proportion of CO versus non-CO outcome as measured by reporter assay) also in brc-1 smc-5 double mutants?

A weakness in the study is that key phenotypes are only analyzed by one allele of brc1 and smc-5 each. Would it be possible to repeat a key experiment, eg EDU labelling or GFP reporter with a second allele? This way, the possibility of secondary, possibly unlinked mutations contributing to phenotypes can be formally excluded. Nowadays, a simple genome edit (generating a second allele) might do the trick.

In the radiation sensitivity assays, would it be possible to also include an analysis of sensitivities of single and double mutants of mitotically proliferating germ cells (before the enter prophase). Such analysis would very much add to our understanding of differential pathway usage of germ cells.

Figures 1-3, I think it would be good, wherever possible, in graphs and diagrams (Figure 1a, c, Figure 2a, b, Figure 3 c, d) to show individual data points in addition to error bars.

Line (46) Is the statement that the majority of meiotic DSBs are repaired by interhomolog recombination true, also for C. elegans?

Lines 121. I think, for clarity, it would be good to use 'more genetic language. Eg 'the hypersensitivity of smc-5 mutations towards IR is suppressed/bypassed by brc-1 (mutation).

Generally, whenever possible only describe mutant phenotypes, or protein function but not both within a sentence.

Line 269 suppl figure 3B. It would be good to precisely refer to the events shown in the text. Eg label (1-5) and refer to (3B.1) 3B.2 etc.

Line 403, Figure 3C and D. Be uniform in what you label as short and long conversion tracks.

Lines 514, and 515, same as the above comment, line 121.

Page 25 consider rewording. Can the word 'resilience' be avoided?

Eg:.…strains or more sensitive to IR than WT,.. are hypersensitive to IR,.. the IR sensitivity of smc-5 mutants is suppressed by brc-1…

Line 587. 599 can this section be reworded to avoid the word 'normal'? Eg BRC-1 localization did not change upon IR in…..

Are the most important strains for measuring inter-sister and interhomolog recombination deposited in the GCG strain collection?

Reviewer #3 (Recommendations for the authors):

As currently written, the manuscript is very focused on C. elegans meiosis. The experiments are generally well done, and the results will be of interest to investigators studying DNA repair and meiotic recombination in C. elegans. However, it is unclear whether the results are unique to C. elegans, and the authors do not give sufficient context to convincingly frame their conclusions as novel or identifying conserved meiotic mechanisms.

At least in the merged PDF of the manuscript, lines 176 and 177 seem out of place, and reading from line 147 (before Figure 1) to line 176 (after Figure 1) does not make sense. I think lines 176-77 should be deleted, but do they belong somewhere else? Also, the first reference to Figure 1A comes later in the text than I would have expected, so I'm not sure if other text was missing that should have been there.

The ICR and IH assays are so important to this paper that there should be a supplemental figure showing how they work and give different outcomes for CO vs NCO, and where the polymorphisms are. Even though they have been published elsewhere, it would be helpful not to have to find those papers to be able to follow the experiments done here.

Line 461: How do the doses of IR used affect the number of DSBs or RAD-51 foci? Are these doses expected to increase breaks 2-fold? 10-fold? The experiments are difficult to interpret without knowing how DSB number (or some DSB proxy) changes.

As the authors acknowledge, there is substantial variation in viability between the broods of different irradiated (and even unirradiated) hermaphrodites with the same genotype. The cause of this variability is not known. However, it is possible that sperm defects contribute to the variability. Irradiation of young adult hermaphrodites will induce mutations both in the germline nuclei undergoing meiosis and in the several hundred mature sperm made earlier in development. Thus, the "reverse timecourse" following irradiation is capturing both the effects of mutations made at different stages of nuclei undergoing oogenic meiosis and sperm that had already completed meiosis when irradiated. Larval lethality could result from either, and may be revealing how an embryo copes with inheriting damaged DNA from the sperm. It is also formally possible that sperm differences account for the variability observed in unirradiated worms. It is already difficult to compare the data using Mos1 induced breaks to the irradiation data because the assays are completely different. However, the Mos data also presumably is only measuring recombination during oocyte production (i.e. not in sperm), while larval lethality following irradiation is likely measuring damage in sperm as well as during oogenesis. I would recommend mating irradiated hermaphrodites with unirradiated males to simplify the analysis by looking only at consequences of damage that will ultimately affect the oocyte.

The irradiation/larval lethality assay was used instead of the ICR/IH assays because "genetically balanced smc-5;brc-1 double mutants can still acquire mutations and become progressively sterile over the course of a few generations" (line 456). From the strain list, it looks like only smc-5 was balanced, but brc-1 was maintained in a homozygous condition. Given the availability of numerous small inversion balancers made by the Mitani lab, it should be possible to balance both loci. This may prevent the accumulation of defects and allow the ICR/IH assays to be done in double mutants. Alternatively, perhaps the degron-tagged smc-5 allele could be used to deplete SMC-5 acutely. If so, this would greatly strengthen the paper.

For me, the way the irradiation data are presented calls into question their robustness, or at least suggests that the conclusions are only as good as the mathematical model. I think many of the key results are visible in Supplemental Figure 4A, at least at some doses. As a biology person and not a statistics person, I would find it substantially more convincing to discuss the empirical data first, then bring in the model data to support the empirical data. At the very least, I need better justification for the design of the statistical model and its reliability.

Identical data are presented as wild-type controls in several figures (Figures1A and 4A, 1B and 4C, Supplemental Figure 1A and B, and elsewhere). This gives the false impression that each mutant was analyzed in parallel with a wild-type control. However, it is unclear from the text, figure legends, and methods whether any of the experiments were done with parallel controls. In fact, the wild-type dataset was performed once and combined with previous data (line 950). Ideally, wild-type and mutants would be analyzed at the same time, on the same batch of plates, same batch of worm food, and in the same incubator, since meiosis is temperature sensitive, and heat shock genes can be induced by a variety of stressors, including wet plates. If this was not done, the authors should clearly state it in the methods and ideally also in the figure legends, since it is an important point. I also think it would be less confusing, and would potentially make the paper easier to read, if some figures were combined, for example 1A and 4A could be one figure (with a legend stating that multiple replicates were done, but not always in parallel for different genotypes); 1B and 4C could easily be combined.

Figures 1B and 4C: the N values are given for number of bivalents analyzed. The number for WT seems reasonable, but the numbers for mutants seem small even though this is a somewhat difficult experiment. How many bivalents were analyzed in each oocyte, and how were they chosen? How many oocytes were analyzed? How many animals?

Figure 3A and C: it is hard to interpret the data showing a statistically significant effect of brc-1 depletion on resection tract length because so many fewer NCO tracts were analyzed in brc-1 than in wt or smc-5 and only one long tract was identified. I guess this would only mean that the magnitude of the effect is being underestimated, not the opposite.

10.7554/eLife.80687.sa2
Author response
Essential revisions:

1) Understanding the assays is important for the readers. Even though the information is available in previous publications, a supplementary figure describing the assays (ICR and IH) and recombination products and their detection is suggested.

We appreciate the reviewers’ helpful suggestion and have generated a new supplemental figure (Figure 1 —figure supplement 1) with diagrams of the IH and ICR assays.

2) As noted by the authors, the inter-sister CO increase was not expected and seems to contradict the previous publications by Adamo et al. and Bickel et al. Have the authors thought about testing intersister recombination with another allele of their mutants to exclude effects due to unknown mutations? This issue needs to be addressed and discussed.

We now include data with the ICR assay performed in both the classical brc- 1(tm1145);brd-1(dw1) mutant and null smc-6(ok3294) mutant. The ICR results in brc- 1(tm1145);brd-1(dw1) mutants revealed a clear increase in homolog-independent crossovers, corroborating our brc-1(xoe4) results (Figure 1 —figure supplement 2B). We observed both crossover and noncrossover repair outcomes in smc-6(ok3294) mutants at levels comparable to wild type, although smc-6 mutants did not display a large increase in crossover events that we observed in smc-5 mutants (Figure 2 —figure supplement 1B). Thus, our additional experiments affirm that neither SMC-5 nor SMC-6 is required for homolog-independent repair. While both smc-5(ok2421) and smc-6(ok3294) null mutants prevent SMC-5/6 complex assembly (Bickel et al.), it is possible that the residual proteins of the SMC-5/6 complex in either single mutant (e.g. SMC-5 protein in the smc-6(ok3294) null mutant) may still exert subtle functions sufficient to influence DNA repair outcomes that are independent of an assembled SMC-5/6 complex. We have therefore amended the text of our manuscript to specify that our results are specific to the function of SMC-5, rather than SMC-5/6.

Our multipronged assessment of DNA repair phenotypes provides further confidence that a strong modifier allele is not affecting our analysis of smc-5 and brc-1 mutants relative to previous work. In our hands, smc-5(ok2421) mutants closely recapitulated previously published RAD-51 foci counts (Figure 4B), sensitivity to ionizing radiation (Figure 4C), and defects in chromosome compaction described in Bickel et al. Similarly, brc-1 mutants displayed ionizing radiation sensitivity (Figure 4C), disrupted RAD-51 loading in mid-late pachytene (Figure 4 —figure supplement 2C), and a high incidence of males (a product of chromosome nondisjunction) when maintained in stocks; phenotypes previously reported in Adamo et al., Janisiw et al., and Li et al.

Taken together, our data complements previous work on BRC-1 and SMC-5/6. Our experiments affirm the long-standing hypothesis that BRC-1 and SMC-5 regulate intersister DNA repair; however, our data indicate that they are not necessarily required for intersister repair (which is what was originally hypothesized), but instead our results support a growing body of evidence that BRC-1 and SMC-5/6 regulate diverse meiotic DNA repair outcomes. Our study therefore provides vital context to the meiosis and DNA repair fields. To emphasize and clarify these points (especially the fact our data complements prior published data), we have summarized these notions in a new section of our discussion (lines 545-589).

3) L303-304: The interpretation of the increased GFP progeny is a major issue and cannot be redirected to a few sentences in the methods section as this is the major topic of this study. The methods section outlines several alternatives, whereas the main text seems to prioritize some. This seems arbitrary and should be clarified with experimental data (for instance testing the SNP hypothesis).

We agree that the increased frequency of ICR assay recombination events in both smc-5 and brc-1 mutants is of potential biological importance, and we therefore performed experiments to test our hypotheses that the rate of increased recombinants in brc-1 and smc-5 mutants may be underpinned by relaxed heteroduplex rejection and/or increased Mos1 excision. It is important to note, however, that none of the conclusions made from the ICR assay in our manuscript are informed by the absolute frequency of ICR assay recombinants; we only draw conclusions from the ratios of homolog-independent noncrossovers and crossovers. We further make no claims as to the absolute frequency of intersister events that occur in brc-1 and smc-5 mutants.

We now include new experimental data where we tested whether altered heteroduplex recognition or rejection may influence the frequency of detectable ICR assay recombinants by specifically performing the ICR assay in a msh-2 mutant, which is required for mismatch repair (Figure 1 —figure supplement 2, Chakraborty and Alani 2016). We found that the overall frequency of recombinants was not significantly altered in this context, disfavoring the mismatch-rejection model.

We next attempted to directly measure the frequency of Mos1 excision following heat shock by quantifying the number of RAD-51 foci produced following heat shock with the ICR assay in spo-11, smc-5::AID::3xFLAG;spo-11, and brc-1;spo-11 mutants. However, we found that our smc-5::AID::3xFLAG;spo-11 ICR assay strains were sick and mated very poorly, preventing us from obtaining sufficient animals to perform the experiment. Further, the brc-1(xoe4);spo-11 ICR assay strains were genetically unstable and segregated phenotypes consistent with balancer breakdown. We hypothesize that this problem is due brc-1 intolerance for large heterozygous genomic rearrangements, such as the nT1 translocation balancer required to properly balance spo-11 and the ICR assay.

We attempted to balance brc-1 with the multiply inverted balancer chromosome qC1 (Edgley et al. Micropub. 2021) and observed similar genetic instability. As BRC-1 represses heterologous recombination (Leon-Ortiz et al. Mol. Cell 2018), brc-1 mutation may be broadly incompatible with this balancer class. Unfortunately, the smaller inversion balancer that covers the unc-5 locus on chromosome IV (Dejima et al. Cell Rep. 2018) contains a transgene disrupting the unc-5 locus, rendering it unusable for our purposes. We therefore were unable to test the absolute rate of Mos1 excision in the ICR assay in smc-5 and brc-1 mutants. As we noted in the text of our manuscript (Lines 191- 194,271-273), the maximum incidence of recombinants in the smc-5 and brc-1 IH assays were not elevated relative to wild type, suggesting that increased Mos1 excision is not increased in these mutants. Future work beyond the scope of this manuscript will be required to determine the underlying cause of the elevated rates of GFP+ ICR assay progeny in smc-5 and brc-1 mutants.

4) The authors cannot conclude that both assays (L 323 support a function for SMC-5 in repressing intersister crossover in C. elegans meiosis: Data from Edu is supported by only 6 bivalents coming from 2 oocytes. In addition, could the authors demonstrate that those exchanges are taking place during meiosis? (as performed for him-6, this may require to analyze a smc-5 spo-11 mutant).

We appreciate the reviewers’ comment and have quantified additional chromatid pairs from smc-5 mutants. Our collaborators (David Almanzar and ofer Rog) identified additional SCE chromatids at a frequency in line with prior experiments (Figure 2D). We also appreciate that assessing for SCEs in an smc-5;spo-11 mutant could be informative. However, due to the dissertation completion timeline of our collaborators, this analysis is beyond the scope of this manuscript. To interpret this data more conservatively, we have amended our text to emphasize that our smc-5 SCE counts should be interpreted as evidence that meiotic and/or mitotic intersister crossovers do occur in the absence of SMC-5 but may not reflect the absolute levels of SCEs (Lines 262-266).

5) L361: the potential delay should be shown. Assigning the two time-windows as inter homolog and non interhomolog is at the basis of the experimental approach and whether it is altered in the mutants or not must be known and taken into account for interpretations.

We agree with the reviewers that the potential delay in meiotic progression is of interest, and recent work using the early prophase marker DSB-1 was recently published affirming that prophase I progression is delayed in brc-1 mutants (Trivedi et al. NAR 2022).

However, our interhomolog assays (Figure 1 —figure supplement 3, Figure 2 —figure supplement 2) already serve as a key control that addresses this concern. In both smc-5 and brc-1 mutants, additional recombination events were not observed in the non- interhomolog window timepoint (10-22hr), indicating that the timepoints we use for the interhomolog/non-interhomolog windows are appropriate for the mutants assessed in this study.

6) Analysis of ICR and IH in brc-1 smc-5 double mutant. The authors could use balancers for both loci to maintain the strain, and minimize accumulation of genomic instability (from the strain list, a balancer was used for smc-5 but not for brc-1). Alternatively, the Smc-5 degron allele could be used.

We agree with the reviewers that the brc-1 smc-5 double mutant is of interest. Unfortunately, the balancer options available for the brc-1 locus of Chromosome III are limited to translocation balancers, and in our hands translocation balancers (both nT1 and qC1) are highly genetically unstable in a brc-1 mutant background, limiting their application for these purposes. We therefore introgressed a germline-specific TIR1 transgene into the smc-5::AID::3xFLAG background, enabling germline-specific SMC-5 depletion in the presence of auxin (Figure 4 —figure supplement 2A,B). We then generated the smc-5::AID::3xFLAG;brc-1(xoe4) double mutant ICR assay strains and performed the assay following SMC-5 depletion (Figure 4A). We found that the ICR assay in brc-1 mutants following SMC-5 depletion appear very similar to brc-1 single mutants, suggesting that BRC-1 acts upstream of or in the same pathway with SMC-5 to regulate homolog-independent repair outcomes (Lines 344-364).

7) Irradiation experiments: Please provide cytological data of DSB repair detection (ie RPA or Rad-51) in the different mutant contexts and information about the number of DSBs induced at the different doses of IR (14 DSB per homolog pair for 5000 rads as from Almanzar et al?). Also provide information about the γ sensitivity of germ cells of wt, single and double mutants.

We appreciate the value of the reviewers’ suggestion to additionally assess DSB repair cytologically to complement our functional analysis. We examined RAD-51 foci in wild- type, smc-5, brc-1, and smc-5;brc-1 germlines (Figure 4B). The results of this analysis are discussed in the manuscript at Lines 365-383. As we used γ radiation from a cesium source rather than X-rays to induce DSBs in this study, we reference the DSB induction estimates calculated in Yokoo et al. Cell 2012 that also used γ radiation to induce DSBs. From Yokoo et al., a dose of 5000 Rads is expected to induce approximately 9.8 DSBs/chromatid pair, while a dose of 5000 Rads would inflict 19.6 DSBs/chromatid pair. We have included this information in the text for the readers’ reference (Lines 390-392).

The readout of the irradiation experiments is brood viability. One major problem with the interpretation is that sperm is also irradiated and can contribute to the phenotype. To avoid this issue, the authors should irradiate hermaphrodites and mate with non-irradiated males. This could be tested at least for one genotype (ie brc-1 smc-5) to evaluate the potential impact of sperm irradiation.

We appreciate this point made by the reviewers, particularly considering recent evidence that sperm-specific irradiation can cause intergenerational lethality in C. elegans (Wang et al. Nature 2023). Wang et al. demonstrate that even at doses of radiation much higher than those used in this study, the sperm-specific impact on brood viability is minimal in the F1 generation following P0 irradiation. The notable exception to this observation is in polq-1 mutants, as DSBs in mature sperm DNA are repaired by maternally contributed POLQ-1 in the fertilized zygote. To assess the potential confounding effect of sperm to our brood viability experiments, we irradiated smc-5;brc-1, polq-1, and smc-5;brc-1;polq- 1 mutant hermaphrodites and then mated these animals to unirradiated males (Figure 4 —figure supplement 3A,B, see Methods lines 781-783). In accordance with Wang et al., introduction of polq-1 mutation did increase the sensitivity of brood viability to radiation due to sperm-specific effects. However, mating did not rescue brood viability in the non- interhomolog window of smc-5;brc-1;polq-1 mutants, supporting our conclusion that TMEJ is engaged in late stages of meiotic prophase I to resolve DSBs in smc-5;brc-1 mutants. We have added description of these results to our Results section (Lines 447- 460).

8) The main figure (figure 4) should present brood viability, and the fit to the model as supplementary figure, as qualitatively the effects can be visualized by examining the brood viability: i) greater sensitivity of smc-5 compared to brc-1 (the claim for a greater sensitivity in the non-interhomolog window is not convincing as the differences of the γ parameter are quite small, may be excepted for the brc-1 mutant at 5000 rads; in addition, no statistical test is validating the differences),ii) dispensability of BRC-1 at early prophase in low IR, iii) suppression of smc-5 sensitivity by brc-1 in the interhomolog window, iv) sensitization by polq-1.

We appreciate the reviewers’ feedback on the presentation of our irradiation data and subsequent analysis. In response, we have exchanged the positions of our plots representing the experimental data we gathered and the outputs from our Bayesian modeling analysis (Figure 4C, Figure 4 —figure supplement 3A).

9) Discussion:

The discussion is mostly reiterating the data from the results and should be more focused on the conclusions that can be drawn, novel points or questions to be addressed, and relating to current knowledge on Brc-1 and Smc-5 in other species.

The question of chromosome fragmentation in Smc-5 and discussion about the data from this manuscript (L 674…) is unclear. How could the mutations detected in smc-5 (Volkova et al.) explain the efficient recovery of HR events by the ICR and IH assays? As indicated above (point 2), the authors should discuss the previous study concluding that Brc-1 is required for intersister recombination (Adamo et al., 2008).

After citing this work in the introduction, the authors ignore this opposite conclusion from the discussion. May be the chromatid fragments in brc-1 msh-4 are products of TMEJ ? Similarly, Bickel et al. 2010, proposed that Smc-5 is required for homolog-independent (presumably intersister) events. The authors must solve this apparent contradiction.

The question of potential differences between Spo11 and Mos1 induced breaks should be discussed and thus with alternative interpretations.

We appreciate the interesting points raised by the reviewers here. In reference to Adamo et al. and Bickel et al., we have added additional context to our discussion (Lines 516- 527, see also our response to Major Revision point #2). We do not feel that our results contradict the Adamo and Bickel results and instead provide additional context to their data by applying technologies not available at the time of these original studies to directly test the specific role of SMC-5/6 and BRC-1 in homolog-independent DSB repair. Our parallel application of the EdU labeling assay (which monitors primarily SPO-11- induced DSB repair) and ICR assay (which monitors Mos1 excision-induced DSB repair) addresses the concern that our detection of intersister events may be unique to exogenous DSB repair. We have emphasized this point both in the Results (Lines 164- 165) and Discussion (Lines 524-527).

We thank the reviewers for their feedback on the structure of our Discussion. We regret that the reiteration of our conclusions, which we included with the intention to help guide a non-recombination expert reader through this section, deemphasized the primary discussion points we wished to convey. We have therefore streamlined the entire Discussion section to focus on contextualizing our results in the light of prior research.

10) The model presented in Figure 5, with the molecular intermediates is only indirectly supported by the data which does not allow determining which steps of the reaction are affected besides for the resection phenotype from the gene conversion tract analysis. The model would be better suited to be presented as a supplementary figure.

We have moved this figure to supplement (Figure 4 —figure supplement 6).

11) Box plots: Plot data points instead of box plots: Figure 1A, 1c, supfig2b, 2d, Figure 2B, 2d, Figure 3C, d

We appreciate the reviewers’ suggestions to improve the clarity of our data visualization. However, the panels indicated represent count data, and therefore the bars themselves accurately reflect the relevant proportions used for statistical analysis. As the ICR assay requires the quantification of low-frequency events (~0.7% of progeny in wildtype ICR assays) and the synchronization of P0 worms tested in the assay must be performed within a limited temporal window (see Methods lines 846-847), we sum together 4 replicates of the ICR assay or 2 replicates of the interhomolog assay when making comparisons between mutant contexts in either assay. The bar plot visualizations we employ and our approach for statistical analysis is consistent with previous work (Rosu et al. Science 2011, Almanzar et al. Curr. Biol. 2021, Toraason et al. Curr. Biol. 2021). For transparency in our results, we have updated the relevant source data files to specifically delineate the number and phenotypes of progeny assayed in each replicate.

Other revisions:

12) Abstract: L21: SMC-5 was not shown to limit error prone repair.

This line has been removed.

13) The authors should introduce more widely the current knowledge about Brca1 and Smc5/6 with information from other species. Their results should also be integrated into a larger context.

We appreciate that our reviewers suggestion to contextualize our results broadly in the field. Our revised manuscript includes numerous references to work in yeasts and mammals that inform both our approach to this work and discussion of our conclusions. We have additionally added references to data from plants (Lines 539-541).

14) It is unclear whether each mutant was analyzed in parallel with a wild-type control. In principle to control for experimental variations (temperature…) this should be done. As presented in figures, one has the impression that wild-type and mutants were done in parallel. Please explain clearly the experimental procedures in the methods, and provide relevant information in the legends.

We thank the reviewers’ for identifying sections of our Methods that are unclear. To perform the time course of the ICR assay, we manually isolate all the parent hermaphrodites to be included in the experiment within a brief window precisely 16-18hr preceding heat shock. As the cross schemes required to generate some of P0 hermaphrodites yield the desired parent at a frequency as low as ~3 % (e.g. for smc-5 mutants) and many parent hermaphrodites are required for these experiments, its is infeasible to perform these assays in parallel. We have added more transparent language to make this point in our Methods section (Lines 869-877) and in figure legends, where appropriate.

15) In several figures (ie Figure 1C and others), sample sizes and duplicates are not clearly indicated: how many animals, how many oocytes. It would be easier to have N values on the figures. It is mentioned in the methods that ICR assays were repeated 4 times with at least 20 parents each (what about the IH assays ?), but the source data shows only the total pool of progeny tested. What is the inter-parent and inter-replicate variation?

We appreciate the reviewers’ suggestions to improve the clarity of our methodology. We have added specific sample sizes to our figure legends where appropriate and provided details on the specific progeny counts in our supporting data for individual replicates.

We also thank the reviewers for catching our mistake in not including specific replicate information for the IH assays. The IH assay was performed twice for each genotype, as the high frequency of recombinants in the IH assay requires fewer progeny for robust quantification of recombination phenotypes relative to the ICR assay. To ensure that we correctly distinguished between noncrossover and mutagenic end joining events among these recombinants, we also had to individually sequence the unc-5 locus of each potential noncrossover recombinant derived from our IH assays (461/483 non-Unc recombinants were successfully identified, and the remainder that couldn’t be sequenced were labeled as ‘undetermined’, Figure 1 —figure supplement 3, Figure 2 —figure supplement 2), reducing the throughput of these assays relative to previous work (Rosu et al. Science 2011, Toraason et al. Curr. Bio. 2021). This information is now included in our Methods (Lines 941-981). For Figure 2C, our collaborators (David Almanzar and Ofer Rog) provided additional numbers which are now included the text and figure legends.

16) For counting bivalents, some with visually interpretable bivalents were counted. Likely some bivalents either DAPI or Edu staining was difficult to interpret. How to exclude a selection bias in this analysis?

We acknowledge this concern from the reviewers. As described in the methods of Almanzar et al. Curr. Biol. 2020, the paper in which this technique was established: “… the poor resolution in the z axis prohibited analysis of chromosomes that were not oriented horizontally relative to the imaging plane. Exchanges (or lack thereof) were examined only in chromosomes where one of the two sisters was labeled with EdU and the two sisters were clearly distinguishable in the xy-plane. Sister exchanges were scored when EdU labeled chromatin crossed the chromosome axis (decorated with anti- HTP-3 antibodies), which represents the inter-sister interface. For bivalents, each of the long arms was scored independently.”

17) Fig1D: some numbers do not match the table: 1/41 instead of 1/43…, same for 1E.

And the mutant non-unc is 17.2% in the figure but 13.2% in the text.

We thank the reviewers for catching our typo in the text. The revised manuscript has been amended to accurately reflect the 17.2% statistic. The 1/41 number in Figure 1D refers specifically to the number of successfully sequenced GFP+ progeny.

Unfortunately, we were unable to successfully sequence n=2 GFP+ animals identified in our brc-1 ICR assays. We therefore excluded these animals from the calculation presented in Figure 1D.

18) Figure 3 A and C: The number of noncrossover conversion tracts in the non-IH window for smc-5 and brc-1 seems to be too low (with one long event in brc-1) to be statistically valid, even though a p value was calculated by the Fisher's exact test. The authors should dampen their conclusion that Brc-1 only affects tract length in the IH window or alternatively increase sample size.

We appreciate the reviewers’ point regarding this sample size. We have amended the text (Lines 306-308) to emphasize that our data only supports that the role of BRC-1 in regulating conversion tract length in the IH window but does not necessarily preclude it from performing this function in the non-IH window.

19)

L 39: SPo11 references: Keeney et al. 1997; Bergerat et al. 1997.

L 44: The use of "resolve" for DSB is odd (also L 55, 74).

L 51: "In SDSA, one resected end" might be better than "the resected end".

L 74: Utilize homologous recombination.

Fixed

L 104-5: vague; not additive could mean synergistic or unchanged.

We thank the reviewers for pointing out a place where our text was unclear. Both smc-5 and brc-1 mutants exhibit chromosome fragments (indicative of unrepaired DSBs at diakinesis). This phenotype is not additive nor synthetically increased in the double mutant, providing rationale that SMC-5 and BRC-1 may function in the same pathway. We have modified the text to better emphasize this point (Lines 98-100)

L 121 (and L514-515). For clarity, it would be good to use 'more genetic language. Eg 'the hypersensitivity of smc-5 mutations towards IR is suppressed/bypassed by brc-1 (mutation).

Fixed

L514: Could the term resilience be avoided, replaced by Eg:.…strains or more sensitive to IR than WT,.. are hypersensitive to IR,.. the IR sensitivity of smc-5 mutants is suppressed by brc-1….

Fixed

L 176-177: seem out of place, please revise.

We thank the reviewers for catching this typo. We have fixed the indicated text (Lines 135-153)

L179: "Does not necessarily represent recombinant progeny". The meaning is unclear. Please clarify.

Fixed

Line 198 and elsewhere: "is not required for" could be understood to mean "is not involved in." The intended meaning is "is not essential for."

Thank you for this clarifying suggestion, we have made the relevant changes to favor this language.

L 210. More frequently is vague please provide quantitative information.

We appreciate the reviewers’ suggestion to provide more quantitative language, however, the specific frequencies of mutagenesis in brc-1 mutants seen in the very thorough Kamp et al. and Meier et al. studies vary depending on the mutagen and resulting mutations observed. To avoid including too much verbiage that could prove distracting to the reader, we have modified the text to better emphasize the important point that brc-1 mutants incur mutations normally repressed during meiosis (Lines 187- 188).

L 246: "a slight delay in the rate of meiotic progression" the rate is not delayed.

Previous work (Rosu et al. Science 2011) indicates that mutants that impede crossover formation and therefore delay meiotic prophase progression extend the window in which the homolog is available as a repair template in the IH assay. Our results parallel recent cytological evidence using the early prophase marker DSB-1 (Trivedi et al. NAR 2022) that also indicates that brc-1 mutants exhibit altered prophase progression. We have updated the text to reflect this relevant evidence (Results Lines 196-198, Discussion Lines 531-535).

L 261: "at the time of Mos1 excision" perhaps should say "at the time of heat shock" since there is likely some delay between heat shock and transposase expression and transposon excision.

We have amended our statement accordingly.

L 269 suppl figure 3B. It would be better to precisely refer to the events shown in the text. Eg label (1-4) and refer to (3B.1) 3B.2 etc etc.

We agree with this suggestion from the reviewers and have modified the figure and text accordingly.

L 283: 5 not 4 mutants have been identified (Figure 1E), but only 4 are reported?

We thank the reviewers for identifying this point of potential confusion. As described in our methods (Lines 966-969), we successfully identified two independent unc-5 mutations in one of the non-Unc progeny derived from the IH assay. As somatic Mos1 excision can occur in the ICR assay (Toraason et al. Curr. Biol. 2021, Toraason et al. STAR Protocols 2021), these mutations likely stem from separate meiotic and somatic Mos1 excision events. We cannot distinguish which of these mutations are meiotically- derived and therefore wish to avoid making claims pertaining to the origin of this mutant. We have added a statement to the main text clarifying this point (Lines 220-221).

Line 299: "SMC-5/6 is therefore not required for viability in C. elegans…" this conclusion does not follow from the data presented in the preceding sentences.

C. elegans smc-5, smc-6, and smc-5;smc-6 null mutants survive and are fertile despite ablation of the SMC-5/6 complex and can produce living progeny for many generations (Bickel et al. 2010), indicating that nematodes are capable of essential biological function (are viable) in the absence of this complex. In line with previous edits suggested by the reviewers, we have amended the text of this sentence to specify that SMC-5/6 is not essential for viability in C. elegans, rather than not required for viability (Line 237).

L 318: intersister in smc-5. "Among a limited sample", please clarify, does it refer to 6 individuals?

We have updated the text to specify the number of chromatids examined (Line 260).

Supplemental Figure 3B: using a monospaced font in the DNA sequences would ensure that the nucleotides in each strand were properly aligned.

We thank the reviewer for this suggestion. We have amended the figure accordingly.

Figure 2C-D: it would be helpful to see an image of an "uninterpretable" bivalent in the SCE assay and to know what percentage of bivalents were discarded as uninterpretable in wt, brc-1, and smc-5 animals.

The SCE assay results were performed by our collaborators (David Almanzar and Ofer Rog). They state, “most excluded chromosomes were to what are very technical as opposed to biological reasons (e.g. the stochasticity in EdU incorporation and progression of nuclei in the gonad; and the orientation of the bivalent to the xy-axis of the microscope).” Also, please see the response to Essential Revision #16 regarding the original publication of the SCE assay method developed by the Rog lab (Almanzar et al., Current Biology 2021). Due to the lack of EdU incorporation, uninterpretable bivalents were not imaged by the collaborators on the project.

Line 380: could be more specific. "in restricting/limiting intersister CO recombination".

L 389: Figure 3A not 4A.

Fixed

L 428: This conclusion is confusing. Brca-1 mutant were shown above to have more CO (intersister). How can one conclude that it does not regulate CO recombination?

We thank the reviewers for identifying this opportunity for us to clarify our language. We intend to imply that our data does not support a function for regulating homolog- independent CO intermediates that would influence the extent of gene conversion following joint molecule resolution. We speculate in our discussion (Lines 522-577) as to how regulation of noncrossover-precursors may influence noncrossover/crossover DNA repair outcomes. The text has been edited to more clearly convey our intent (Lines 318- 320).

L 448: Where is the heteroduplex DNA information? Please provide this data.

Positions at which we detected heteroduplex DNA signals are depicted in the conversion tract plots as open circles, as outlined in the relevant figure legend. We acknowledge that these sites may be difficult to see, so we have added asterisks to indicate these tracts (Figure 3, Figure Legend 3).

Figure 3C and D (graphs): font is too small.

Fixed

Figure 4, supplemental figure 4: it would be interesting to see controls with for example polq-1 single mutants and polq-1 double mutants with brc-1 and smc-5. These controls might shed some light on what is going on and get closer to mechanism.

We agree with this suggestion from the authors and have assessed polq-1 single mutant sensitivity to ionizing radiation (Figure 4 —figure supplement 3) in both unmated and mated conditions. In line with previously published work (Kamp et al. Nat. Comm. 2020), we demonstrate that POLQ-1 contributes minimally to meiotic DSB repair when BRC-1 and SMC-5/6 are present.

Sup Figure 4: What is the sample size ? Wild type: no point is visible; brc-1, only 1 point is visible at 0 rad ? Please clarify. In panel B, the simulation is probably the distribution shown in black, please clarify.

We thank the reviewers for indicating how we could improve our data visualization. The low variance in unirradiated wildtype animals caused all the datapoints to cluster together in Figure 4C. To better visualize the brood viabilities of the individual hermaphrodites, we changed the shape of the datapoints and added horizontal jitter (Figure 4C, Figure 4 —figure supplement 3B). Additionally, we have added clarifying text to our posterior simulations to emphasize the experimental (formerly labeled ‘empirical’) and simulated distributions (Figure 4 —figure supplement 3C).

In some cases (smc-5 2500 rad) the simulation does not fit the data. This is problematic because the validity of the γ parameter is therefore uncertain. The source data do not show the individual data points (ie brood viability of individual hermaphrodites), please revise.

We appreciate the reviewers’ pointing out instances where our model fit could be improved. By reparametrizing our model to use the mean and shape parameter sum of the Β distribution, we improved the model fit (Methods Lines 794-802, Figure 4 —figure supplement 3C).

Supplemental Figure 7 is never referred to in the manuscript.

We included this figure (now Figure 4 —figure supplement 2 in the revised manuscript) to demonstrate that RAD-51 localization occurs using our tagged smc-5 allele, in contrast to the known RAD-51 loading defect in brc-1 mutants. Supplemental Figure 7 was referenced on Line 596 of the original manuscript and is referenced on line 354 in the revised manuscript.

What is smc-5 (phx3065) ? PHX3065 seems to be a strain name.

We cannot find the place in the manuscript where we refer to smc-5(phx3065). As listed in our Methods (Line 754 in the revised manuscript), the strain PHX3065 carries the smc- 5(syb3065) allele, which is the endogenously tagged smc-5::AID*::3xFLAG. If the reviewers would please identify the position where we misannotated this genotype, then we would be happy correct this mistake.

L 642: "influences noncrossover intermediate processing" is vague.

We have altered this line to be more specific as a part of the larger requested changes to our discussion (Lines 507-509).

Are the most important strains for measuring inter-sister and interhomolog recombination deposited in the GCG strain collection?

The ICR assay strain (DLW14) and repair template strain (CB791) are available through the CGC. The strain IH assay strain (AV554) was developed in the Villeneuve Lab as part of Rosu et al., Science 2011 and we were unaware that it was not added to the CGC strain collection with the other strains from that published paper (many thanks to the reviewers for pointing this out). We have recently submitted AV554 to the CGC so that it can be easily obtained by the C. elegans community.

Reviewer #1 (Recommendations for the authors):

Figure 1: The number of biological duplicates is unclear and single-point data cannot be found in the tables. It is said that assays were replicated 4 times and at least 20 parents each, but sup table 1 only show the total progeny. What is the inter-parent and inter-replicate variation?

The individual replicate numbers of these experiments are now available in the supporting data associated with the relevant figures.

Fig1D: some numbers do not match the table: 1/41 instead of 1/43.…, same for 1E

And the mutant non-unc is 17.2% in the figure but 13.2% in the text ?

We thank the reviewer for catching this discrepancy. We have thoroughly vetted the manuscript to ensure all numbers are correct. Also, please see our response to Essential Revision #17.

L171: "Does not necessarily represent recombinant progeny". The meaning is unclear. Please clarify.

Fixed

L 222. More frequently is vague please provide quantitative information.

Fixed

L 252: 5 not 4 mutants have been identified, but only 4 are reported?

See our response to Essential Revisions #19.

Interhomolog assay: the progeny is referred to as non-unc or unc-5 (+). This is confusing , please use one of the two. It seems that referring to unc-5 (+) is better even if this can include some mutational events.

We appreciate the reviewers’ suggestions on our specific language when referring to phenotypically revertant progeny in the IH assay, and had previously considered using the suggested ‘unc-5(+)’ nomenclature when drafting our manuscript. The term ‘non-Unc’ is appropriate terminology commonly used by C. elegans geneticists to refer to nematodes with normal locomotion. Our rationale to use this language, rather than unc- 5(+), is to avoid confusion over the distinction between recombinant and mutant progeny, as this is an important delineation in repair events that informs our conclusions. Thus, while we greatly appreciate this feedback from the reviewer, we have maintained our original language in this revised draft.

L228 and sup2A: increase of interhomolog !!

Please see our response to Essential Revision #2 and the associated changes to the Discussion.

L287: The interpretation of the increased GFP progeny is a major issue and cannot be redirected to a few sentences in the methods section as this is the major topic of this study. The methods section outlines several alternatives, whereas the main text seems to prioritize some. This seems arbitrary and should be clarified with experimental data (for instance testing the SNP hypothesis).

Please see our response to Essential Revision #3.

L324: intersister in smc-5. "Among a limited sample", please clarify, does it refer to 6 individuals?

We have added relevant sample size information to the text and figure legends.

L 232: What are the other defects?

We are uncertain what this comment is in reference to but would be happy to rectify any concerns the reviewer has that this line is in reference to.

L338: the potential delay should be shown.

Please see our response to Essential Revision 5.

L343: It is not because the mutant has no defect in the IH homolog assay that smc-5 does not have a function in IH repair. Please revise.

We have amended the statement accordingly.

Figure 2: A and B: why 2 graphs: the data 10-22hr is plotted twice.

Our ICR/IH data can be examined both by individual timepoints and overall within the IH/non-IH window. As there is only one timepoint in the non-IH window, there is no distinction between these two representations as the reviewer notes. However, this alternative representation can provide information in particular for the IH window, and for clarity of information we provide both visualizations for the reader. We have previously used this style of visualization in Toraason et al. Curr Biol. 2021.

L365: Figure 3A not 4A

Fixed

Figure 3C and D (graphs) : letter sizes are too small

Fixed

L388: The numbers for non-crossovers in the IH window is too low (8 events) to draw a convincing comparison between wt and brc-1.

Please see our response to Essential Revisions #4.

L402: This conclusion is confusing. Brca-1 mutant were shown above to have more CO (intersister). How can one conclude that it does not regulate CO recombination?

Please see our response to Essential Revisions #19.

L422: Where is the heteroduplex DNA information? Please provide.

We have amended Figure 3 and its associated figure legend.

Sup Figure 4: What is the sample size ? Wild type: no point is visible; brc-1, only 1 point is visible at 0 rad ? Please clarify. In panel B, the simulation is probably the distribution shown in black, please clarify. In some cases (smc-5 2500 rad) the simulation does not fit the data. This is problematic because the validity of the γ parameter is therefore uncertain. The sup. table 3 and 4 do not show the individual data points, please revise.

Please see our response to Essential Revisions #19.

What is smc-5 (phx3065) ? PHX3065 seems to be a strain name.

Please see our response to Essential Revisions #19.

Figure 4: A DSB repair defective control would be important to evaluate how severe the defect in smc-5 mutant is, may be Rad-51 or Rad-54 mutants could be used. The conclusion that the sensitivity (estimated by Γ parameter, 4A) is greater in the non-interhomolog window is not supported by a statistical test. Please revise.

We appreciate this suggestion from the reviewer. Both RAD-51 and RAD-54 null mutants are sterile due to severe chromosome fragmentation, as all meiotic recombination in C. elegans is dependent upon these proteins. We also appreciate the feedback from the reviewer on our statistics. To account for multiple levels of variation (including inter- hermaphrodite and inter-genotype variation in brood size and baseline brood viability) into our analysis, we employed a Bayesian statistical modeling approach and therefore compared the Credible Intervals of our parameter estimates to inform our conclusions.

The authors should analyze the phenotypes of the brc-1 smc-5 double mutant with the ICR and IH assays.

Please see our response to Essential Revisions #6.

Also a more direct monitoring of DSB repair must be done, for instance by detection of RPA and/or RAD51 foci in the different mutants (especially double and triple mutants) with and without the different doses of radiation. How many breaks are induced by 2500 and 5000 rads ?

Please see our response to Essential Revisions #7.

L 40: SPo11 references: Keeney et al. 1997; Bergerat et al. 1997

Fixed

L 45: The use of "resolve" for DSB is odd (also L 58)

Fixed

L75: utilize homologous recombination

Fixed

Comment on the Discussion

The discussion is mostly reiterating the data from the results and should be more focused on the conclusions that can be drawn, novel points or questions to be addressed.

The question of chromosome fragmentation in Smc-5 and discussion about the data from this manuscript (L 674…) is unclear. How could the mutations detected in smc-5 (Volkova et al.) explain the efficient recovery of HR events by the ICR and IH assays?

The authors should discuss the previous study concluding that Brc-1 is required for intersister recombination (Adamo et al., 2008). After citing this work in the introduction, the authors ignore this opposite conclusion from the discussion. May be the chromatid fragments in brc-1 msh-4 are products of TMEJ ?

Similarly, Bickel et al. 2010, proposed that Smc-5 is required for homolog-independent (presumably intersister) events. The authors must solve this apparent contradiction. Differences between assays and/or Spo11 vs Mos1 induced breaks or other features should be tested.

The model presented in Figure 5 is not supported by the data which does not allow determining which steps of the reaction are affected beside a support for a resection phenotype from the gene conversion tract analysis. The authors could speculate on the different alternatives for the activities of Brc-1 and Smc-5 (and they are many) but presenting a synthetic model is misleading not coherent with the content of the data. It should be removed. If the authors want to keep this visualization, it should be in supplementary data.

A schematic representation of the key assays: the meiotic progression in the gonad to show the reverse kinetic principle, the ICR and the IH assays as a sup figure would help understanding the data.

We thank the reviewer for this valuable feedback. We have addressed all of these comments in our revised manuscript as well as our responses to the Essential Revisions. In particular, please see our response to Essential Revisions #1, 2 which address most of the major points brought up in the above comments.

Reviewer #2 (Recommendations for the authors):

Importantly, data on sister chromatid repair by CO and non-CO data are both supported by GFP reporter assays as well as by directly observing sister chromatid exchanges of EDU-marked chromatids. Having this said, the reviewer struggled to deduce how the reporter system used, allows for distinguishing CO and non-CO outcomes. Could a Suppl model; Figure showing the detailed intermediates be provided? I did not find this in the original C. elegans paper either.

We thank the reviewer for this suggestion and have added Figure 1 —figure supplement 1 in the revised manuscript to meet this need.

Would it be possible to analyze sister chromatid recombination (proportion of CO versus non-CO outcome as measured by reporter assay) also in brc-1 smc-5 double mutants?

Please see our response to Essential Revision #6.

A weakness in the study is that key phenotypes are only analyzed by one allele of brc1 and smc-5 each. Would it be possible to repeat a key experiment, eg EDU labelling or GFP reporter with a second allele? This way, the possibility of secondary, possibly unlinked mutations contributing to phenotypes can be formally excluded. Nowadays, a simple genome edit (generating a second allele) might do the trick.

Please see our response to Essential Revisions #2.

In the radiation sensitivity assays, would it be possible to also include an analysis of sensitivities of single and double mutants of mitotically proliferating germ cells (before the enter prophase). Such analysis would very much add to our understanding of differential pathway usage of germ cells.

Please see our response to Essential Revisions #7.

Figures 1-3, I think it would be good, wherever possible, in graphs and diagrams (Figure 1a, c, Figure 2a, b, Figure 3 c, d) to show individual data points in addition to error bars.

Please see our response to Essential Revisions #11.

Line (46) Is the statement that the majority of meiotic DSBs are repaired by interhomolog recombination true, also for C. elegans?

While the low frequency of SCE events as seen by Almanzar et al. suggest that intersister repair is not readily engaged in C. elegans meiosis, we acknowledge that the direct proportion of DSBs resolved by IH repair is not known in C. elegans. We have added clarifying text to this sentence (Line 48, 70-71).

Lines 121. I think, for clarity, it would be good to use 'more genetic language. Eg 'the hypersensitivity of smc-5 mutations towards IR is suppressed/bypassed by brc-1 (mutation).

Fixed.

Generally, whenever possible only describe mutant phenotypes, or protein function but not both within a sentence.

We appreciate this suggestion and have implemented it in the revised manuscript.

Line 269 suppl figure 3B. It would be good to precisely refer to the events shown in the text. Eg label (1-5) and refer to (3B.1) 3B.2 etc.

Fixed.

Line 403, Figure 3C and D. Be uniform in what you label as short and long conversion tracks.

We are examining separate classes of recombination events in these panels that display differing properties in a wild type context. Our delineation of short and long tracts reflects these baseline differences in order to facilitate comparisons to mutants that might alter mechanisms of NCO and/or CO gene conversion specifically.

Lines 514, and 515, same as the above comment, line 121.

Fixed.

Page 25 consider rewording. Can the word 'resilience' be avoided?

Fixed.

Eg:.…strains or more sensitive to IR than WT,.. are hypersensitive to IR,.. the IR sensitivity of smc-5 mutants is suppressed by brc-1…

Line 587. 599 can this section be reworded to avoid the word 'normal'? Eg BRC-1 localization did not change upon IR in…..

Fixed.

Are the most important strains for measuring inter-sister and interhomolog recombination deposited in the GCG strain collection?

Please see our response to Essential Revisions #19.

Reviewer #3 (Recommendations for the authors):

As currently written, the manuscript is very focused on C. elegans meiosis. The experiments are generally well done, and the results will be of interest to investigators studying DNA repair and meiotic recombination in C. elegans. However, it is unclear whether the results are unique to C. elegans, and the authors do not give sufficient context to convincingly frame their conclusions as novel or identifying conserved meiotic mechanisms.

At least in the merged PDF of the manuscript, lines 176 and 177 seem out of place, and reading from line 147 (before Figure 1) to line 176 (after Figure 1) does not make sense. I think lines 176-77 should be deleted, but do they belong somewhere else? Also, the first reference to Figure 1A comes later in the text than I would have expected, so I'm not sure if other text was missing that should have been there.

We thank the reviewer for catching this formatting error. The deleted text has been restored in the revised draft.

The ICR and IH assays are so important to this paper that there should be a supplemental figure showing how they work and give different outcomes for CO vs NCO, and where the polymorphisms are. Even though they have been published elsewhere, it would be helpful not to have to find those papers to be able to follow the experiments done here.

We thank the reviewer for this feedback. The relevant recombination assays are now included as Figure 1 —figure supplement 1.

Line 461: How do the doses of IR used affect the number of DSBs or RAD-51 foci? Are these doses expected to increase breaks 2-fold? 10-fold? The experiments are difficult to interpret without knowing how DSB number (or some DSB proxy) changes.

Please see our response to Essential Revisions #7.

As the authors acknowledge, there is substantial variation in viability between the broods of different irradiated (and even unirradiated) hermaphrodites with the same genotype. The cause of this variability is not known. However, it is possible that sperm defects contribute to the variability. Irradiation of young adult hermaphrodites will induce mutations both in the germline nuclei undergoing meiosis and in the several hundred mature sperm made earlier in development. Thus, the "reverse timecourse" following irradiation is capturing both the effects of mutations made at different stages of nuclei undergoing oogenic meiosis and sperm that had already completed meiosis when irradiated. Larval lethality could result from either, and may be revealing how an embryo copes with inheriting damaged DNA from the sperm. It is also formally possible that sperm differences account for the variability observed in unirradiated worms. It is already difficult to compare the data using Mos1 induced breaks to the irradiation data because the assays are completely different. However, the Mos data also presumably is only measuring recombination during oocyte production (i.e. not in sperm), while larval lethality following irradiation is likely measuring damage in sperm as well as during oogenesis. I would recommend mating irradiated hermaphrodites with unirradiated males to simplify the analysis by looking only at consequences of damage that will ultimately affect the oocyte.

Please see our response to Essential Revisions #7.

The irradiation/larval lethality assay was used instead of the ICR/IH assays because "genetically balanced smc-5;brc-1 double mutants can still acquire mutations and become progressively sterile over the course of a few generations" (line 456). From the strain list, it looks like only smc-5 was balanced, but brc-1 was maintained in a homozygous condition. Given the availability of numerous small inversion balancers made by the Mitani lab, it should be possible to balance both loci. This may prevent the accumulation of defects and allow the ICR/IH assays to be done in double mutants. Alternatively, perhaps the degron-tagged smc-5 allele could be used to deplete SMC-5 acutely. If so, this would greatly strengthen the paper.

Please see our response to Essential Revisions #6.

For me, the way the irradiation data are presented calls into question their robustness, or at least suggests that the conclusions are only as good as the mathematical model. I think many of the key results are visible in Supplemental Figure 4A, at least at some doses. As a biology person and not a statistics person, I would find it substantially more convincing to discuss the empirical data first, then bring in the model data to support the empirical data. At the very least, I need better justification for the design of the statistical model and its reliability.

We appreciate this valuable feedback from the reviewer and wish to emphasize that it was not our intent to obscure our results. We agree with and appreciate the feedback that many of the phenotypes we noted are quite clear even from the raw data without any analysis, and have presented the experimental data in Figure 4C and moved our statistical analysis to Figure 4 —figure supplement 3.

The Βeta-Binomial model is commonly employed in statistical analysis of discrete observations, as it accounts for multiple levels of variation that may exist within a given dataset. Binomial distributions describe the incidence of discrete outcomes (e.g. whether the egg laid by a nematode will hatch or not) that occur with a probability of p. In a Βeta-Binomial model, p is not a fixed value and is instead described by a Βeta distribution.

This framework is useful for our analysis, as some DNA repair mutants exhibit high inter-hermaphrodite variation in baseline brood viability (in particular loss-of-function mutants deficient for multiple repair pathways, such as brc-1;polq-1 mutants, as observed both in our study and by Trivedi et al. NAR 2022). In this context, the variance between hermaphrodites can be accounted for by the Βeta distribution in the model, while the proportion of dead progeny that are observed in a given brood is accounted for by the Binomial level of the model. We have taken a Bayesian approach to fitting this model to our data and have estimated values for the parameters of this model that reasonably recapitulate the data we observe and facilitate our inference in the effect of irradiation on brood viability.

Identical data are presented as wild-type controls in several figures (Figures1A and 4A, 1B and 4C, Supplemental Figure 1A and B, and elsewhere). This gives the false impression that each mutant was analyzed in parallel with a wild-type control. However, it is unclear from the text, figure legends, and methods whether any of the experiments were done with parallel controls. In fact, the wild-type dataset was performed once and combined with previous data (line 950). Ideally, wild-type and mutants would be analyzed at the same time, on the same batch of plates, same batch of worm food, and in the same incubator, since meiosis is temperature sensitive, and heat shock genes can be induced by a variety of stressors, including wet plates. If this was not done, the authors should clearly state it in the methods and ideally also in the figure legends, since it is an important point. I also think it would be less confusing, and would potentially make the paper easier to read, if some figures were combined, for example 1A and 4A could be one figure (with a legend stating that multiple replicates were done, but not always in parallel for different genotypes); 1B and 4C could easily be combined.

We thank the reviewer for this feedback. Please see our response to Essential Revisions #14.

Figures 1B and 4C: the N values are given for number of bivalents analyzed. The number for WT seems reasonable, but the numbers for mutants seem small even though this is a somewhat difficult experiment. How many bivalents were analyzed in each oocyte, and how were they chosen? How many oocytes were analyzed? How many animals?

Please see our response to Essential Revision #17.

Figure 3A and C: it is hard to interpret the data showing a statistically significant effect of brc-1 depletion on resection tract length because so many fewer NCO tracts were analyzed in brc-1 than in wt or smc-5 and only one long tract was identified. I guess this would only mean that the magnitude of the effect is being underestimated, not the opposite.

Please see our response to Essential Revisions #18.

No competing interests declared.

Conceptualization, Formal analysis, Investigation, Visualization, Methodology, Writing – original draft, Writing – review and editing.

Investigation, Writing – review and editing.

Investigation, Writing – review and editing.

Investigation.

Investigation.

Investigation.

Supervision, Funding acquisition, Writing – review and editing.

Conceptualization, Formal analysis, Supervision, Funding acquisition, Writing – original draft, Project administration, Writing – review and editing.
==== Refs
References

Adamo A Montemauri P Silva N Ward JD Boulton SJ La Volpe A 2008 BRC-1 acts in the inter-sister pathway of meiotic double-strand break repair EMBO Reports 9 287 292 10.1038/sj.embor.7401167 18219312
Ahuja JS Harvey CS Wheeler DL Lichten M 2021 Repeated strand invasion and extensive branch migration are hallmarks of meiotic recombination Molecular Cell 81 4258 4270 10.1016/j.molcel.2021.08.003 34453891
Almanzar DE Gordon SG Rog O 2021 Meiotic sister chromatid exchanges are rare in C. elegans Current Biology 31 1499 1507 10.1016/j.cub.2020.11.018 33740426
Almanzar DE Hamrick A Rog O 2022 Single-sister labeling in the C. elegans germline using the nucleotide analog EdU STAR Protocols 3 101344 10.1016/j.xpro.2022.101344 35509971
Andrews EA Palecek J Sergeant J Taylor E Lehmann AR Watts FZ 2005 Nse2, a component of the Smc5-6 complex, Is a SUMO ligase required for the response to DNA damage Molecular and Cellular Biology 25 185 196 10.1128/MCB.25.1.185-196.2005 15601841
Aragón L 2018 The Smc5/6 complex: new and old functions of the enigmatic long-distance relative Annual Review of Genetics 52 89 107 10.1146/annurev-genet-120417-031353 30476445
Bergerat A de Massy B Gadelle D Varoutas PC Nicolas A Forterre P 1997 An atypical topoisomerase II from Archaea with implications for meiotic recombination Nature 386 414 417 10.1038/386414a0 9121560
Bessereau JL Wright A Williams DC Schuske K Davis MW Jorgensen EM 2001 Mobilization of a Drosophila transposon in the Caenorhabditis elegans germ line Nature 413 70 74 10.1038/35092567 11544527
Bickel JS Chen L Hayward J Yeap SL Alkers AE Chan RC 2010 Structural maintenance of chromosomes (SMC) proteins promote homolog-independent recombination repair in meiosis crucial for germ cell genomic stability PLOS Genetics 6 e1001028 10.1371/journal.pgen.1001028 20661436
Bonner JN Choi K Xue X Torres NP Szakal B Wei L Wan B Arter M Matos J Sung P Brown GW Branzei D Zhao X 2016 Smc5/6 mediated sumoylation of the Sgs1-Top3-Rmi1 complex promotes removal of recombination intermediates Cell Reports 16 368 378 10.1016/j.celrep.2016.06.015 27373152
Boulton SJ Martin JS Polanowska J Hill DE Gartner A Vidal M 2004 BRCA1/BARD1 orthologs required for DNA repair in Caenorhabditis elegans Current Biology 14 33 39 10.1016/j.cub.2003.11.029 14711411
Cahoon CK Libuda DE 2021 Conditional immobilization for live imaging Caenorhabditis elegans using auxin-dependent protein depletion G3 11 jkab310 10.1093/g3journal/jkab310 34534266
Chakraborty U Alani E 2016 Understanding how mismatch repair proteins participate in the repair/anti-recombination decision FEMS Yeast Research 16 fow071 10.1093/femsyr/fow071 27573382
Chandramouly G Kwok A Huang B Willis NA Xie A Scully R 2013 BRCA1 and CtIP suppress long-tract gene conversion between sister chromatids Nature Communications 4 2404 10.1038/ncomms3404 23994874
Chen L Nievera CJ Lee AYL Wu X 2008 Cell cycle-dependent complex formation of BRCA1·CtIP·MRN Is important for DNA double-strand break repair Journal of Biological Chemistry 283 7713 7720 10.1074/jbc.M710245200 18171670
Chen Y-H Choi K Szakal B Arenz J Duan X Ye H Branzei D Zhao X 2009 Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair PNAS 106 21252 21257 10.1073/pnas.0908258106 19995966
Chung WH Zhu Z Papusha A Malkova A Ira G 2010 Defective resection at DNA double-strand breaks leads to de novo telomere formation and enhances gene targeting PLOS Genetics 6 e1000948 10.1371/journal.pgen.1000948 20485519
Church DL Guan KL Lambie EJ 1995 Three genes of the MAP kinase cascade, mek-2, mpk-1/sur-1 and let-60 ras, are required for meiotic cell cycle progression in Caenorhabditis elegans Development 121 2525 2535 10.1242/dev.121.8.2525 7671816
Colaiácovo MP MacQueen AJ Martinez-Perez E McDonald K Adamo A La Volpe A Villeneuve AM 2003 Synaptonemal complex assembly in C. elegans is dispensable for loading strand-exchange proteins but critical for proper completion of recombination Developmental Cell 5 463 474 10.1016/s1534-5807(03)00232-6 12967565
Cole F Keeney S Jasin M 2010 Comprehensive, fine-scale dissection of homologous recombination outcomes at a hot spot in mouse meiosis Molecular Cell 39 700 710 10.1016/j.molcel.2010.08.017 20832722
Cole F Baudat F Grey C Keeney S de Massy B Jasin M 2014 Mouse tetrad analysis provides insights into recombination mechanisms and hotspot evolutionary dynamics Nature Genetics 46 1072 1080 10.1038/ng.3068 25151354
Copsey A Tang S Jordan PW Blitzblau HG Newcombe S Chan AC-H Newnham L Li Z Gray S Herbert AD Arumugam P Hochwagen A Hunter N Hoffmann E 2013 Smc5/6 coordinates formation and resolution of joint molecules with chromosome morphology to ensure meiotic divisions PLOS Genetics 9 e1004071 10.1371/journal.pgen.1004071 24385939
Crown KN McMahan S Sekelsky J 2014 Eliminating both canonical and short-patch mismatch repair in Drosophila melanogaster suggests a new meiotic recombination model PLOS Genetics 10 e1004583 10.1371/journal.pgen.1004583 25188408
Cruz-García A López-Saavedra A Huertas P 2014 BRCA1 accelerates CtIP-mediated DNA-end resection Cell Reports 9 451 459 10.1016/j.celrep.2014.08.076 25310973
Gartner A Engebrecht JA 2022 DNA repair, recombination, and damage signaling Genetics 220 iyab178 10.1093/genetics/iyab178 35137093
Gelot C Kovacs MT Miron S Mylne E Ghouil R Popova T Dingli F Loew D Guirouilh-Barbat J Del Nery E Zinn-Justin S Ceccaldi R 2023 Polθ Is phosphorylated by polo-like kinase 1 (PLK1) to enable repair of DNA double strand breaks in mitosis bioRxiv 10.1101/2023.03.17.533134
Goldfarb T Lichten M 2010 Frequent and efficient use of the sister chromatid for DNA double-strand break repair during budding yeast meiosis PLOS Biology 8 e1000520 10.1371/journal.pbio.1000520 20976044
Guo X Hum YF Lehner K Jinks-Robertson S 2017 Regulation of hetDNA length during mitotic double-strand break repair in yeast Molecular Cell 67 539 549 10.1016/j.molcel.2017.07.009 28781235
Hariri S Li Q Engebrecht J 2023 53bp1 mutation enhances brca1 and bard1 embryonic lethality in C. elegans microPublication Biol 01 0934 10.17912/micropub.biology.000934
Hayashi M Chin GM Villeneuve AM 2007 C. elegans germ cells switch between distinct modes of double-strand break repair during meiotic prophase progression PLOS Genetics 3 e191 10.1371/journal.pgen.0030191 17983271
Hong Y Sonneville R Agostinho A Meier B Wang B Blow JJ Gartner A 2016 The SMC-5/6 complex and the HIM-6 (BLM) helicase synergistically promote meiotic recombination intermediate processing and chromosome maturation during Caenorhabditis elegans Meiosis PLOS Genetics 12 e1005872 10.1371/journal.pgen.1005872 27010650
Howe M McDonald KL Albertson DG Meyer BJ 2001 HIM-10 is required for kinetochore structure and function on Caenorhabditis elegans holocentric chromosomes The Journal of Cell Biology 153 1227 1238 10.1083/jcb.153.6.1227 11402066
Huen MSY Sy SMH Chen J 2010 BRCA1 and its toolbox for the maintenance of genome integrity Nature Reviews. Molecular Cell Biology 11 138 148 10.1038/nrm2831 20029420
Hum YF Jinks-Robertson S 2017 Mitotic gene conversion tracts associated with repair of a defined double-strand break in Saccharomyces cerevisiae Genetics 207 115 128 10.1534/genetics.117.300057 28743762
Humphryes N Hochwagen A 2014 A non-sister act: recombination template choice during meiosis Experimental Cell Research 329 53 60 10.1016/j.yexcr.2014.08.024 25158281
Hunter N 2015 Meiotic recombination: The essence of heredity Cold Spring Harbor Perspectives in Biology 7 a016618 10.1101/cshperspect.a016618 26511629
Jagut M Hamminger P Woglar A Millonigg S Paulin L Mikl M Dello Stritto MR Tang L Habacher C Tam A Gallach M von Haeseler A Villeneuve AM Jantsch V 2016 Separable roles for a Caenorhabditis elegans RMI1 homolog in promoting and antagonizing meiotic crossovers ensure faithful chromosome inheritance PLOS Biology 14 e1002412 10.1371/journal.pbio.1002412 27011106
Janisiw E Dello Stritto MR Jantsch V Silva N 2018 BRCA1-BARD1 associate with the synaptonemal complex and pro-crossover factors and influence RAD-51 dynamics during Caenorhabditis elegans meiosis PLOS Genetics 14 e1007653 10.1371/journal.pgen.1007653 30383754
Jaramillo-Lambert A Ellefson M Villeneuve AM Engebrecht JA 2007 Differential timing of S phases, X chromosome replication, and meiotic prophase in the C. elegans germ line Developmental Biology 308 206 221 10.1016/j.ydbio.2007.05.019 17599823
Kamp JA van Schendel R Dilweg IW Tijsterman M 2020 BRCA1-associated structural variations are a consequence of polymerase theta-mediated end-joining Nature Communications 11 3615 10.1038/s41467-020-17455-3 32680986
Keelagher RE Cotton VE Goldman ASH Borts RH 2011 Separable roles for Exonuclease I in meiotic DNA double-strand break repair DNA Repair 10 126 137 10.1016/j.dnarep.2010.09.024 21044871
Keeney S Giroux CN Kleckner N 1997 Meiosis-specific DNA double-strand breaks are catalyzed by Spo11, a member of a widely conserved protein family Cell 88 375 384 10.1016/s0092-8674(00)81876-0 9039264
Kim KP Weiner BM Zhang L Jordan A Dekker J Kleckner N 2010 Sister cohesion and structural axis components mediate homolog bias of meiotic recombination Cell 143 924 937 10.1016/j.cell.2010.11.015 21145459
Kritikou EA Milstein S Vidalain P-O Lettre G Bogan E Doukoumetzidis K Gray P Chappell TG Vidal M Hengartner MO 2006 C. elegans GLA-3 is a novel component of the MAP kinase MPK-1 signaling pathway required for germ cell survival Genes & Development 20 2279 2292 10.1101/gad.384506 16912277
Kurhanewicz NA Dinwiddie D Bush ZD Libuda DE 2020 Elevated temperatures cause transposon-associated DNA Damage in C. elegans spermatocytes Current Biology 30 5007 5017 10.1016/j.cub.2020.09.050 33065011
Lee M-H Ohmachi M Arur S Nayak S Francis R Church D Lambie E Schedl T 2007 Multiple functions and dynamic activation of MPK-1 extracellular signal-regulated kinase signaling in Caenorhabditis elegans germline development Genetics 177 2039 2062 10.1534/genetics.107.081356 18073423
Lemmens B Johnson NM Tijsterman M 2013 COM-1 promotes homologous recombination during Caenorhabditis elegans meiosis by antagonizing Ku-mediated non-homologous end joining PLOS Genetics 9 e1003276 10.1371/journal.pgen.1003276 23408909
León-Ortiz AM Panier S Sarek G Vannier J-B Patel H Campbell PJ Boulton SJ 2018 A distinct class of genome rearrangements driven by heterologous recombination Molecular Cell 69 292 305 10.1016/j.molcel.2017.12.014 29351848
Li Q Saito TT Martinez-Garcia M Deshong AJ Nadarajan S Lawrence KS Checchi PM Colaiacovo MP Engebrecht J 2018 The tumor suppressor BRCA1-BARD1 complex localizes to the synaptonemal complex and regulates recombination under meiotic dysfunction in Caenorhabditis elegans PLOS Genetics 14 e1007701 10.1371/journal.pgen.1007701 30383767
Li Q Hariri S Engebrecht J 2020 Meiotic double-strand break processing and crossover patterning are regulated in a sex-specific manner by BRCA1-BARD1 in Caenorhabditis elegans Genetics 216 359 379 10.1534/genetics.120.303292 32796008
Libuda DE Uzawa S Meyer BJ Villeneuve AM 2013 Meiotic chromosome structures constrain and respond to designation of crossover sites Nature 502 703 706 10.1038/nature12577 24107990
Lilienthal I Kanno T Sjögren C 2013 Inhibition of the Smc5/6 complex during meiosis perturbs joint molecule formation and resolution without significantly changing crossover or non-crossover levels PLOS Genetics 9 e1003898 10.1371/journal.pgen.1003898 24244180
Macaisne N Kessler Z Yanowitz JL 2018 Meiotic double-strand break proteins influence repair pathway utilization Genetics 210 843 856 10.1534/genetics.118.301402 30242011
MacQueen AJ Phillips CM Bhalla N Weiser P Villeneuve AM Dernburg AF 2005 Chromosome sites play dual roles to establish homologous synapsis during meiosis in C. elegans Cell 123 1037 1050 10.1016/j.cell.2005.09.034 16360034
Marsolier-Kergoat MC Khan MM Schott J Zhu X Llorente B 2018 Mechanistic view and genetic control of DNA recombination during meiosis Molecular Cell 70 9 20 10.1016/j.molcel.2018.02.032 29625041
McVey M Larocque JR Adams MD Sekelsky JJ 2004 Formation of deletions during double-strand break repair in Drosophila DmBlm mutants occurs after strand invasion PNAS 101 15694 15699 10.1073/pnas.0406157101 15501916
Medhi D Goldman ASH Lichten M 2016 Local chromosome context is a major determinant of crossover pathway biochemistry during budding yeast meiosis eLife 5 e19669 10.7554/eLife.19669 27855779
Meier B Volkova NV Hong Y Bertolini S González-Huici V Petrova T Boulton S Campbell PJ Gerstung M Gartner A 2021 Protection of the C. elegans germ cell genome depends on diverse DNA repair pathways during normal proliferation PLOS ONE 16 e0250291 10.1371/journal.pone.0250291 33905417
Nadarajan S Mohideen F Tzur YB Ferrandiz N Crawley O Montoya A Faull P Snijders AP Cutillas PR Jambhekar A Blower MD Martinez-Perez E Harper JW Colaiacovo MP 2016 The MAP kinase pathway coordinates crossover designation with disassembly of synaptonemal complex proteins during meiosis eLife 5 e12039 10.7554/eLife.12039 26920220
Odiba AS Ezechukwu CS Liao G Hong Y Fang W Jin C Gartner A Wang B 2024 SMC-5/6 complex subunit NSE-1 plays a crucial role in meiosis and DNA repair in Caenorhabditis elegans DNA Repair 137 103669 10.1016/j.dnarep.2024.103669 38507953
Pâques F Haber JE 1999 Multiple pathways of recombination induced by double-strand breaks in Saccharomyces cerevisiae Microbiology and Molecular Biology Reviews 63 349 404 10.1128/MMBR.63.2.349-404.1999 10357855
Peng XP Lim S Li S Marjavaara L Chabes A Zhao X 2018 Acute Smc5/6 depletion reveals its primary role in rDNA replication by restraining recombination at fork pausing sites PLOS Genetics 14 e1007129 10.1371/journal.pgen.1007129 29360860
Pradhan B Kanno T Igarashi MU Baaske MD Kei Wong JS Jeppsson K Björkegren C Kim E 2022 The Smc5/6 complex Is a DNA loop extruding motor bioRxiv 10.1101/2022.05.13.491800
Preibisch S Saalfeld S Tomancak P 2009 Globally optimal stitching of tiled 3D microscopic image acquisitions Bioinformatics 25 1463 1465 10.1093/bioinformatics/btp184 19346324
Ramsden DA Carvajal-Garcia J Gupta GP 2022 Mechanism, cellular functions and cancer roles of polymerase-theta-mediated DNA end joining Nature Reviews. Molecular Cell Biology 23 125 140 10.1038/s41580-021-00405-2 34522048
Robert V Bessereau JL 2007 Targeted engineering of the Caenorhabditis elegans genome following Mos1-triggered chromosomal breaks The EMBO Journal 26 170 183 10.1038/sj.emboj.7601463 17159906
Robert VJ Davis MW Jorgensen EM Bessereau JL 2008 Gene conversion and end-joining-repair double-strand breaks in the Caenorhabditis elegans germline Genetics 180 673 679 10.1534/genetics.108.089698 18757928
Rosu S Libuda DE Villeneuve AM 2011 Robust crossover assurance and regulated interhomolog access maintain meiotic crossover number Science 334 1286 1289 10.1126/science.1212424 22144627
Schaub JM Soniat MM Finkelstein IJ 2022 Polymerase theta-helicase promotes end joining by stripping single-stranded DNA-binding proteins and bridging DNA ends Nucleic Acids Research 50 3911 3921 10.1093/nar/gkac119 35357490
Schindelin J Arganda-Carreras I Frise E Kaynig V Longair M Pietzsch T Preibisch S Rueden C Saalfeld S Schmid B Tinevez J-Y White DJ Hartenstein V Eliceiri K Tomancak P Cardona A 2012 Fiji: an open-source platform for biological-image analysis Nature Methods 9 676 682 10.1038/nmeth.2019 22743772
Schvarzstein M Pattabiraman D Libuda DE Ramadugu A Tam A Martinez-Perez E Roelens B Zawadzki KA Yokoo R Rosu S Severson AF Meyer BJ Nabeshima K Villeneuve AM 2014 DNA helicase HIM-6/BLM both promotes MutSγ-dependent crossovers and antagonizes MutSγ-independent interhomolog associations during Caenorhabditis elegans meiosis Genetics 198 193 207 10.1534/genetics.114.161513 25053665
Schwacha A Kleckner N 1994 Identification of joint molecules that form frequently between homologs but rarely between sister chromatids during yeast meiosis Cell 76 51 63 10.1016/0092-8674(94)90172-4 8287479
Schwacha A Kleckner N 1997 Interhomolog bias during meiotic recombination: meiotic functions promote a highly differentiated interhomolog-only pathway Cell 90 1123 1135 10.1016/s0092-8674(00)80378-5 9323140
Stan Development Team 2021 RStan: the R interface to stan 0.1 RStan https://mc-stan.org/
Szostak JW Orr-Weaver TL Rothstein RJ Stahl FW 1983 The double-strand-break repair model for recombination Cell 33 25 35 10.1016/0092-8674(83)90331-8 6380756
Toraason E Adler VL Kurhanewicz NA DiNardo A Saunders AM Cahoon CK Libuda DE 2021a Automated and customizable quantitative image analysis of whole Caenorhabditis elegans germlines Genetics 217 iyab010 10.1093/genetics/iyab010 33772283
Toraason E Glover M Horacek A Libuda DE 2021b Detection of homolog-independent meiotic DNA repair events in C. elegans with the intersister/intrachromatid repair assay STAR Protocols 2 100801 10.1016/j.xpro.2021.100801 34527958
Toraason E Horacek A Clark C Glover ML Adler VL Premkumar T Salagean A Cole F Libuda DE 2021c Meiotic DNA break repair can utilize homolog-independent chromatid templates in C. elegans Current Biology 31 1508 1514 10.1016/j.cub.2021.03.008 33740427
Toraason E Adler VL Kurhanewicz NA DiNardo A Saunders AM Cahoon CK Libuda DE 2021d Software name of the R script 40ff223 Github https://github.com/libudalab/Gonad-Analysis-Pipeline
Trivedi S Blazícková J Silva N 2022 PARG and BRCA1-BARD1 cooperative function regulates DNA repair pathway choice during gametogenesis Nucleic Acids Research 50 12291 12308 10.1093/nar/gkac1153 36478097
Tzur YB Winter E Gao J Hashimshony T Yanai I Colaiácovo MP 2018 Spatiotemporal gene expression analysis of the Caenorhabditis elegans germline uncovers a syncytial expression switch Genetics 210 587 605 10.1534/genetics.118.301315 30093412
van Schendel R Roerink SF Portegijs V van den Heuvel S Tijsterman M 2015 Polymerase Θ is a key driver of genome evolution and of CRISPR/Cas9-mediated mutagenesis Nature Communications 6 7394 10.1038/ncomms8394 26077599
Volkova NV Meier B González-Huici V Bertolini S Gonzalez S Vöhringer H Abascal F Martincorena I Campbell PJ Gartner A Gerstung M 2020 Mutational signatures are jointly shaped by DNA damage and repair Nature Communications 11 2169 10.1038/s41467-020-15912-7 32358516
Wang S Meyer DH Schumacher B 2023 Inheritance of paternal DNA damage by histone-mediated repair restriction Nature 613 365 374 10.1038/s41586-022-05544-w 36544019
Weinert BT Rio DC 2007 DNA strand displacement, strand annealing and strand swapping by the Drosophila Bloom’s syndrome helicase Nucleic Acids Research 35 1367 1376 10.1093/nar/gkl831 17272294
Wickham H Averick M Bryan J Chang W McGowan L François R Grolemund G Hayes A Henry L Hester J Kuhn M Pedersen T Miller E Bache S Müller K Ooms J Robinson D Seidel D Spinu V Takahashi K Vaughan D Wilke C Woo K Yutani H 2019 Welcome to the tidyverse Journal of Open Source Software 4 1686 10.21105/joss.01686
Wolters S Ermolaeva MA Bickel JS Fingerhut JM Khanikar J Chan RC Schumacher B 2014 Loss of Caenorhabditis elegans BRCA1 promotes genome stability during replication in smc-5 mutants Genetics 196 985 999 10.1534/genetics.113.158295 24424777
Xaver M Huang L Chen D Klein F 2013 Smc5/6-Mms21 prevents and eliminates inappropriate recombination intermediates in meiosis PLOS Genetics 9 e1004067 10.1371/journal.pgen.1004067 24385936
Yin Y Smolikove S 2013 Impaired resection of meiotic double-strand breaks channels repair to nonhomologous end joining in Caenorhabditis elegans Molecular and Cellular Biology 33 2732 2747 10.1128/MCB.00055-13 23671188
Yokoo R Zawadzki KA Nabeshima K Drake M Arur S Villeneuve AM 2012 COSA-1 reveals robust homeostasis and separable licensing and reinforcement steps governing meiotic crossovers Cell 149 75 87 10.1016/j.cell.2012.01.052 22464324
Zakharyevich K Ma Y Tang S Hwang PYH Boiteux S Hunter N 2010 Temporally and biochemically distinct activities of Exo1 during meiosis: double-strand break resection and resolution of double Holliday junctions Molecular Cell 40 1001 1015 10.1016/j.molcel.2010.11.032 21172664
Zhang L Ward JD Cheng Z Dernburg AF 2015 The auxin-inducible degradation (AID) system enables versatile conditional protein depletion in C. elegans Development 142 4374 4384 10.1242/dev.129635 26552885
Zhang L Stauffer WT Wang JS Wu F Yu Z Liu C Kim HJ Dernburg AF 2023 Recruitment of Polo-like kinase couples synapsis to meiotic progression via inactivation of CHK-2 eLife 12 e84492 10.7554/eLife.84492 36700544
Zhao W Steinfeld JB Liang F Chen X Maranon DG Jian Ma C Kwon Y Rao T Wang W Sheng C Song X Deng Y Jimenez-Sainz J Lu L Jensen RB Xiong Y Kupfer GM Wiese C Greene EC Sung P 2017 BRCA1–BARD1 promotes RAD51-mediated homologous DNA pairing Nature 550 360 365 10.1038/nature24060 28976962
Zhu L Fernández-Jiménez N Szymanska-Lejman M Pelé A Underwood CJ Serra H Lambing C Dluzewska J Bieluszewski T Pradillo M Henderson IR Ziolkowski PA 2021 Natural variation identifies SNI1, the SMC5/6 component, as a modifier of meiotic crossover inArabidopsis PNAS 118 e2021970118 10.1073/pnas.2021970118 34385313
