
==== Front
Nat Struct Mol Biol
Nat Struct Mol Biol
Nature Structural & Molecular Biology
1545-9993
1545-9985
Nature Publishing Group US New York

38326650
1206
10.1038/s41594-023-01206-1
Article
Mechanism of millisecond Lys48-linked poly-ubiquitin chain formation by cullin-RING ligases
http://orcid.org/0000-0002-8341-8466
Liwocha Joanna 1
http://orcid.org/0000-0003-4036-2471
Li Jerry 2
Purser Nicholas 2
Rattanasopa Chutima 2
Maiwald Samuel 1
Krist David T. 1
Scott Daniel C. 3
Steigenberger Barbara 4
http://orcid.org/0000-0002-7726-9310
Prabu J. Rajan 1
http://orcid.org/0000-0002-3083-1126
Schulman Brenda A. schulman@biochem.mpg.de

1
http://orcid.org/0000-0003-3924-1680
Kleiger Gary gary.kleiger@unlv.edu

12
1 https://ror.org/04py35477 grid.418615.f 0000 0004 0491 845X Department of Molecular Machines and Signaling, Max Planck Institute of Biochemistry, Martinsried, Germany
2 grid.272362.0 0000 0001 0806 6926 Department of Chemistry and Biochemistry, University of Nevada, Las Vegas, Las Vegas, NV USA
3 https://ror.org/02r3e0967 grid.240871.8 0000 0001 0224 711X Department of Structural Biology, St. Jude Children’s Research Hospital, Memphis, TN USA
4 https://ror.org/04py35477 grid.418615.f 0000 0004 0491 845X Mass Spectrometry Core Facility, Max Planck Institute of Biochemistry, Martinsried, Germany
7 2 2024
7 2 2024
2024
31 2 378389
7 8 2023
21 12 2023
© The Author(s) 2024
https://creativecommons.org/licenses/by/4.0/ Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/.
E3 ubiquitin ligases, in collaboration with E2 ubiquitin-conjugating enzymes, modify proteins with poly-ubiquitin chains. Cullin-RING ligase (CRL) E3s use Cdc34/UBE2R-family E2s to build Lys48-linked poly-ubiquitin chains to control an enormous swath of eukaryotic biology. Yet the molecular mechanisms underlying this exceptional linkage specificity and millisecond kinetics of poly-ubiquitylation remain unclear. Here we obtain cryogenic-electron microscopy (cryo-EM) structures that provide pertinent insight into how such poly-ubiquitin chains are forged. The CRL RING domain not only activates the E2-bound ubiquitin but also shapes the conformation of a distinctive UBE2R2 loop, positioning both the ubiquitin to be transferred and the substrate-linked acceptor ubiquitin within the active site. The structures also reveal how the ubiquitin-like protein NEDD8 uniquely activates CRLs during chain formation. NEDD8 releases the RING domain from the CRL, but unlike previous CRL–E2 structures, does not contact UBE2R2. These findings suggest how poly-ubiquitylation may be accomplished by many E2s and E3s.

The authors define a NEDD8-activated cullin-RING E3 poly-ubiquitylation mechanism using chemistry, cryo-EM and rapid kinetics. Near-perfect catalytic efficiency is achieved by an E2 ‘synergy loop’ connecting to the E3, donor and acceptor ubiquitins.

Subject terms

Cryoelectron microscopy
Ubiquitin ligases
Enzyme mechanisms
Ubiquitylation
Ubiquitylation
issue-copyright-statement© Springer Nature America, Inc. 2024
==== Body
pmcMain

The enzymatic assembly of poly-ubiquitin chains onto protein substrates is a defining feature of eukaryotic cell biology. Ubiquitin chain formation determines the fates of substrates; for instance, by affecting the cellular localization of the modified protein, or in many cases, eliciting degradation by the 26S proteasome1. Poly-ubiquitin chains are forged during the covalent joining of a ubiquitin bound to a protein substrate with an enzyme-activated ubiquitin. Ubiquitin is a highly conserved protein containing seven lysine residues that all may serve as linkage points for poly-ubiquitin chains2. Nonetheless, Lys48 appears to be of particular importance, as it is the only ubiquitin lysine residue required for viability in yeast3 and has consistently been identified as the most abundant poly-ubiquitin chain linkage type in cells derived from a variety of organisms4, including humans5. As such, it is of great importance to elucidate the enzymatic mechanisms of Lys48-specific poly-ubiquitin chain formation.

Cdc34/UBE2R-family E2s are highly specialized in forging ubiquitin chains with Lys48-linkages that elicit 26S proteasome-dependent protein degradation2,6. Yeast Cdc34 was amongst the first components of the ubiquitin system identified7, and its essentiality for the cell division cycle helped guide the discovery of its partner E3s as CRLs8–10. CRL and Cdc34/UBE2R-catalyzed poly-ubiquitylation control gene expression, metabolism, signaling, protein trafficking, targeted protein degradation and more11,12. Therefore, it is important to understand how CRLs, together with UBE2R-type E2s, poly-ubiquitylate substrates.

CRLs are a large family of modular multi-subunit complexes, with approximately 300 members in humans. CRLs recruit substrate ‘degron’ motifs that bind to a specific substrate receptor module. Numerous distinct substrate receptors bind interchangeably to core cullin-RING modules. For example, F-box proteins are substrate receptors that function with the cullin-RING module CUL1–RBX1. Foundational F-box proteins include FBXW7 and βTRCP, which control the degradation of numerous oncoproteins, such as cyclin E and c-Myc, or β-catenin and IκBα, respectively13. Meanwhile, BC-box proteins are substrate receptors that function with CUL2–RBX1 (ref. 14). Well-characterized BC-box proteins include VHL and FEM1C, which regulate hypoxia-induced degradation of HIF1α15 or recognize protein carboxyl termini as degrons in the nucleotide exchange factor SIL1 (refs. 16–18), respectively.

To poly-ubiquitylate their substrates, CRLs must partner with ubiquitin-carrying enzymes, which typically specialize in either ‘priming’—that is, directly modifying substrate—or ‘extending’ ubiquitin chains. Notably, Cdc34/UBE2R-family E2s are specialized in the latter category and add ubiquitin molecules to primed CRL substrates at a millisecond time scale19. This ultra-rapid formation of Lys48-linked chains presumably drives the timely degradation of CRL substrates. These ubiquitylation events are activated by NEDD8 modification of the cullin subunit20. Although structures with various substrates and distinct ubiquitin-carrying enzymes have defined how NEDD8-modified, CUL1-based CRLs catalyze priming21,22, the mechanisms of poly-ubiquitylation remain elusive.

Prior studies have suggested that CRL-catalyzed ubiquitin chain formation with UBE2R-family E2s differs from the well-studied priming reactions; for example, as mediated by E2s in the UBE2D family. For instance, CRLs are the only genetically validated E3 partners of Cdc34 and UBE2R-family E2s23,24. By contrast, UBE2D-family E2s are exceptionally promiscuous and function with a large fraction of all E3s characterized to date25. A second difference concerns the hallmark feature of most ubiquitin ligases, the RING domain26,27, which serves as the catalytic entity of CRLs. RING domains typically function by allosterically activating ubiquitylation by facilitating close contact between E2 and its covalently bound ubiquitin (hereafter E2~ubiquitin, where the '~' represents or mimics an activated state, or donor ubiquitin). Unlike UBE2D-family E2s, Cdc34/UBE2R-family E2s activate donor ubiquitin in the so-called ‘closed’ conformation even in the absence of E3 (refs. 28,29). Cdc34/UBE2R can thus forge unanchored ubiquitin chains in an E3-independent manner, albeit relatively slowly30. Ubiquitin chain formation by Cdc34/UBE2R-family E2s is accelerated by one to two orders of magnitude in the presence of a CRL31. This demonstrates the crucial catalytic role of the E3 but raises the question of how this is achieved.

Amino acid sequences of the Cdc34/UBE2R-family are unique amongst E2s, with a 16-residue insertion in the catalytic UBC domain and an acidic C-terminal tail32–39. The insertion is essential for yeast viability36,37 and achieving millisecond rates of poly-ubiquitylation33, but its function is not explained by any prior structure. The acidic tail dynamically binds to a basic canyon on the cullin40,41 and helps to form the closed conformation with donor ubiquitin even in the absence of E3 (ref. 29).

Another feature that remains the subject of debate is the function of the ubiquitin-like protein NEDD8, the primary activator of CRLs in cells. NEDD8 activates CRL substrate priming by directly binding a UBE2D~ubiquitin22,42. NEDD8 also activates ubiquitin chain extension and reduces the Michaelis–Menten constant (Km) of UBE2R-family E2s43. However, deletion of the domain containing the neddylation site on CUL1 stimulated the activity of a UBE2R-family E2 though in a crude system44, implying differences in NEDD8 function during priming and chain extension.

To date, no human RING-based E3 had been visualized during poly-ubiquitylation of an E3-bound substrate to promote Lys48-specific ubiquitin chains or any other chain type. Given the biological importance of Cdc34/UBE2R E2s and CRLs and owing to their unique and yet perplexing catalytic elements, we determined the structural basis for their millisecond production of Lys48-linked ubiquitin chains.

Results

Cryo-EM structure showing CRL substrate poly-ubiquitylation

We sought to determine a cryo-EM structure of a neddylated CRL20 with UBE2R2~ubiquitin poised to modify a ubiquitin-primed substrate. Given that structure determination is an empirical endeavor, several distinct CRL complexes were tested. The highest resolution maps were obtained with CRL2FEM1C (containing neddylated CUL2–RBX1 and substrate receptor Elongin B/C–FEM1C16–18; Fig. 1a). As the transition state for poly-ubiquitylation is fleeting, a ligation mimic was used to join acceptor ubiquitin fused to a C-terminal degron peptide substrate (Sil1) with donor ubiquitin and eventual cross-linking to the UBE2R2 active site (Fig. 1b and Extended Data Fig. 1a). The structure resolved to 3.8 Å resolution (Fig. 1c–e, Extended Data Figs. 1 and 2, Table 1 and Supplementary Video 1) and enabled rationalization of poly-ubiquitylation on the millisecond time scale.Fig. 1 High-resolution cryo-EM structure of a CRL promoting poly-ubiquitylation.

a, Schematic representation for all protein subunits used to form the chain formation complex for cryo-EM. b, Diagram comparing the native transition-state geometry for UBE2R2-dependent chaining with a stabilized ubiquitin-chain forming architecture. The ligation mimic consists of a peptide substrate (S; red hexagon) fused to a K48C acceptor ubiquitin (UBA; light orange circle) crosslinked to donor ubiquitin (UBD; dark orange circle), followed by reaction with the UBE2R2 active site cysteine. c, Various orientations of the DeepEMhancer composite cryo-EM map representing the structure. Electron density for each subunit has been colored according to the schematic in a. d, Cryo-EM maps highlighting the cullin scaffold (left) and the substrate receptor complex (right). e, Cryo-EM map showing the catalytic core containing UBE2R2, UBD, UBA and RBX1. ELOB, Elongin B; ELOC, Elongin C.

Table 1 Cryo-EM data collection, refinement and validation statistics

Ligation mimic
UBE2R2
NEDD8
CRL	Yes
Yes
Yes
CRL2FEM1C
(EMD-17803)
(EMD-17822)
(PDB 8PQL)	Yes
Yes
Yes
CRL2VHL-MZ1
(EMD-18767)	Yes
Yes
Yes
CRL1FBXW7
(EMD-17802)	No
No
No
CRL2FEM1C
Map1 Map2
(Map1: EMD-17798) (Map2: EMD-17799)	No
No
Yes
CRL2FEM1C
Map1 Map2
(Map1: EMD-17800)
(Map2: EMD-17801)	
Data collection and processing	
Microscope	Krios	Krios	Glacios	Glacios	Glacios	
Magnification	130,000	130,000	22,000	22,000	22,000	
Voltage (kV)	300	300	200	200	200	
Electron exposure (e–/Å2)	66	66	59	60	60	
Defocus range (μm)	−0.6 ∼ −2.2	-0.6 ∼ −2.2	−0.6 ∼ −2.6	−0.6 ∼ −2.6	−0.6 ∼ −2.6	
Pixel size (Å)	0.8512	0.8512	1.885	1.885	1.885	
Symmetry imposed	C1	C1	C1	C1	C1	
Initial particle images (no.)	4,187,858	1,210,530	2,989,541	2,801,309	2,963,610	
Final particle images (no.)	61,956*	12,520	65,467	56,038	38,547	51,322	28,677	
Map resolution (Å)

FSC threshold

	3,76**

(0,143)

	7,5

(0,143)

	8,1

(0,143)

	7,72

(0,143)

	7,54

(0,143)

	7,19

(0,143)

	6,88

(0,143)

	
Map resolution range (Å)	−	−	−	−	−	−	−	
Refinement	
Initial model used (PDB code)	5N4W

6NYO

6TTU

6LBN

							
Model resolution (Å)

FSC threshold

	3.8

(0.143)

							
Model resolution range (Å)								
Map sharpening B factor (Å2)	−70***	−160	−350	−250	−300	−300	−150	
Model composition	
   Non-hydrogen atoms	13554							
   Protein residues	1837							
   Ligands	3(ZN)							
B factors (Å2)	
    Protein	77.63							
    Ligand	92.01							
R.m.s. deviations	
    Bond lengths (Å)	0.004							
    Bond angles (°)	0.729							
Validation	
    MolProbity score	1.96							
    Clashscore	7.85							
    Poor rotamers (%)	0.38							
Ramachandran plot	
    Favored (%)	90.54							
    Allowed (%)	9.46							
    Disallowed (%)	0.00							
*Consensus map: 61,956; focused map 1: 61,956; focused map 2,3: 52,377; focused map 4,5: 55,024 particles

**Consensus map: Consensus map: 3.76Å; focused map 1: 3.55Å; focused map 2: 3.76Å; focused map 3: 3.89Å; focused map 4: 3.89Å; focused map 5: 3.84Å

***Consensus map: -70; focused map 1: -60; focused map 2: -80; focused map 3: -50; focused map 4: -70; focused map 5: -60

The individual components observed in previous structures matched expectations. For example, (1) the amino-terminal side of CUL2 binds the substrate receptor complex, while its C-terminal side interacts with the RBX1 subunit harboring the RING domain that recruits E2s45 (Fig. 1c); (2) the UBE2R2 catalytic UBC domain and C-terminal extension both participate in forming the closed conformation for the UBE2R2~ubiquitin conjugate28,29,46–49; and (3) the acceptor ubiquitin and the UBE2R2 UBC domain interact (Fig. 1e). Interestingly, NEDD8 is not visible in the cryo-EM map.

Despite the seeming similarity to prior structures, there are two striking differences that explain how CRLs activate extension of Lys48-linked ubiquitin chains. First, the conformation of the UBE2R2~ubiquitin intermediate shows significant rearrangement compared to the prior crystal structure that lacked an E3 (ref. 29) and contained an inhibitor that prevents the discharge of ubiquitin from a UBE2R-family E2 active site50,51 (Extended Data Fig. 3a). However, the UBE2R2~ubiquitin structure here was highly similar to an E2~ubiquitin bound to RING adopting the closed conformation47 (Extended Data Fig. 3b). Morphing between the E3-free and bound UBE2R2~ubiquitin conformations allows for visualizing CRL-dependent alignment into the activated conformation (Supplementary Video 2). These results are consistent with a model in which the inhibitor may block poly-ubiquitylation by securing donor ubiquitin against the E2 UBC domain in a closed yet inactive conformation. Second, these differences occur concomitantly with the organization of the distinctive Cdc34/UBE2R-family E2 insertion (His98–Arg113), forming a loop that is the heart of the complex. Multiple loop residues hover near the UBE2R2 active site, including His98 (which has been shown to be critical for UBE2R2 biochemical activity and for yeast viability32). The structure confirms the importance of His98, with its imidazole ring residing directly across from Cys93, the key active site residue that becomes thioesterified to donor ubiquitin (Extended Data Fig. 1b). Contrary to expectations, the E2 insertion, commonly referred to as the acidic loop, did not contact basic patches on neighboring subunits. Rather, the loop residues unify the E2, E3 and the ubiquitins to be adjoined into a cohesive functional unit (Fig. 1e, inset). We thus rename this insertion sequence ‘synergy loop’.

Molecular synergy promotes millisecond poly-ubiquitylation

Multiple interactions between the UBE2R2 synergy loop and RBX1 facilitate shaping the loop’s conformation, which in turn forms interfaces with both the donor and acceptor ubiquitins (Fig. 2a). Conserved residues of the synergy loop radiate outward to interact with the other components involved in poly-ubiquitylation (Extended Data Fig. 3c,d and Supplementary Video 3). Additionally, at least three residues internally organize the loop conformation (Asp102, Glu108 and Arg113; Fig. 2b). To ascertain how these interactions may affect UBE2R2 activity, various mutant UBE2R2 proteins were assayed for the neddylated CRL-dependent formation of unanchored poly-ubiquitin chains33,38 (Extended Data Fig. 3e). In brief, UBE2R2 is first thioesterified to radio-labeled donor ubiquitin (the N-terminal tag that promotes labeling through phosphorylation was shown to not affect UBE2R2 activity; Extended Data Fig. 3f), followed by the addition of unlabeled acceptor ubiquitin and CRL. Indeed, the mutation of synergy loop residues located at each interface led to the impairment of poly-ubiquitin chain formation (Extended Data Fig. 3g).Fig. 2 CRL shaping of UBE2R2’s synergy loop promotes millisecond poly-ubiquitylation by stabilizing donor and acceptor ubiquitins.

a, Ribbon diagram and cryo-EM density of the catalytic core, highlighting stabilizing interfaces between UBE2R2’s synergy loop and the CRL subunit RBX1 (e), donor ubiquitin (UBD) (c) and acceptor ubiquitin (UBA) (d). b, Catalytic core cryo-EM density showing a close-up view of Asp102, Glu108 and Arg113 within the interaction hub. Subunits have been colored as in a. c, Same as in b, but showing proximity between residues Ser106 and Glu112 in the loop and Arg74 and Arg72 in the donor ubiquitin, respectively. d, Same as in b, but highlighting the interaction between residue Asp103 in the loop and His68 in the acceptor ubiquitin. e, Same as in b, but showing the interaction between residue Glu108 in the synergy loop and Arg91 in RBX1. f, Bar graph comparing the Km values of unanchored acceptor ubiquitin for UBE2R2 and with WT or mutant proteins. Bars showing a ‘>ʼ reflect reactions in which saturation of UBE2R2 with acceptor ubiquitin was not possible (the top concentration in the dilution series is shown). The value of each bar represents the estimated value for Km based on n = 3 technical replicates.

Source data

The UBE2R2 synergy loop helps integrate the donor and acceptor ubiquitins into the catalytic conformation. The Ser106 and Glu112 in UBE2R2 point toward the C-terminal tail in the donor ubiquitin (Fig. 2c). Across from the donor, Asp103 in UBE2R2 points toward His68 in the acceptor ubiquitin (Fig. 2d), which presumably helps place Lys48 into the UBE2R2 active site. Mutation of both interfaces, as well as the loop organizing residues, resulted in higher Km values of unanchored acceptor ubiquitin for the UBE2R2-mediated poly-ubiquitylation complex (Fig. 2f, Extended Data Fig. 4a,b and Table 2).Table 2 Estimates of Km and kobs for neddylated CRL2*-mediated poly-ubiquitin chain formation

UBAa	UBDb	UBE2Rc	RBX1	Kmd (µM)	Fold change (Km)	kobsS1-S2 (s−1)	Fold change (kobs)	
WT	K48R	WT (R2)	WT	111.33 ± 7.58	–	45.55 ± 2.88	–	
WT	K48R	WT (R1)	WT	310.77 ± 43.37	–	33.60 ± 1.68	–	
Interface 1: synergy loop–UBA	
H68A	K48R	WT (R2)	WT	815.48 ± 70.88	7.3	64.37 ± 2.71	0.71	
R54D	K48R	WT (R2)	WT	>800	>7	17.02 ± 0.96	2.7	
N60R	K48R	WT (R2)	WT	200.45 ± 21.71	1.8	–	–	
WT	K48R	D143K (R2)	WT	1,261.60 ± 132.41	11.3	27.01 ± 1.03	1.7	
WT	K48R	R149D (R2)	WT	>1,200	>10	29.40 ± 1.41	1.5	
R54D	K48R	D143K (R2)	WT	334.51 ± 59.99	3	31.68 ± 1.49	1.4	
N60R	K48R	R149D (R2)	WT	269.36 ± 28.66	2.4	38.32 ± 2.30	1.2	
WT	K48R	D103A (R2)	WT	563.97 ± 99.14	5.1	31.67 ± 1.02	1.4	
Interface 2: synergy loop–synergy loop	
WT	K48R	D102A (R2)	WT	147.66 ± 8.03	1.3	24.94 ± 1.35	1.8	
WT	K48R	R113A (R2)	WT	>1,000	>9	24.71 ± 3.24	1.8	
WT	K48R	R113A (R1)	WT	>1,200	>4	22.15 ± 0.87	1.5	
Interface 3: synergy loop–UBD	
WT	K48R	S106A (R2)	WT	384.62 ± 48.04	3.5	–	–	
WT	K48R	S106R (R2)	WT	>1,000	>9	16.84 ± 1.40	2.7	
WT	K48R	E112A (R2)	WT	>1,000	>9	11.61 ± 1.01	3.9	
WT	K48R/R74E	WT (R2)	WT	1,667.90 ± 180.82	15.0	21.37 ± 0.74	2.1	
WT	K48R/R74E	WT (R1)	WT	>1,200	>4	22.91 ± 1.91	1.5	
Interface 4: synergy loop–RING domain	
WT	K48R	E108A (R2)	WT	>1,000	>9	13.18 ± 1.50	3.5	
WT	K48R	E108A (R1)	WT	>1,200	>4	15.29 ± 0.66	2.2	
WT	K48R	E108R (R2)	WT	>1,200	>10	5.17 ± 0.21	8.8	
WT	K48R	WT (R2)	R91E	>1,680	>15	24.67 ± 1.59	1.8	
WT	K48R	WT (R1)	R91E	>1,200	>4	8.92 ± 0.62	3.8	
Interface 5: multiple interfaces	
WT	K48R	D102A/103A (R2)	WT	924.45 ± 126.37	8.3	16.21 ± 0.73	2.8	
WT	K48R	E108/112A (R2)	WT	>1,200	>10	4.23 ± 0.14	10.8	
R54D	K48R	E108A (R2)	WT	>800	>7	0.89 ± 0.06	51.2	
R54D	K48R	E108A (R1)	WT	>800	>2.5	0.68 ± 0.06	49.4	
WT	K48R/R74E	E108A (R2)	WT	>1,200	>10	3.68 ± 0.33	12.4	
*Experiments estimating kobs included Elongin B/C–FEM1C and Sil1-ubiquitin substrate; aAcceptor ubiquitin; refers to either unanchored ubiquitin for Km (D77 ubiquitin; see Methods) or conjugated to Sil1 peptide (kobs); bDonor ubiquitin; cUBE2R1 and UBE2R2 paralogs are denoted as (R1) and (R2), respectively; dKm of unanchored acceptor ubiquitin for UBE2R2, ‘>’ denotes the highest concentration of the dilution series in cases for which Km could not be estimated; S1, Sil1-ubiquitin; S2, Sil1-ubiquitin2. The standard error of measurements are shown for all estimates.

UBE2R2’s synergy loop mediates activation by the E3. A unique E2–E3 interface is formed between the synergy loop and the RBX1 RING domain, stabilized by Glu108 in UBE2R2 and Arg91 in RBX1 (Fig. 2e). Accordingly, neddylated CRL-dependent UBE2R2 activation was impaired by an R91E mutation (Extended Data Fig. 4c,d). This also weakened the apparent affinity of unanchored acceptor ubiquitin for UBE2R2 in the presence of neddylated CUL2–RBX1 (Fig. 2f, Extended Data Fig. 4b and Table 2).

UBE2R2 shares extensive sequence and functional similarity with its paralogous human E2 UBE2R1 (Extended Data Fig. 3c). To test for conservation of the interfaces observed in the structure, UBE2R1 synergy loop mutants were assayed with neddylated CRL2FEM1C, while wild-type (WT) UBE2R1 was assayed with previously described mutations in the RING domain or donor ubiquitin (for the latter, controls were performed to ensure comparable UBE2R1 and UBE2R2 loading for WT and mutant ubiquitins; Extended Data Fig. 4e). Like UBE2R2, these mutations all resulted in significant increases in the Km values of unanchored acceptor ubiquitin for UBE2R1-catalyzed ubiquitin chain formation (Extended Data Fig. 4f and Table 2).

Intricate placement of Lys48 into the UBE2R2 active site

The UBE2R2 catalytic UBC domain also recruits the acceptor ubiquitin through residues located on both the N-terminal portion of α-helix3 and its preceding loop in a unique manner (Fig. 3a). This differs from a UBE2R2 acceptor ubiquitin binding surface recently proposed52. The placement of the acceptor ubiquitin relative to the UBE2R2 UBC domain is consistent with our finding that mutations at the interface resulted in increased Km values of unanchored acceptor ubiquitin for the UBE2R2-mediated poly-ubiquitylation complex (Fig. 3b and Table 2). The ultimate test of the role of the structurally observed interface would be if compensatory UBE2R2 and acceptor ubiquitin mutations rescue the interaction. Indeed, assaying two such sets of mutant combinations restored Km to near WT values (Fig. 3b, Extended Data Fig. 4b and Table 2). We surmise that this distinctive placement of the acceptor ubiquitin enables its dual engagement by the synergy loop to coordinate the catalytic assembly.Fig. 3 UBE2R2’s UBC domain assists the synergy loop to recruit the acceptor ubiquitin.

a, Ribbon diagram of the chain formation complex highlighting the UBE2R2–acceptor ubiquitin (UBA) interface and the positions of key residues and their side chains mediating the interaction. Cryo-EM density from the composite map is shown. b, Bar graphs comparing the Km values for the indicated proteins of unanchored UBA for UBE2R2 in the presence of neddylated CUL2–RBX1. Compensatory mutations in UBE2R2 and UBA re-establish the interface, reducing Km values to near WT. Bars showing a ‘>’ reflect reactions in which saturation of UBE2R2 with UBA was not possible (the top concentration in the dilution series is shown). The value of each bar represents the estimated value for Km based on n = 3 technical replicates. c, Schematic showing the assay used to estimate the rates of chain extension onto ubiquitin-primed CRL substrates by UBE2R-family E2s (also see Extended Data Fig. 5d for an illustration of quench flow operation). SR, substrate receptor; S, substrate; R, RBX1, UBD, donor ubiquitin. d, Bar graph comparing the rates (kobs) of donor ubiquitin transfer from UBE2R2 to ubiquitin-primed Sil1 peptide substrate for the indicated proteins. The value of each bar represents the estimated value of kobs based on n = 3 technical replicates.

Source data

Overall, the structure showed multiple interactions contributing to the recruitment of donor and acceptor ubiquitins and poly-ubiquitylation of CRL substrates. In addition to contacts between UBE2R2 and the acceptor ubiquitin, CRL substrates are anchored by high-affinity interactions between their degrons and cognate receptors; here, the C terminus of the Sil1 peptide and FEM1C. To determine how the various mutant proteins would affect poly-ubiquitin chain formation onto a CRL-bound substrate, a method was devised to obtain highly pure mono-ubiquitylated Sil1 peptide (Extended Data Fig. 5a–c). This enabled our quantifying the rate of ubiquitin transfer (kobs) in pre-steady state reactions performed on a quench flow instrument (Fig. 3c and Extended Data Fig. 5d). Interestingly, monitoring chain extension on ubiquitin-primed Sil1 peptide suggested that the high effective concentration afforded by degron binding largely masks defects caused by mutations in individual interaction surfaces (Fig. 3d, Extended Data Fig. 5e,f and Table 2). However, the roles of all the interfaces become apparent upon simultaneous mutation of any two. For example, mutation of the interface between the synergy loop and the CRL combined with either that between the acceptor ubiquitin and E2 UBC domain or the donor ubiquitin and the synergy loop resulted in 51-fold and 12-fold reductions in kobs, respectively (Fig. 3d and Table 2). Similar effects were observed when the assays were repeated with UBE2R1 (Extended Data Fig. 5f,g and Table 2).

General mechanism of poly-ubiquitin formation across CRLs

UBE2R2 mediates poly-ubiquitylation with numerous distinct CRLs. Previous structures have shown several different combinations of cullins, substrate receptors and substrates. We modeled their potential catalytic assemblies by docking them with our structure of RBX1, UBE2R2 and donor and acceptor ubiquitins. The models suggested that a common catalytic architecture juxtaposes the poly-ubiquitylation active site and CRL-bound substrates (Extended Data Fig. 6a). To test our hypothesis of a common catalytic architecture, we applied cryo-EM to visualize UBE2R-mediated Lys48-linked chain extension for a ubiquitin-primed cyclin E phosphopeptide substrate of CRL1FBXW7 (containing neddylated CUL1–RBX1 and substrate receptor SKP1–FBXW7; Tables 1 and 3). This is the human homolog of the archetypal CRL in yeast shown to work with Cdc34 (refs. 8–10). The map readily fit our coordinates for the catalytic assembly mediating poly-ubiquitylation (Fig. 4a and Supplementary Video 4).Fig. 4 A generalized catalytic core for UBE2R-mediated poly-ubiquitin chain formation.

a, Ribbon diagram of neddylated CUL1–RBX1 bound to SKP1–FBXW7 with trapped UBE2R2~ubiquitin covalently bonded to ubiquitin-primed cyclin E peptide substrate and corresponding cryo-EM density. SKP1–FBXW7 (PDB 2OVP), CUL1 (PDB 6TTU) and the catalytic core (UBE2R2~UBD–UBA–RBX1, this study) were fit into the density using rigid-body refinement (UCSF Chimera). b, Bar graph comparing the ubiquitin transfer rates (kobs) for neddylated CRL1 and CRL2 complexes (substrate receptor identities are indicated on the x axis). The value of each bar represents the estimated value of kobs based on n = 3 technical replicates. c, Same as b except with cyclin E peptide–ubiquitin substrate and neddylated CRL1FBXW7 in combination with the indicated proteins. d, Ribbon diagram of neddylated CUL2–RBX1 bound to Elongin B/C–VHL with trapped UBE2R2~ubiquitin covalently bonded to ubiquitin-primed BRD4 neo-substrate in the presence of the PROTAC MZ1 and corresponding cryo-EM density. Elongin B/C–VHL–MZ1 (PDB 5T35), CUL2 and the catalytic core (this study) were fit into the density as described above. e, Same as c, except with neddylated CRL2VHL, ubiquitin-primed BRD4 neo-substrate (see Methods) and MZ1. UBD, donor ubiquitin; UBA, acceptor ubiquitin; ELOB, Elongin B; ELOC, Elongin C.

Source data

To validate the structural data indicating that millisecond poly-ubiquitylation is a broad feature of CRLs, we generated additional ubiquitin-primed peptide substrates of various CRLs to estimate the pre-steady state kinetics of poly-ubiquitylation. The fastest rate of ubiquitin transfer was an astonishing ~100 s−1 between ubiquitylated Hif1α peptide and neddylated CRL2 with VHL substrate receptor (Fig. 4b and Extended Data Table 1). The efficiency of product formation is striking, with 12% of Hif1α-ubiquitin further ubiquitylated in 2.5 ms, the limiting time of resolution for the quench flow instrument (Extended Data Fig. 6b). Overall, the average rate was 57 s−1 for four distinct CRL complexes. Importantly, poly-ubiquitylation was again substantially slowed by mutations at the structurally observed interfaces (Fig. 4c, Extended Data Fig. 6c and Extended Data Table 1).

In addition to their endogenous targets, CRLs can serve as E3s, promoting targeted protein degradation in response to hetero-bifunctional molecules, termed proteolysis targeting chimeras (PROTACs)53,54. These agents trigger the ubiquitylation of a neo-substrate by inducing its proximity with an E3 (refs. 55–58). Several PROTACs use CUL2 and its substrate receptor VHL59,60, with at least one such drug being explored as a cancer therapeutic in human clinical trials61. To determine whether the mechanism proposed here generalizes to neo-substrate poly-ubiquitylation, cryo-EM was performed on a neddylated CRL2VHL complex in the presence of the PROTAC MZ1 (refs. 62,63) and a ubiquitin-primed BRD4 fragment that had been chemically linked to UBE2R2~ubiquitin (Table 1). The electron density maps were sufficiently resolved to yield the following conclusions: (1) the catalytic core, including UBE2R2~donor ubiquitin, acceptor ubiquitin and the RBX1 RING domain, readily fit into the electron density (Fig. 4d and Supplementary Video 4); (2) the broad functionality of the UBE2R2 synergy loop also appeared to be conserved, including its interactions with the RING and both donor and acceptor ubiquitins (Fig. 4d inset); (3) the CRL complex accommodated the catalytic core by subtle rearrangement of the RING domain (Extended Data Fig. 6d), presumably due to the larger neo-substrate compared to peptides; (4) mutations in residues within the UBE2R2 UBC domain and located at the interface with acceptor ubiquitin led to defects in neo-substrate poly-ubiquitylation (Fig. 4e and Extended Data Fig. 6e, f); and (5) both the WHB domain and NEDD8 appeared to be disordered owing to a lack of clear electron density.

Comparison of CRL-mediated poly-ubiquitylation with RING E3s

To date, only two structures have been elucidated of RING-based E3s catalyzing Lys48-linked poly-ubiquitin chain formation. Superposition of the human E2 UBE2K and an associated acceptor ubiquitin64 with equivalent molecular counterparts from the neddylated CRL2FEM1C-based chain elongation structure showed distinct orientations of the acceptor ubiquitins relative to the E2 (Fig. 5a). Furthermore, the mechanism of poly-ubiquitin chain formation by the yeast E3 Ubr1 (ref. 65) also differed. First, this comparison showed the acceptor ubiquitins likewise interacting with their respective E2s through distinct conformations (Fig. 5b). Second, and in contrast with UBE2R2’s synergy loop, Ubr1 contains a short stretch of residues that were disordered during substrate priming but appeared to stabilize the conformation of the acceptor ubiquitin during poly-ubiquitin chain formation (Fig. 5c–e). Consequently, the rate of Ubr1-catalyzed chain formation was slower than the substrate priming reaction65. Even greater differences were observed in the acceptor ubiquitin conformation when the neddylated CRL2FEM1C structure was compared to an E2~ubiquitin–E3 complex promoting Lys63-linked poly-ubiquitin chain formation66 (Fig. 5f).Fig. 5 Unique modes of acceptor ubiquitin activation during Lys48-linked poly-ubiquitin chain formation.

a, Structural superposition of UBE2R2 (cyan) and bound acceptor ubiquitin (UBA; light orange) with the human E2 UBE2K and UBA (PDB 7OJX; gray). Notice dramatic rotation and translation of the acceptor ubiquitins relative to the E2 UBC domains. b, Same as a, except with the yeast E2 Ubc2 (PDB 7MEY). c, Cartoon illustrating distinct molecular solutions for controlling the orientation of UBA by UBE2R2’s synergy loop (top) and the yeast E3 Ubr1’s UB-binding loop (bottom). d, Ribbon diagram of the UBE2R2~UBD–UBA–RBX1 catalytic core (this study) during Lys48-dependent poly-ubiquitin chain formation. e, Same as d, except with the yeast E3 Ubr1 and Ubc2. f, Superposition of UBE2R2 (cyan) and UBA (light orange) with the human E2 UBE2N bound to UBA (gray) during Lys63-linked chain formation (PDB 5AIT). All structural alignments were performed with coordinates from the E2 UBC domains and UBE2R2–UBA from the neddylated CRL2FEM1C chain elongation structure. UBD, donor ubiquitin.

Ubiquitin chain formation depends on unique CRL remodeling

CRLs are activated by the covalent linkage of NEDD8 to a conserved cullin lysine residue20. NEDD8 has been shown to stimulate the catalytic efficiency of substrate priming43, in some cases by several orders of magnitude22. We and others32,39 also found that this property was paralleled by UBE2R2-mediated poly-ubiquitylation of ubiquitin-primed substrates whereby neddylation decreased the Km of UBE2R2 for the CRL complex while also increasing the rate of ubiquitin transfer, kobs (Extended Data Table 1). Previous structures of CUL1–RBX1-based CRLs had shown NEDD8 assisting RBX1 in recruiting the enzymes that mediate substrate priming21,22. Therefore, it was surprising that NEDD8 and its covalently linked cullin domain (the WHB domain) were not visible in the structures (Figs. 1c and 4a,d).

Interestingly, deleting the cullin WHB domain from CRL1βTRCP2, CRL1FBXW7, CRL2VHL and CRL2FEM1C E3s stimulated the kinetics of UBE2R2-mediated ubiquitin chain extension to an extent similar to or even exceeding the effect of neddylation (Fig. 6a, Extended Data Figs. 7a,b and Extended Data Table 1). Importantly, this effect is specific to UBE2R2: activity with other RBX1 partner ubiquitin-carrying enzymes (UBE2D3 and ARIH1) decreased upon deleting either the CUL1 or CUL2 WHB domain, in accordance with NEDD8 mediating their recruitment (Extended Data Fig. 7c,d).Fig. 6 Unique mechanisms guide CRL activation for substrate priming versus poly-ubiquitylation.

a, Bar graph showing kobs values for CRLs that were either unneddylated (gray), neddylated (yellow) or that contained mutant CUL1 or CUL2 subunits that lacked the WHB domain (ΔWHB; light green) or that disrupted interaction between the WHB domain and CUL2 (3K; dark green). The value of each bar represents the estimated value of kobs based on n = 3 technical replicates. b, Ribbon diagram of an AlphaFold model of the CUL2 C-terminal domain (green) bound to the RBX1 subunit (PDB 5N4W; blue). Charge-swapped mutations were introduced at three residues (‘3K’) in an α-helix buttressing the CUL2 C/R domain, disrupting interaction between the WHB and the RBX1 RING domain. c, Model illustrating how CRLs achieve timely substrate degradation. CRLs are activated by NEDD8 (N8) conjugation to the cullin’s WHB domain. Substrate priming is catalyzed by either the UBE2D-family E2s or the E3 ARIH1, with direct interaction between UBE2D and NEDD8 mediating juxtaposition between the donor ubiquitin and substrate. UBE2R-family E2s promote chain extension through their synergy loop and without direct interaction with NEDD8. UBD, donor ubiquitin; UBA, acceptor ubiquitin; SR, substrate receptor; S, substrate.

Source data

We gained further insights from cryo-EM data for CRL2 complexes without UBE2R2. The cryo-EM density maps for neddylated and unneddylated CRL2FEM1C were reminiscent of a CRL1 complex in that they resulted in multiple classes with distinct conformations22. In the previous study, the positions of CUL1’s WHB and RBX1’s RING domain, and NEDD8 when present, could not be assigned in any class because of poor density. Similarly, in cryo-EM maps of neddylated CRL2FEM1C, neither CUL2’s WHB domain nor NEDD8 could be unambiguously assigned (Extended Data Figs. 7e and 8a). However, one class for the unneddylated CRL2FEM1C showed CUL2’s WHB domain roughly positioned as in the prior crystal structure45, restraining RBX1’s RING domain (Extended Data Figs. 7f,g and 8b). Modeling NEDD8 on this structure, based on a study suggesting that NEDD8 and its covalently linked cullin WHB domain adopt the same conformation for CUL1 and CUL2 (refs. 22,67), showed it clashing (Extended Data Fig. 7h). Thus, neddylation would trigger rearrangement of its covalently linked CUL2 domain and liberate interactions with the RBX1 RING.

We designed mutations to test whether the activating role of NEDD8 towards UBE2R2 is to remove the WHB domain from its perch. A NEDD8 Q40E mutant that would prevent interactions mediating its clashing with the RING domain greatly reduced the rate of poly-ubiquitylation with UBE2R2 (Extended Data Fig. 7i,j). Notably, Gln40 in NEDD8 is the primary target of pathogenic bacterial effector proteins that catalyze its deamidation, impairing CRL activity and ubiquitylation of their substrates68,69. Alternatively, charge-swapped point mutants in CUL2 (D660K, E664K, D675K) were designed to liberate the WHB domain, activating UBE2R2-mediated ubiquitin chain extension in the absence of neddylation to an extent similar to neddylated WT CRL2 E3s (Fig. 6a,b, Extended Data Fig. 7a and Extended Data Table 1).

In summary, while CRL neddylation is required to promote both substrate priming and poly-ubiquitylation, NEDD8 does not directly mediate proximity between UBE2R2~ubiquitin and ubiquitin-primed substrate. Rather, it releases the RING domain from the cullin, which enables UBE2R2’s unique interactions with both the RING and acceptor ubiquitin (Fig. 6c).

Discussion

Here, we show how CRLs together with Cdc34/UBE2R-family E2s rapidly forge the Lys48-linked ubiquitin chains that trigger timely degradation of their substrates. Numerous CRL-dependent interactions converge to adjoin the C terminus of the donor ubiquitin linked to UBE2R2’s active site with Lys48 of a substrate-linked acceptor ubiquitin. Specifically, the CRL RING domain activates the catalytic conformation at multiple levels. In addition to the canonical function whereby the RING domain appears to directly stabilize the activated E2~donor ubiquitin conformation, the RING also configures the synergy loop to buttress the donor ubiquitin against UBE2R2. Consequently, this sculpting of the synergy loop also guides the acceptor ubiquitin. These interactions are interconnected; thus, the donor ubiquitin also shapes the synergy loop to organize the acceptor, and vice-versa (Fig. 2).

The multiplicity of interactions establishes extraordinary kinetics of poly-ubiquitin chain formation. Together with a CRL, UBE2R2 belongs to a small group of enzymes that are considered at or near catalytic perfection. The catalytic efficiency (kcat/Km) of such an enzyme is limited by the rate of forming the enzyme–substrate complex70,71, ranging from 108 to 109 M−1 s−1. Here, the related value, kobs/Km, was estimated at nearly 108 M−1 s−1 for neddylated CRL1FBXW7 and a ubiquitin-primed cyclin E peptide substrate (Extended Data Table 1). Such rapid formation of Lys48-linked—that is degradative72—poly-ubiquitin chains would need to be tightly controlled to prevent wayward activity, perhaps explaining the requisite specificity of Cdc34/UBE2R-family E2s for CRLs.

In addition to a synergy loop, Cdc34/UBE2R-family E2s also contain a unique and conserved C-terminal extension. Like its synergy loop counterpart, the tail is also acidic and essential for viability in yeast34,73,74. Biochemically, the Cdc34/UBE2R-family C-terminal tail promotes processive poly-ubiquitylation, at least in part by enabling rapid rates of association between the E2 and the CRL complex through a basic canyon region on the cullin subunit41. Prior studies suggested that the acidic tail may adopt multiple conformations during cullin subunit binding40, which seems consistent with an apparent lack of electron density for the various CRL-mediated chain elongation complexes reported here. The tail has also been shown to participate in catalysis31, and our model for poly-ubiquitin chain formation suggests that tethering of the Cdc34/UBE2R UBC domain by its tail may restrain the conformational freedom of the active site towards the substrate, thus increasing the rate of ubiquitin transfer.

CRLs as a paradigm for rapid poly-ubiquitylation

Our structural and quench flow kinetic data, taken together with previous knowledge of CRL regulation, suggest how rapid poly-ubiquitylation is tied to substrate binding to a cullin. Substrates effectively stimulate cullin neddylation by impeding NEDD8 deconjugation75–79. NEDD8, in turn, substantially potentiates all steps along the process of substrate poly-ubiquitylation. NEDD8 first stimulates the initial priming of substrates with ubiquitin. Previous structures showed the key role for NEDD8 as collaborating with CRLs to recruit the enzymes mediating ubiquitin transfer directly to substrate21,22,42. We showed that NEDD8 also substantially activates the catalytic efficiency of ubiquitin chain extension on ubiquitin-primed substrates by nearly two orders of magnitude (Extended Data Table 1). Surprisingly, this does not involve direct interaction of NEDD8 with UBE2R2, but rather NEDD8-dependent release of a cullin’s grip on the RBX1 RING domain.

Insertions in the same location as the Cdc34/UBE2R-family E2 synergy loop are found in only one other E2 family: Ubc7/UBE2G. Interestingly, UBE2G1 was recently shown to mediate targeted protein degradation relying on a CRL4 E3 through the formation of Lys48-linked poly-ubiquitin chains on neo-substrates54,59,80. In addition, UBE2G1 is necessary for the efficient degradation of CUL1-containing CRL substrates upon ablation of UBE2R1 and UBE2R2 (ref. 39). Furthermore, the structure of UBE2G2 bound to an E3 fragment showed interaction between the distal loop and the RING domain81. Therefore, it seems likely that the structural mechanism of UBE2G-mediated poly-ubiquitylation largely parallels that reported here for UBE2R2. We propose that the unique E2 synergy loop is a general strategy in nature to coordinate neddylated CRLs, their cognate E2~ubiquitin conjugates and placement of the acceptor ubiquitin to drive ultra-rapid poly-ubiquitylation, triggering degradation across thousands of CRL substrates (Fig. 6c).

Although currently there are only three atomic resolution structures of E2-RING E3 complexes catalyzing Lys48-linked poly-ubiquitin chain formation, two key observations were made based on their comparison. First, although the E2 UBC domain structure is highly conserved, its interaction with acceptor ubiquitin to delicately place Lys48 into the active site shows apparent conformational variation amongst the different E2–E3 pathways (Fig. 5). Second, even though additional contacts with the acceptor ubiquitin appear to be important, the Cdc34/UBE2R synergy loop emanates from the E2, whereas the yeast E3 Ubr1 both anchors the acceptor ubiquitin while simultaneously binding to substrate. Based on these observations, it seems likely that additional mechanisms of Lys48-linked poly-ubiquitin chain formation await discovery. We anticipate that the structures presented here will serve as a basis for comparison, as we suspect many additional E2–E3 structures promoting poly-ubiquitylation will be described soon.

Methods

Cloning, protein expression and purification

All constructs used in this study were made by using common molecular biology procedures. Protein sequence modifications were introduced using the QuikChange site-directed mutagenesis protocol (Agilent).

All proteins are of human origin. The UBE2R1 and UBE2R2 constructs (and all mutant derivatives) were expressed in the Rosetta (DE3) bacterial strain with either N-terminal glutathione-S-transferase (GST) or 6×His tags that were liberated during the purification process owing to a tobacco etch virus (TEV) protease cleavage site. GST–thrombin–VHL (residue 54 to C terminus) and GST–TEV–FEM1C were co-expressed with elongin B/C in BL21-Gold (DE3) bacterial cells. Proteins were purified by nickel-agarose or GST-sepharose affinity chromatography followed by overnight treatment with TEV or thrombin proteases. Next, select proteins were further purified by ion-exchange chromatography before size-exclusion chromatography into a buffer containing 25 mM HEPES pH 7.5, 150 mM NaCl and 1 mM DTT or storage buffer (30 mM Tris pH 7.5, 100 mM NaCl, 10% glycerol, 1 mM DTT). A 6×His-3C-K48C ubiquitin–Sil1 fusion construct was expressed in Rosetta (DE3) bacterial cells and purified by nickel-agarose affinity chromatography followed by size-exclusion chromatography into a buffer that contained 25 mM HEPES pH 7.5, 150 mM NaCl and 1 mM TCEP. The final amino acid sequence of K48C ubiquitin–Sil1 was:

N-term- HHHHHHSSGLEVLFQGPMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGCQLEDGRTLSDYNIQKESTLHLVLRLRAAEGYFQELLGSVNPTQGRAR -C-term

A 2×Strep–TEV K48C ubiquitin–BRD4 (residues 352–460) C356A C357A C391A C429A fusion construct was expressed in Rosetta (DE3) bacterial cells and purified by StrepTactin-sepharose affinity chromatography followed by overnight TEV cleavage and size-exclusion chromatography into a buffer that contained 25 mM HEPES pH 7.5, 150 mM NaCl and 1 mM TCEP. The final amino acid sequence of K48C ubiquitin BRD4 (residues 352–460) was:

N-term- GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGCQLEDGRTLSDYNIQKESTLHLVLRLRAAGSGSGSEQLKAASGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYADIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNAYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE -C-term

Ubiquitins (including mutant derivatives) were expressed in BL21 (DE3) bacterial cells and purified through nickel-agarose affinity chromatography followed by size-exclusion chromatography into storage buffer consisting of 30 mM Tris pH 7.5, 100 mM NaCl, 10% glycerol and 1 mM DTT. Donor ubiquitins used in the unanchored, di-ubiquitin synthesis assays were expressed as GST–TEV–PKA–ubiquitin fusions and purified as previously described82. The PKA site contains the consensus phosphorylation sequence for protein kinase A (see below for the radiolabeling procedure). SKP1–FBXW7Δdimerization (residues 263 to C terminus), SKP1–βTRCP2, APPBP1–UBA3, UBE2M, NEDD8 and sortase A were purified as previously described22,30,83–85. All WT and mutant 2×Strep–Dac–TEV–CUL2 constructs, 2×Strep–Dac–TEV–CUL2 residues 1–660 (ΔWHB), His–MBP–TEV–RBX1 (5–C), CUL1, CUL1 residues 1–692 (ΔWHB), GST–TEV–RBX1 (5–C) and UBA1 constructs were generated in pLIB vectors86 and used to form baculoviruses in Sf9 cells. Baculoviruses corresponding to CUL2 and His–MBP–TEV–RBX1 (5–C) or to CUL1 and GST–TEV–RBX1 (5–C) were used to transduce High Five (BTI-TN-5B1-4) cells and co-express the indicated protein subunits22,83. Proteins were purified by either StrepTactin or GST-sepharose affinity chromatography followed by overnight TEV cleavage. Next, proteins were subjected to ion-exchange chromatography followed by size-exclusion chromatography on a SuperDex 200 column that had been equilibrated in a buffer containing 25 mM HEPES pH 7.5, 150 mM NaCl and 1 mM DTT. WT CUL2 with an RBX1 subunit harboring an R91E mutation was purified as previously described87 or through the method of baculoviruses as described above. All CUL1–RBX1 and CUL2–RBX1 complexes were covalently modified by NEDD8 (neddylated) as previously described22,83,88. Human BRD4 (residues 346–460) neo-substrate containing a C-terminal ‘GRRASY’ sequence was cloned using standard procedures and contained an N-terminal His-tag for purification by nickel affinity chromatography. The protein was first expressed in Rosetta (DE3) bacterial cells and purified by capture on nickel-agarose beads. Overnight TEV cleavage was followed by ion-exchange chromatography (HiTrap SP HP) and size-exclusion chromatography into a buffer that contained 25 mM HEPES pH 7.5, 150 mM NaCl and 1 mM DTT.Table 3 Peptides

Peptide	Sequence	Source	
Cyclin E ‘sortasing’ assays	GGGGPLPAGLL(pT)PPQ(pS)GRRASY	21	
Cyclin E ‘sortasing’ cryo-EM	GGGGLPSGLL(pT)PPQ(pS)GKKQSSDYKDDDDK	21	
Cyclin E substrate assays	Ac-KAMLSEQNRASPLPSGLL(pT)PPQ(pS)GRRASY	21	
β-catenin ‘sortasing’ assays	GGGGYLD(pS)GIH(pS)GATTAPRRASY	22	
Hif1α ‘sortasing’ assays	GGGGLLA(hyP)PAAGDTIISLDFGSNGRRASY	MPI	
Hif1α substrate assays	Ac-KLRREPDALTLLA(hyP)AAGDTIISLDFGSN-Fluorescein	MPI	
Sil1 substrate assays	Ac-GRRASYGSGSKEGYFQELLGSVNPTQGRAR	NEP	
All peptides were either purchased from Vivitide (formerly New England Peptides (NEP); greater than 95% purity) or synthesized in-house at the Max Planck Institute of Biochemistry (MPI) and solubilized in water. All single lysine peptide substrates had their N termini acetylated (Ac). Phosphodegrons are shown as pT (phospho Thr) or pS (phospho Ser), and the hydroxylated Pro degron in Hif1α peptides are shown as hyP. The Sil1 peptide substrate amino acid sequence was based on the clone 13 design17 that had optimized affinity for FEM1C. All peptides that were substrates for ubiquitylation assays contained the ‘RRASY’ amino acidic sequence that enabled 32P-labeling by protein kinase A (New England Biolabs).

Generation of ubiquitin-primed substrates

Generation of ubiquitin-primed peptide substrates using ‘sortasing’

The sortase-mediated transpeptidation reaction was used to link ubiquitin75-SGSGSLPETGG-C-term to Hif1α, β-catenin and cyclin E peptides designed for sortasing (see Table 3 above)21,22,30.

Generation of ubiquitin-primed Sil1 peptide substrates

To generate a ubiquitin-primed peptide substrate, one would ideally choose an E2 that is efficient at substrate priming but not poly-ubiquitin chain formation. In the literature, S138A UBE2R1 was shown to be less defective at substrate priming than poly-ubiquitin chain formation38. Those results inspired testing S138D UBE2R2, which was also motivated by the work on the E2 Ubc9 showing that residues at the structurally equivalent position can be either serine or aspartate89. S138D UBE2R2 was still defective at poly-ubiquitin chain formation, but quite active for substrate priming (Extended Data Fig. 5a). As such, unneddylated CUL2–RBX1 (1 µM), Elongin B/C–FEM1C (1 µM) and Sil1 peptide (100 µM) were first diluted in 1× reaction buffer (30 mM Tris-HCl pH 7.5, 100 mM NaCl, 5 mM MgCl2, 2 mM DTT and 2 mM ATP). It was subsequently discovered that S138D UBE2R2 was not efficient at priming substrates for some mutant ubiquitins. In these cases, the E2 UBE2D3 was used instead (see below). In another tube of equal volume, human E1 (1 µM), 6×His-tagged ubiquitin (WT or mutant; 90 µM) and either S138D UBE2R2 (1 µM) or WT UBE2D3 (40 µM) were diluted in reaction buffer. For generation of Sil1-WT-ubiquitin, either S138D UBE2R2 or UBE2D3 were used for various preparations, whereas UBE2D3 was used for Sil1-R54D ubiquitin. Finally, S138D UBE2R2 was used for Sil1-H68A-ubiquitin and Sil1-N60R-ubiquitin. These solutions were pre-incubated for 15 min, then the E1 mix was combined with the E3 mix to initiate the ubiquitylation reaction and allowed to react overnight (>16 h) at room temperature (20–22 °C). The reaction was then diluted 1:10 in nickel-agarose binding buffer (30 mM Tris pH 7.5, 250 mM NaCl, 5% glycerol, 0.1% IgePal and 20 mM imidazole) and incubated with Ni-NTA agarose (Qiagen) for 1 h at 4 °C. The resin was then washed three times with nickel binding buffer before being eluted on a gravity column with 4 ml of nickel elution buffer (50 mM HEPES pH 8.0, 200 mM NaCl and 300 mM imidazole). The resulting eluate was first concentrated using an Amicon Ultra 4 ml centrifugal filter (Millipore-Sigma) and then injected onto a SuperDex 75 (GE Healthcare) column that had been equilibrated in storage buffer (30 mM Tris pH 7.5, 100 mM NaCl, 10% glycerol and 1 mM DTT) (Extended Data Fig. 5b,c). Fractions containing pure Sil1-ubiquitin protein were combined, concentrated and drop-frozen in liquid nitrogen for storage at −80 °C.

Generation of ubiquitin-primed cyclin E peptide substrates for acceptor ubiquitin mutant analysis

Generation of ubiquitin-primed cyclin E peptide substrates by enzyme-catalyzed conjugation of ubiquitin to an N-terminal lysine residue was performed similarly to the ubiquitin-primed Sil1 peptide substrates with the following modifications. An unneddylated SCF complex with SKP1–FBXW7 substrate receptor was used with the E2 UBE2D3 (2 µM) for both WT and R54D ubiquitin. The reactions were incubated at room temperature for 3 h before purification involving the same steps as described above for Sil1-ubiquitin.

Peptide, donor ubiquitin and BRD4 neo-substrate 32P-labeling

All peptides were labeled at 10 µM or 50 µM final concentrations as follows. Peptides were diluted in 10× NEBuffer for Protein Kinases (New England Biolabs) followed by the addition of 40 µM γ32P-labeled ATP (Perkin Elmer) and protein kinase A (2,500 units) and incubation at 32 °C for 2 h. Proteins and peptides labeled at 50 µM or above were first incubated with radio-labeled ATP for 1 h followed by the addition of unlabeled ATP (400 µM) for an additional 1 h. Donor ubiquitins were similarly labeled at a concentration of 200 µM, whereas BRD4 was labeled at 50 µM.

Biochemical assays and enzyme kinetics

Unanchored di-ubiquitin formation assay for UBE2R2 synergy loop alanine scan

This assay is a modified version of a ubiquitylation reaction that had been used to estimate yeast Cdc34 unanchored chain formation33. Both the donor and acceptor ubiquitins contain mutations that restrict product formation to di-ubiquitin, greatly simplifying quantification of the reaction outcomes and interpretation of the results. Here, all radio-labeled donor ubiquitins contained the K48R mutation (hereafter K48R donor ubiquitin) to prevent its ability to act as an acceptor ubiquitin (given UBE2R’s strong preference to build poly-ubiquitin chains with Lys48 specificity). Similarly, all acceptor ubiquitins contained an additional aspartate at the C terminus (hereafter D77 acceptor ubiquitin) that prevented thioester formation with the E2 and its acting as a donor ubiquitin. A mixture of 0.625 µM neddylated CUL2–RBX1 was prepared in reaction buffer (30 mM Tris-HCl pH 7.5, 100 mM NaCl, 5 mM MgCl2, 2 mM DTT and 2 mM ATP). Then, 4 µl of the solution was aliquoted into Eppendorf tubes, followed by the addition of 1 µl of 500 µM D77 acceptor ubiquitin (WT or a mutant variant) to a final volume of 5 µl. In another tube, human E1 (1 µM) and WT or mutant UBE2R2 proteins (15 µM) were mixed with 32P-labeled K48R donor ubiquitin (24 µM) in reaction buffer. Both solutions were incubated at room temperature for 15 min. Reactions were initiated by mixing equal volumes from both tubes before being quenched in 2× SDS–PAGE buffer (100 mM Tris-HCl pH 6.8, 20% glycerol, 30 mM EDTA, 4% SDS and 4% β-mercaptoethanol) after a 15 s incubation period. For reactions with E108A or E112A UBE2R2, the incubation time was increased to 45 s. Donor ubiquitin substrate and di-ubiquitin product were separated by SDS–PAGE on 18% gels followed by autoradiography and detection on an Amersham Typhoon 5 imager (Cytiva). The intensities of substrate and product were quantified in ImageQuant software v.8.2.0.0 (Cytiva) and used to estimate the fraction of substrate that had been converted to product by dividing the signal of product by the total signal in the lane. See Extended Data Fig. 3e for a diagram of the assay.

Comparison of 32P-labeled K48R ubiquitin with untagged K48R ubiquitin

Di-ubiquitin synthesis reactions were performed to compare the activities of 32P-labeled K48R donor ubiquitin that contained an N-terminal amino acid sequence motif that enabled its phosphorylation and untagged K48R ubiquitin that had been purchased (LifeSensors). A tube was assembled with 0.5 µM E1, 24 µM K48R ubiquitin and 4 µM UBE2R2 diluted in reaction buffer (30 mM Tris-HCl pH 7.5, 100 mM NaCl, 5 mM MgCl2, 2 mM DTT and 2 mM ATP). A separate tube was assembled containing 0.5 µM neddylated CUL2–RBX1 and 50 µM D77 acceptor ubiquitin (Extended Data Fig. 3e). Both tubes were then incubated at room temperature for 15 min. Reactions were initiated by mixing equal volumes from both tubes and then quenching them at various time points with 2× SDS–PAGE buffer (100 mM Tris-HCl pH 6.8, 20% glycerol, 30 mM EDTA, 4% SDS and 4% β-mercaptoethanol). Substrates and products were then separated on 18% Tris-Glycine gels by SDS–PAGE before being stained by Coomassie blue solution (20% methanol, 10% acetic acid, 0.1% Coomassie blue; Extended Data Fig. 3f).

Estimation of the Km of unanchored acceptor ubiquitin for the UBE2R1- or UBE2R2–NEDD8–CUL2–RBX1 complex

Di-ubiquitin synthesis reactions were prepared as follows. A twofold dilution series of D77 acceptor ubiquitin was generated with 1× reaction buffer (30 mM Tris-HCl pH 7.5, 100 mM NaCl, 5 mM MgCl2, 2 mM DTT and 2 mM ATP) in a volume of 4 µl and was aliquoted into autoclaved Eppendorf tubes. A separate dilution consisting of 2.5 µM neddylated CUL2–RBX1 without substrate receptors was also made with reaction buffer, and 1 µl of this solution was combined with the acceptor ubiquitin solutions leading to a final total volume of 5 µl. Subsequently, in another tube, 0.5 µM human E1, 24 µM 32P-labeled K48R donor ubiquitin and 15 µM UBE2R1 or UBE2R2 were diluted with 1× reaction buffer. For reactions that involved K48R/R74E donor ubiquitin, it was determined that an E1 concentration of 1 µM was necessary to saturate loading of the E2 (Extended Data Fig. 4e). These mixtures were then incubated for 15 min at room temperature. Reactions were initiated by mixing equal volumes of the E3-acceptor ubiquitin and UBE2R mixtures together. Reactions were quenched using 2× SDS–PAGE buffer (100 mM Tris-HCl pH 6.8, 20% glycerol, 30 mM EDTA, 1% bromophenol blue, 4% SDS and 4% β-mercaptoethanol) after a 10 s incubation period. Reactions containing E108A UBE2R1 and UBE2R2, E108R UBE2R2, and E112A UBE2R2 were incubated for 30 s. Reactions containing E108A/E112A UBE2R2, E108A UBE2R1 and UBE2R2 in combination with R54D acceptor ubiquitin, E108A UBE2R2 in combination with K48R/R74E donor ubiquitin, and WT UBE2R1 and UBE2R2 with K48R/R74E donor ubiquitin were incubated for 45 s. Substrates and products were resolved on 18% Tris-Glycine SDS–PAGE gels and were dried using a Hoefer Slab Gel Dryer GD 2000 before being exposed overnight on a phosphor screen. The screens were then imaged using an Amersham Typhoon 5 scanning imager (Cytiva). Quantification of substrates and products was performed using ImageQuant software v.8.2.0.0 (GE Healthcare), in which the fraction of di-ubiquitin product was estimated by dividing its signal by the total, including that for the substrate. The data were plotted and fit to the Michaelis–Menten model using nonlinear regression (GraphPad Prism 9).

Estimating the CRL-dependent activation of UBE2R2 di-ubiquitin formation

The di-ubiquitin synthesis assay was performed both in the absence or presence of neddylated CUL2–RBX1 in which the RBX1 subunit was WT or harbored an R91E mutant. For reactions containing a CRL, solutions were assembled in reaction buffer (30 mM Tris-HCl pH 7.5, 100 mM NaCl, 5 mM MgCl2, 2 mM DTT and 2 mM ATP) containing 0.5 µM CRL and 50 µM D77 acceptor ubiquitin. Reactions performed in the absence of the CRL were also assembled in reaction buffer with 50 µM D77 acceptor ubiquitin. A separate solution containing 0.5 µM E1, 1 µM UBE2R2 and either 2 µM or 10 µM 32P-labeled K48R donor ubiquitin was diluted in reaction buffer (for reactions containing a CRL, 10 µM 32P-labeled donor ubiquitin was used). These solutions were then incubated at room temperature for 15 min. Reactions were initiated by mixing equal volumes from both solutions before being quenched in 2× SDS–PAGE buffer (100 mM Tris-HCl pH 6.8, 20% glycerol, 30 mM EDTA, 4% SDS and 4% β-mercaptoethanol) after the indicated incubation periods (see Extended Data Fig. 4c,d). Reaction products were separated by SDS–PAGE on 18% Tris-Glycine gels followed by autoradiography and detection on a Typhoon 5 image scanner. The products were quantified by ImageQuant software v.8.2.0.0, whereby the fraction of di-ubiquitin was estimated by dividing its signal by the total signal, including that for the substrate. The data were then normalized whereby the fraction of product values was multiplied by the ratio of 32P-labeled K48R donor ubiquitin and UBE2R2 levels. The data were fit to a linear model in GraphPad Prism using linear regression.

Estimation of kobs from UBE2R1 or UBE2R2 to ubiquitin-primed Sil1 or Hif1α peptide substrates

Ubiquitylation reactions were performed as single-encounter reactions between the ubiquitin-primed substrate and UBE2R2 as follows. A tube containing the CRL components was prepared with neddylated CUL2–RBX1, Elongin B/C–FEM1C or Elongin B/C–VHL and radio-labeled ubiquitin-primed substrate in reaction buffer (30 mM Tris-HCl pH 7.5, 100 mM NaCl, 5 mM MgCl2, 2 mM DTT and 2 mM ATP). In another tube, human E1, unlabeled K48R ubiquitin and UBE2R1 or UBE2R2 were diluted in reaction buffer. For reactions with Hif1α-ubiquitin, 20 µM unlabeled Hif1α substrate peptide (see Table 3 above) was added to the E2 mix to ensure single-encounter conditions between the radio-labeled substrate and the CRL19. For reactions with Sil1-ubiquitin, unlabeled peptide was unnecessary owing to the relatively slow off-rate of Sil1-ubiquitin from the CRL relative to the time course. For reactions involving unlabeled K48R/R74E donor ubiquitin, the human E1 concentration was doubled to ensure complete loading of the E2 before quench flow (Extended Data Fig. 4e). The CRL and E2 mixtures were incubated for 15 min at room temperature, followed by loading onto the left and right sample loops of a KinTek RQF-3 quench flow instrument. Timepoints were taken by combining the two mixtures with drive buffer (30 mM Tris-HCl pH 7.5 and 100 mM NaCl). Reactions were quenched in 5× SDS–PAGE buffer (250 mM Tris-HCl pH 6.8, 50% glycerol, 75 mM EDTA, 1% bromophenol blue, 10% SDS and 10% β-mercaptoethanol). Substrates and products were then resolved using 18% Tris-Glycine SDS–PAGE gels, which were subsequently dried using a Hoefer Slab Gel Dryer model GD 2000 before being exposed overnight on a phosphor screen. The screens were then imaged using a Typhoon 5 scanner. Quantification of substrates and products was performed using ImageQuant software v.8.2.0.0 (GE Healthcare), in which the fraction of remaining Sil1-ubiquitin or Hif1α-ubiquitin was estimated by dividing the signal of the substrate by the total, including the products. The data were fit to a one-phase decay equation using nonlinear regression (GraphPad Prism 9). Final concentrations of all reagents can be found in the table below. UBE2R1 and UBE2R2 concentrations were chosen to saturate the CRL substrate complex when feasible. A schematic of the experimental setup for this method can be found in Fig. 3c and Extended Data Fig. 5d.Final conditions for neddylated CRL2VHL and CRL2FEM1C ubiquitylation reactions	
Substrate receptor	Experiment	[E1] (µM)	[UB] (µM)	[UBE2R1/2] (µM)	[CRL2] (µM)	[Substrate] (µM)	
VHL	QF	0.25	10	5	0.25	0.1	
FEM1C	QF	0.25	2	1	0.25	0.1	
QF, quench flow.

Comparison of E1-catalyzed charging of K48R and K48R/R74E donor ubiquitins onto UBE2R2

A tube with 16.6 µM UBE2R2 and 27 µM K48R or K48R/R74E ubiquitin was diluted in non-reducing reaction buffer (30 mM Tris-HCl pH 7.5, 100 mM NaCl, 5 mM MgCl2 and 2 mM ATP); 9 µl of this solution was then aliquoted to autoclaved reaction tubes. A twofold dilution series was generated with E1 protein in non-reducing reaction buffer, with the highest concentration being 10 µM. Reactions were initiated by adding 1 µl of the E1 serial dilution to each tube, followed by brief vortexing. After a 15 min incubation period at room temperature, reactions were quenched in non-reducing 2× SDS–PAGE buffer (100 mM Tris-HCl pH 6.8, 20% glycerol, 30 mM EDTA and 4% SDS). Products were separated by SDS–PAGE on 18% Tris-Glycine gels and then stained with Coomassie blue solution (20% methanol, 10% acetic acid and 0.1% Coomassie blue). The experiment was then repeated using 32P-labeled donor ubiquitins before exposure to a phosphor screen. Substrates and products were visualized by scanning on an Amersham Typhoon 5 (Cytiva) and quantified using ImageQuant software v.8.2.0.0 (GE Healthcare). The fraction of product signal was determined by dividing the UBE2R2~donor ubiquitin signal by the total signal in the lane (Extended Data Fig. 4e). Experiments were performed in duplicate technical replicates.

Estimation of kobs from UBE2R2 to ubiquitin-primed cyclin E or β-catenin peptide substrates

Reactions were performed as described above for Sil1-ubiquitin and Hif1α-ubiquitin with the following exceptions. The CRL tube contained neddylated CUL1–RBX1, unmodified CUL1–RBX1 or CUL1ΔWHB–RBX1 with either SKP1–FBXW7 or SKP1–βTRCP2 substrate receptors. In the E1 mix, either unlabeled cyclin E or β-catenin substrates were used instead of Hif1α (20 µM). For reactions that involved E108A UBE2R2 and/or cyclin E-UbR54D, the data were fit to analytical closed-form equations19 in Mathematica (v.13.1).Final conditions for neddylated CRL1 or CUL1ΔWHB ubiquitylation reactions	
Substrate receptor	Experiment	[E1] (µM)	[UB] (µM)	[UBE2R2] (µM)	[CRL1] (µM)	[Substrate] (µM)	
FBXW7	QF	0.5	20	10	0.5	0.1	
βTRCP2	QF	0.5	20	10	0.5	0.1	
Final conditions for CRL1 ubiquitylation reactions (unneddylated)	
Substrate receptor	Experiment	[E1] (µM)	[UB] (µM)	[UBE2R2] (µM)	[CRL1] (µM)	[Substrate] (µM)	
FBXW7	QF	0.5	40	20	0.5	0.1	
βTRCP2	QF	0.5	40	20	0.5	0.1	
QF, quench flow.

Estimation of kobs from UBE2R2 to BRD4 (346–460) neo-substrate in complex with neddylated CRL2VHL and the PROTAC MZ1

Generation of BRD4 (346–460)-ubiquitin fusion substrates is technically challenging. However, one can estimate the rates of poly-ubiquitin chain formation by first monitoring substrate priming followed by the formation of a di-ubiquitin chain on substrate, as described in an earlier pioneering work19. MZ1 PROTAC was purchased as a lyophilized powder (MedChemExpress) and solubilized in 100% DMSO at a concentration of 1 mM. Reactions were assembled in two separate mixtures as follows. In one tube, 0.5 µM neddylated CUL2–RBX1, 0.5 µM Elongin B/C–VHL, 0.5 µM 32P-labeled BRD4 (346–460) and 4 µM MZ1 were diluted in reaction buffer. In another tube, 0.5 µM E1, 20 µM WT ubiquitin and 10 µM WT UBE2R2 or its mutant derivatives were also diluted in reaction buffer. These tubes were then incubated for 15 min before being loaded into separate sample loops on a KinTek RQF-3 Quench-Flow instrument. Reactions were initiated by bringing the two solutions together with drive buffer (30 mM Tris pH 7.5 and 100 mM NaCl) and then quenching at various time points with 2× SDS–PAGE buffer (100 mM Tris-HCl pH 6.8, 20% glycerol, 30 mM EDTA, 4% SDS and 4% β-mercaptoethanol). Substrates and products were then resolved using 18% Tris-Glycine SDS–PAGE gels that were dried and exposed overnight to a phosphor screen. Images were collected by scanning of the phosphor screens on an Amersham Typhoon 5 (Cytiva) and quantified using ImageQuant software v.8.2.0.0 (GE Healthcare). Note that the time resolution was sufficient to separate the appearance of primed substrate and poly-ubiquitin chain formation, thus enabling their quantification (Extended Data Fig. 6e,f) The depletion of unmodified BRD4 (346–460) was determined by dividing the signal of the substrate by the total signal in the lane including products. The levels of mono-ubiquitylated BRD4 (346–460) were also determined by dividing the signal of BRD4 (346–460)-ubiquitin by the total signal in the lane. The rates of ubiquitin transfer of priming and poly-ubiquitin chain extension were determined by fitting to their respective analytical closed-form solutions19 in Mathematica (v.13.1).

Multi-turnover reactions with ubiquitin-primed peptide substrates and estimation of the Km of UBE2R2 for various CRL1s

All tubes were assembled in reaction buffer in a stepwise manner. First, the solution for tube one was prepared by the addition of CRL (neddylated CUL1–RBX1, CUL1–RBX1 or CUL1ΔWHB–RBX1), substrate receptor complex (SKP1–βTRCP2 or SKP1–FBXW7) and followed by 32P-labeled peptide substrate (β-catenin-ubiquitin or cyclin E-ubiquitin). Next, the solution for tube two was assembled by the addition of E1 and unlabeled K48R donor ubiquitin, followed by a 1 min incubation period. Equal volumes of the tube two solution were then aliquoted into nine autoclaved Eppendorf tubes. Subsequently, a twofold dilution series was formed for UBE2R2 and then sequentially added to the aliquoted tube two solutions which were incubated for 15 mins at room temperature. Initiation of the ubiquitylation reactions was accomplished by combining equal volumes of tube one and tube two solutions. All reactions were quenched with 2× SDS–PAGE buffer (100 mM Tris-HCl pH 6.8, 20% glycerol, 30 mM EDTA, 4% SDS and 4% β-mercaptoethanol) after a 10 s incubation period. Reactions were processed by SDS–PAGE, substrates and products were quantified (ImageQuant v.8.2.0.0) and the fraction of product formation was estimated. The fraction product was plotted as a function of the UBE2R2 concentration and fit to the Michaelis–Menten model using nonlinear regression (GraphPad Prism 9).Final conditions for neddylated CUL1–RBX1 and CUL1ΔWHB–RBX1 ubiquitylation reactions	
Substrate receptor	Experiment	[E1] (µM)	[UB] (µM)	[UBE2R2] (µM)	[CRL1] (µM)	[Substrate] (µM)	
FBXW7	Km	0.5	20	6.5*	0.5	5	
βTRCP2	Km	0.5	20	6.5*	0.5	5	
*The top concentration in a twofold dilution series

	Final conditions for unmodified CUL1–RBX1 ubiquitylation reactions	
Substrate receptor	Experiment	[E1] (µM)	[UB] (µM)	[UBE2R2] (µM)	[CRL1] (µM)	[Substrate] (µM)	
FBXW7	Km	0.5	50	26*	0.5	5	
βTRCP2	Km	0.5	50	26*	0.5	5	
*The top concentration in a twofold dilution series

Steady state control reactions for the ΔWHB mutation in cullin

All tubes were assembled in reaction buffer in a stepwise manner. First, tube one was prepared by the addition of CRL (neddylated CUL1–RBX1, CUL1–RBX1, CUL1ΔWHB–RBX1, neddylated CUL2–RBX1, CUL2–RBX1 or CUL2ΔWHB–RBX1), substrate receptor complex (SKP1–βTRCP2 or Elongin B/C–FEM1C) and then 32P-labeled substrate (β-catenin-ubiquitin or Sil1-ubiquitin). Next, tube two was prepared by the addition of E1 and WT donor ubiquitin followed by a 1 min incubation period and then UBE2D3, or ARIH1 with UBE2L3. For tube two mixtures containing UBE2D3, an additional 2 min incubation period was performed before initiation of the ubiquitylation reactions. For tube two mixtures containing ARIH1, the E2 UBE2L3 was added first and incubated for 2 min followed by the addition of ARIH1. All incubation periods were performed at room temperature. Reactions were initiated by combining equal volumes of tube one with tube two at room temperature. All reactions were quenched with 2× SDS–PAGE buffer (100 mM Tris-HCl pH 6.8, 20% glycerol, 30 mM EDTA, 4% SDS and 4% β-mercaptoethanol) at the indicated time points (Extended Data Fig. 7c,d). Reactions were processed by SDS–PAGE, substrates and products were quantified (ImageQuant v.8.2.0.0) and the fraction of product formation was estimated.Final conditions for steady state control reactions with UBE2D3	
E3*	[E1] (µM)	[UB] (µM)	[UBE2D3] (µM)	[CRL] (µM)	[Substrate] (µM)	
CRL2FEM1C	0.5	30	12.5	0.25	0.1	
CRL1BTRCP2	0.5	30	12.5	0.5	0.1	
Final conditions for steady state control reactions with ARIH1	
E3*	[E1] (µM)	[UB] (µM)	[ARIH1] (µM)	[UBE2L3] (µM)	[CRL] (µM)	[Substrate] (µM)	
CRL2FEM1C	0.5	12.5	5	10	0.25	0.1	
*E3 represents all three unneddylated, neddylated and ΔWHB CRL1 and CRL2 complexes

Ubiquitylation assays comparing WT and S138D UBE2R2 substrate priming and poly-ubiquitin chain extension

For this step, 1 µM WT or S138D UBE2R2 was charged with 20 µM WT ubiquitin by adding 1 µM E1 in reaction buffer (30 mM Tris pH 7.5, 100 mM NaCl, 5 mM MgCl2, 2 mM ATP and 1 mM DTT) for 15 min at room temperature. Subsequently, the UBE2R2~WT ubiquitin solution was diluted twofold and incubated with 0.5 μM elongin B/C–VHL, 0.5 µM neddylated CUL2–RBX1 and 0.2 µM Hif1α peptide (that had been labeled with fluorescein) for the indicated time points (Extended Data Fig. 5a) before being quenched with 2× SDS–PAGE buffer (100 mM Tris-HCl pH 6.8, 20% glycerol, 30 mM EDTA, 4% SDS and 4% β-mercaptoethanol). Substrates and products were separated by SDS–PAGE and scanned on an Amersham Typhoon system (GE Healthcare).

Generation and purification of activity-based probes

Activity-based probes (ABPs) were used to mimic the native intermediate of donor ubiquitin transfer to CRL substrate-linked acceptor ubiquitin by UBE2R2 (see Fig. 1b). The linear fusions of a Sil1 peptide that had been optimized for FEM1C binding17 or BRD4 (352–460) were produced with K48C acceptor ubiquitin and expressed in bacteria (see both Table 3 for the Sil1 amino acid sequence and the ‘Cloning, expression and purification’ section at the beginning of the Methods for the full fusion sequences). Similarly, a linear fusion of cyclin E peptide with K48C ubiquitin was generated via the sortase-mediated transpeptidation reaction. All ABPs used His-tagged-ubiquitin(1–75)–MESNa and its conjugation to the compound (E)-3-[2-(bromomethyl)-1,3-dioxolan-2-yl]prop-2-en-1-amine (BmDPA) as previously described21. Reactive His-ubiquitin(1–75)–BmDPA (which mimics the donor ubiquitin in the final trapped complex; 0.5 mg ml−1 final) was incubated with 100 µM K48C ubiquitin–Sil1 fusion, 100 µM K48C ubiquitin–BRD4 (352–460) or 100 µM K48C ubiquitin–cyclin E peptide for 1 h at 30 °C. The ABP was purified by size-exclusion chromatography in a column that had been equilibrated with a buffer containing 25 mM HEPES pH 7.5 and 150 mM NaCl.

Formation of trapped CRL complexes

To form the trapped poly-ubiquitin chain-forming complex (containing neddylated CUL2–RBX1 and substrate receptor Elongin B/C–FEM1C, neddylated CUL2–RBX1 and substrate receptor Elongin B/C–VHL–MZ1 or neddylated CUL1–RBX1 and substrate receptor SKP1–FBXW7), UBE2R2 was incubated with 1 mM TCEP for 20 min on ice and desalted (Zeba spin columns) into a buffer that contained 25 mM HEPES pH 7.5 and 150 mM NaCl. Next, 7.5 µM desalted UBE2R2 was immediately added to other complex components including 7.5 µM neddylated CRL2FEM1C, 7.5 µM neddylated CRL2VHL-MZ1 or neddylated CRL1FBXW7 and a sixfold molar excess of ABP. The reactions were incubated for 30 min at 30 °C. The trapped complex was purified by size-exclusion chromatography on a column that had been equilibrated in a buffer containing 25 mM HEPES pH 7.5, 75 mM NaCl and 1 mM TCEP.

Cryo-EM

Sample preparation

The trapped poly-ubiquitin chain formation complexes were prepared as described in the previous section. The CRL2FEM1C–Sil1 peptide and neddylated CRL2FEM1C–Sil1 peptide complexes (that is, in the absence of E2 or donor ubiquitin) were formed by adding 7.5 µM CUL2–RBX1 or neddylated CUL2–RBX1, respectively, with 7.5 µM Elongin B/C–FEM1C substrate receptor complex and 7.5 µM Sil1 peptide substrate, and then incubated on ice for 15 min. Complexes were purified by size-exclusion chromatography on a column that had been equilibrated with a buffer containing 25 mM HEPES pH 7.5, 100 mM NaCl and 1 mM TCEP. A total of 3.5 µl of the purified complexes were applied onto R1.2/1.3 holey carbon grids (Quantifoil) and blotted with a blot force of 4 for 3.5 s using a Vitrobot Mark IV (4 °C, 100% humidity). Grids were subsequently plunge-frozen in liquid ethane.

Data collection

Three datasets (CRL2FEM1C-Sil1, NEDD8–CRL2FEM1C-Sil1 and NEDD8–CRL1FBXW7-cyclin E-UBA-UBE2R2~ubiquitin) were recorded on a 200 kV Glacios transmission electron microscope using a K2 direct detector set to counting mode and SerialEM software. The datasets consisted of 2,632, 2,820 and 3,192 micrographs, respectively, with a pixel size of 1.885 Å. The total exposure for each dataset was 59–60 electrons Å−2 (40 frames), and the defocus value ranged between −0.6 and −2.6 µm.

The datasets for the NEDD8–CRL2FEM1C-Sil1-UBA–UBE2R2~ubiquitin and NEDD8–CRL2VHL-MZ1-BRD4-UBA–UBE2R2~ubiquitin complexes (14,022 and 4,848 total micrographs, respectively) were collected on a 300 kV Titan Krios transmission electron microscope with a pixel size of 0.851 Å, using a K3 direct detector in counting mode and SerialEM software. The total exposure was set to 66 electrons Å−2 (38 frames) with a defocus ranging from −0.6 to −2.2 µm. Representative micrographs can be found in Supplementary Fig. 1.

Data processing

All datasets were processed in RELION v.3.1.1 (ref. 90). First, the raw movie frames were aligned and dose-weighted using MotionCorr2 v.1.1.0 (ref. 91). Second, CTFFIND4 was used to estimate the contrast-transfer function92. Particle picking was performed using Gautomatch v0.56. The ab initio NEDD8–CRL2FEM1C-Sil1-UBA–UBE2R2~ubiquitin trapped complex reconstruction was performed in cryoSPARC v4.2.093. All further operations, including 2D classification, 3D classification, global, local and focused 3D refinement and post-processing, were done in RELION v.3.1.1. Processing schemes are shown in Extended Data Fig. 2 for the CRL2FEM1C chain formation structure and Extended Data Fig. 8 for both unmodified and neddylated CRL2FEM1C in the absence of UBE2R2 and donor ubiquitin. Cryo-EM data for the NEDD8–CRL1FBXW7-cyclin E-UBA–UBE2R2~ubiquitin and NEDD8–CRL2VHL-MZ1-BRD4-UBA–UBE2R2~ubiquitin chain formation complexes were processed in a similar manner as shown in Extended Data Fig. 2. For the latter complex, the map was kept binned (1.925 Å pixel size) owing to the reconstruction not reaching high resolution (the final resolution was 7 Å).

For the high-resolution, NEDD8–CRL2FEM1C-Sil1-UBA–UBE2R2~ubiquitin dataset, two classes were initially observed during data processing with differing density for the donor ubiquitin. As such, the final reconstruction was made using particles with visible donor ubiquitin. Additionally, to best extract certain features of the complex, a series of focused maps were generated, masking on: (1) CUL2–Elongin B/C–FEM1C404–C–RBX15–35; (2) FEM1CN–404–UBE2R2~UBD–UBA–Sil1–RBX135–104; (3) FEM1C150–404–UBE2R2~UBD–UBA–Sil1–RBX135–104; (4) CUL2429–556–FEM1CN–404–UBE2R2~UBD–UBA–Sil1–RBX130–104; and (5) CUL2429–556–FEM1C150–404–UBE2R2~UBD–UBA–Sil1–RBX130–104 (Extended Data Fig. 2a). All final maps were post-processed using DeepEMhancer94.

Model building

The high-resolution NEDD8–CRL2FEM1C-Sil1-UBA–UBE2R2~ubiquitin structure was built using five focused-refined maps, displaying high-resolution features of certain parts of the complex (Extended Data Fig. 2). Map one was used to build CUL21–563, Elongin B/C, FEM1C404–C and RBX121–35. FEM1C150–404 was built using map two and Sil1 peptide substrate using map five. The UBE2R2 catalytic domain (except the synergy loop, residues 98–113) was built using map three while the synergy loop was modeled based on density from map four. The RBX1 RING domain (36–104) was built using maps three and five. Both donor and acceptor ubiquitins (UBD and UBA) were built using maps three and five. The C/R domain of CUL2563–644 and FEM1C’s N-terminal domain (3–150) (PDB 5N4W and 6LBN, respectively) were docked into maps one and two, respectively, using rigid-body refinement in UCSF Chimera95.

An initial model was made using previously determined crystal structures of single components or subcomplexes: UBE2R2 (PDB 6NYO), ubiquitin (donor and acceptor) and RBX1 (PDB 6TTU), CUL2–Elongin B/C (PDB 5N4W) and FEM1C3–373 (PDB 6LBN). FEM1C373–C was built de novo using AlphaFold2 (ref. 96). The coordinates for these subunits were first manually placed into the cryo-EM maps followed by rigid-body refinement in UCSF Chimera95. Next, manual model building in COOT97 and real-space refinement using Phenix.refine98 were performed iteratively until good map-to-model correlations and geometries were achieved. Stretches of protein subunits that lacked clear electron density in the maps were excluded from the model. Side chains were built for residues that showed well-resolved density in the cryo-EM maps. For regions of the cryo-EM maps in which tracing of the backbone was feasible, coordinates for side chains from previous crystal structures were included or based on the results from protein mutagenesis performed in this study.

The composite map (Extended Data Fig. 2b) was constructed manually by combining better-resolved DeepEMhancer sharpened maps from focused refinements. Focused maps were also deposited as additional maps (EMD-17822). The consensus map served as a base for resampling of the focused maps. The composite map was used to build atomic coordinates of the structure. The final model for the neddylated CRL2FEM1C-Sil1-UBA–UBE2R2~ubiquitin complex was refined using the composite map. All figures displaying structures were generated with ChimeraX v1.4 software99.

Reporting summary

Further information on research design is available in the Nature Portfolio Reporting Summary linked to this article.

Online content

Any methods, additional references, Nature Portfolio reporting summaries, source data, extended data, supplementary information, acknowledgements, peer review information; details of author contributions and competing interests; and statements of data and code availability are available at 10.1038/s41594-023-01206-1.

Supplementary information

Supplementary Information Supplementary Fig. 1.

Reporting Summary

Peer Review File

Supplementary Video 1 Structural basis illuminating how CRLs poly-ubiquitylate their substrates.

Supplementary Video 2 RING-induced conformational closing of the UBE2R2–donor ubiquitin interface.

Supplementary Video 3 UBE2R2’s synergy loop unites RBX1’s RING domain, donor and acceptor ubiquitins for catalysis.

Supplementary Video 4 Generalized millisecond poly-ubiquitin chain formation across CRLs.

Source data

Source Data Fig. 2 Unprocessed autoradiograms.

Source Data Fig. 2 Statistical source data for Fig. 2.

Source Data Fig. 3 Unprocessed autoradiograms.

Source Data Fig. 3 Statistical source data for Fig. 3.

Source Data Fig. 4 Unprocessed autoradiograms.

Source Data Fig. 4 Statistical source data for Fig. 4.

Source Data Fig. 6 Unprocessed autoradiograms.

Source Data Fig. 6 Statistical source data for Fig. 6.

Source Data Extended Data Fig. 1 Unprocessed Coomassie-stained SDS–PAGE gel.

Source Data Extended Data Fig. 3 Unprocessed Coomassie-stained SDS–PAGE gel and autoradiograms.

Source Data Extended Data Fig. 3 Statistical source data for Extended Data Fig. 3.

Source Data Extended Data Fig. 4 Unprocessed Coomassie-stained SDS–PAGE gel and autoradiograms.

Source Data Extended Data Fig. 4 Statistical source data for Extended Data Fig. 4.

Source Data Extended Data Fig. 5 Unprocessed Coomassie-stained SDS–PAGE gel, fluorescence-scanned gel and autoradiograms.

Source Data Extended Data Fig. 5 Statistical source data for Extended Data Fig. 5.

Source Data Extended Data Fig. 6 Unprocessed autoradiograms.

Source Data Extended Data Fig. 6 Statistical source data for Extended Data Fig. 6.

Source Data Extended Data Fig. 7 Unprocessed autoradiograms.

Source Data Extended Data Fig. 7 Statistical source data for Extended Data Fig. 7.

Extended data

Extended Data Fig. 1 Formation of an activity-based probe to capture millisecond poly-ubiquitin chain formation.

a, Coomassie-stained SDS-PAGE gel examining reactions containing wild-type (WT) or catalytically inactive UBE2R2 with the ligation mimic (defined as the donor ubiquitin cross-linked to the BmDPA molecule, see Methods) and in the absence or presence of neddylated CRL2FEM1C or separated CRL components. The red box identifies the “trapped” UBE2R2 ~ UBD-substrate-UBA product. Notice that formation of the trapped complex was dependent on the presence of WT UBE2R2 containing its C-terminal acidic tail and an intact CRL containing the substrate receptor complex (FEM1C-ELOBC, Elongin B/C-FEM1C; UBD, donor ubiquitin; UBA, acceptor ubiquitin; UBE2R2 FL, full-length; MW, molecular weight). The gel is representative of duplicate technical replicates. b, Electron density from the composite cryo-EM map highlighting the UBE2R2 active site region including UBD’s C-terminal tail, UBA, and the UBE2R2 synergy loop. While visualization of UBA’s Lys48 was not possible owing to its replacement with a Cys to promote trap formation, clear density is visible for synergy loop residue His98, previously shown to be important for UBE2R2 activity32, whose side-chain imidazole ring points towards the UBE2R2 active site Cys93. c, Select regions of the composite cryo-EM map and ribbon diagrams of the corresponding protein subunits. Ball-and-sticks are shown for residues where side-chains were built. Top-left, the central stalk of CUL2; top-right, donor ubiquitin (UBD) and RBX1; middle-left, the “trap” indicating the location for the ligation mimic-UBE2R2-crosslinked junction; middle-right, Elongin B/C with part of FEM1C; bottom, the catalytic core with UBE2R2, RBX1, and donor and acceptor ubiquitins (UBD and UBA, respectively).

Source data

Extended Data Fig. 2 Cryo-EM structure determination of the CRL poly-ubiquitin chain formation complex.

a, Flow chart describing the processing of the cryo-EM dataset (also see Table 1). The consensus map was refined to 3.76 Å. Additionally, five distinct focused maps were generated, with masking on the following subunits and the indicated residue ranges: (1) CUL2-Elongin B/C-FEM1C (residues 404-C)-RBX1 (residues 5-35); (2) FEM1C (residues N-404)-UBE2R2~UBD-UBA-Sil1 peptide-RBX1 (residues 35-104); (3) FEM1C (residues 150-404)-UBE2R2~UBD-UBA-Sil1-RBX1 (residues 35-104); (4) CUL2 (residues 429-556)-FEM1C (residues N-404)-UBE2R2~UBD-UBA-Sil1-RBX1 (residues 30-104); and (5) CUL2 (residues 429-556)-FEM1C (residues 150-404)-UBE2R2~UBD-UBA-Sil1-RBX1 (residues 30-104). N or C refer to N- or C-terminal residues. b, Final image of the composite cryo-EM map generated by merging all of the focused maps. c, Cryo-EM density of the consensus map as colored by the indicated local resolution. d, Graph plotting the Fourier shell correlation (FSC) versus inverse resolution (3.76 Å resolution at FSC = 0.143). e, Angular distribution of the consensus map. UBD, donor ubiquitin; UBA, acceptor ubiquitin.

Extended Data Fig. 3 The CRL poly-ubiquitin chain formation structure shows donor ubiquitin in an activated conformation.

a, Superposition of UBE2R2~donor ubiquitin (UBD) from the neddylated CRL2FEM1C-Sil1-UBA-UBE2R2~UBD structure (cyan and dark orange, respectively) with the previously published x-ray structure of UBE2R2 ~ UBD bound to an allosteric inhibitor (gray; PDB code 6NYO). The structural alignment was performed on the E2 UBC domains. b, Same as in a, except with UBE2D1 ~ UBD bound to the RNF4 E3 RING domain (not shown). Also see Supplementary Video 2. c, Multiple sequence alignment of various human E2s (top). The star indicates the position of the catalytic Cys. Fully conserved residues have been labeled with an asterisk. A multiple sequence alignment of Cdc34/UBE2R and Ubc7/UBE2G-family E2s highlighting conservation of various positions in the synergy loop has also been provided (bottom). d, Ribbon diagram highlighting the positions of synergy loop residues (shown as ball-and-sticks). Residues colored red were shown upon their mutation to be defective in poly-ubiquitin chain formation. e, Schematic of the UBE2R2 unanchored, di-ubiquitin chain synthesis assay in the presence of neddylated cullin-RBX1 (R) without substrate receptors. Donor ubiquitin (UBD) and acceptor ubiquitin (UBA) are covalently joined (UBD-UBA) to form product. f, Coomassie-stained SDS-PAGE gel comparing di-ubiquitin product formation for 32P-labeled K48R ubiquitin (that contained an N-terminal tag that enabled phosphorylation by protein kinase A) and unlabeled K48R ubiquitin without a tag. The gel is representative of duplicate technical replicates. UB, ubiquitin. g, Bar graph showing fold defects in di-ubiquitin chain synthesis for synergy loop mutants in comparison with wild-type. The value of each bar represents the estimated value of ‘fold-defect’ based on n = 2 technical replicates.

Source data

Extended Data Fig. 4 Unanchored di-ubiquitin chain synthesis enables estimation of the Km and the apparent affinity of acceptor ubiquitin for UBE2R-family E2s.

a, Autoradiogram showing UBD-UBA formation for reactions containing UBE2R2, neddylated CUL2-RBX1, and increasing UBA concentrations. The gel migrations of radiolabeled UBD (indicated by *) and UBA-UBD product are shown (top). The graph shows the fraction of UBA-UBD product formed as a function of the unanchored UBA concentration with wild-type (WT) components (bottom). The data were fit to the Michaelis-Menten model (GraphPad Prism software v9) to estimate the Km of UBA for the UBE2R2-mediated poly-ubiquitylation complex. The autoradiogram is representative of triplicate technical replicates. UBD, donor ubiquitin; UBA, acceptor ubiquitin. b, Graphs showing the fraction of di-ubiquitin product formation (UBD-UBA) as a function of the unanchored acceptor ubiquitin (UBA) concentration with WT or mutant protein components (the assay setup is shown in Extended Data Fig. 3e). The data were fit to the Michaelis-Menten model using non-linear regression (GraphPad Prism software v9). Datapoints from triplicate technical replicates are shown. c, Autoradiograms showing time courses for the formation of free UBA-UBD product with WT UBE2R2. Reactions were performed in the absence (w/o) or presence of WT neddylated CUL2-RBX1 or a mutant harboring a R91E RBX1 subunit. All autoradiograms are representative of triplicate technical replicates. d, Graph showing product formation normalized to the ratio of the UBD and UBE2R2 concentrations with respect to time. Rates were derived by linear regression in Prism. Estimates are based on n = 3 technical replicates. e, Coomassie-stained SDS-PAGE gel comparing the loading of WT UBE2R2 with K48R or K48R/R74E donor ubiquitins and upon titration of E1 enzyme (top). The graph shows the fraction of the total ubiquitin thioesterified to UBE2R2 (bottom; based on n = 2 technical replicates). The results determined the E1 concentration in subsequent experiments with K48R/R74E donor ubiquitin (see methods). The gel is representative of duplicate technical replicates. UB, ubiquitin. f, Bar graphs comparing the Km values of unanchored UBA for UBE2R1 in the presence of neddylated CUL2-RBX1 and the indicated mutants. Bars showing a ‘>‘ reflect reactions where saturation of UBE2R2 with UBA was not feasible (the top concentration in the dilution series is shown). The value of each bar represents the estimated value for Km based on n = 3 technical replicates.

Source data

Extended Data Fig. 5 Ubiquitin-primed CRL substrate ubiquitylation enables estimation of the rate of poly-ubiquitin chain formation kobs.

a, Fluorescence-scanned gel showing ubiquitylation reactions comparing wild-type (WT) and S138D UBE2R2 activity with Hif1α peptide substrate (see methods). Notice that, while S138D UBE2R2 is highly defective at poly-ubiquitin chain formation, it can prime substrate, facilitating production of highly pure Sil1-ubiquitin substrate. The scan is representative of duplicate technical replicates. UB, ubiquitin. b, Schematic of the production strategy for substrate-ubiquitin synthesis. c, Coomassie-stained SDS-PAGE gel showing purification of Sil1-ubiquitin. Following the ubiquitylation reaction (R), Sil1-ubiquitin was first separated from unreacted peptide owing to ubiquitin’s N-terminal Histidine tag (Ni) followed by gel filtration chromatography. The gel is representative of triplicate technical replicates. SEC, size exclusion chromatography. d, Illustration of the Rapid Quench Flow (RQF) device (Kintek) used to estimate the rates of poly-ubiquitin chain formation (kobs) on ubiquitin-primed CRL substrates by UBE2R2. Timepoints are computer-controlled according to the speed of a plate pushing against the syringe plungers, first mixing the reactants followed by introduction of the quench buffer. e, Autoradiogram showing a time course from quench flow, pre-steady state kinetic ubiquitylation reactions with neddylated CRL2FEM1C. The gel migrations of radiolabeled, ubiquitin-primed Sil1 substrate (indicated by *) and ubiquitylated product are shown (top). The graph shows the fraction of remaining substrate as a function of time in the presence of WT proteins (bottom). The autoradiogram is representative of triplicate technical replicates. f, Graphs showing the fraction of ubiquitin-primed Sil1 substrate remaining as a function of time with WT or mutant proteins. The data were fit to a single exponential decay model (GraphPad Prism software v9). Datapoints from triplicate technical replicates are shown. g, Bar graph comparing the ubiquitin transfer rates (kobs) for the indicated proteins in reactions that contained neddylated CRL2FEM1C, Sil1-ubiquitin substrate, and UBE2R1. The value of each bar represents the estimated value of kobs based on n = 3 technical replicates. UBD, donor ubiquitin; UBA, acceptor ubiquitin.

Source data

Extended Data Fig. 6 Generalized mechanism for CRL-dependent substrate poly-ubiquitylation.

a, Modelling of the RBX1-UBE2R2 ~ UBD-UBA portion of the chain formation structure (PDB code: 8PQL, this work) onto three other CRL substrate receptor complexes: SKP1-βTRCP1 (left; PDB code 6TTU), SKP1-SKP2 (middle; PDB code 7B5L), and Elongin B/C-VHL (right; PDB code 1LM8). b, Autoradiogram from quench flow, pre-steady state kinetic ubiquitylation reactions with neddylated CRL2VHL and ubiquitin-primed Hif1α peptide substrate that had been radiolabeled (indicated by *). The graph showing substrate conversion to product and the fit of the data to the model can be found in Extended Data Fig. 7a. The autoradiogram is representative of triplicate technical replicates. UB, ubiquitin. c, Graph corresponding to ubiquitylation reactions containing neddylated CRL1FBXW7 with wild-type (WT) or mutant ubiquitin-primed cyclin E peptide substrates and WT or mutant UBE2R2. The data were fit to closed form solutions using Mathematica19 (v.13.1). Datapoints from triplicate technical replicates are shown. d, Superposition of the CUL2 C-terminal domains from the CRL2VHL-MZ1-BRD4-UBA-UBE2R2~UBD (gray) and CRL2FEM1C-Sil1- UBA-UBE2R2~UBD structures (green and blue), showing translation of the RBX1 RING domains that enables repositioning of UBE2R2~ubiquitin relative to substrate. e, Autoradiogram for BRD4BD2 ubiquitylation reactions in the presence of neddylated CRL2VHL, the PROTAC MZ1, UBE2R2 and WT ubiquitin. Notice the sequential appearance of ubiquitin-primed BRD4 (BRD4BD2-UB) and poly-ubiquitylated BRD4 (BRD4BD2-UB-UB) which enabled estimation of the rate of ubiquitin transfer to primed neo-substrate (Fig. 4e and Extended Data Table 1; see methods). The autoradiogram is representative of triplicate technical replicates. f, Graphs showing depletion of BRD4BD2 (left) or the appearance of primed neo-substrate (right) in the presence of the indicated UBE2R2 proteins and the fit of the data to the model. UBA, acceptor ubiquitin; UBD, donor ubiquitin; BRD4BD2, BRD4 (residues 346-460); ELOB, Elongin B; ELOC, Elongin C.

Source data

Extended Data Fig. 7 NEDD8 activates CRLs for millisecond poly-ubiquitin chain formation by releasing RBX1’s RING domain from cullin.

a, Graphs showing the fraction of ubiquitin-primed peptide substrates remaining with unneddylated CRL (w/o NEDD8, gray), neddylated CRL ( + NEDD8, yellow), unneddylated CRL with deletion of the cullin WHB domain (ΔWHB, light green), and CRL2s containing D660K E664K D675K CUL2 (3 K, dark green). CRL1βTRCP2 (top-left), CRL1FBXW7 (top-right), CRL2FEM1C (bottom-left) and CRL2VHL (bottom-right) E3s were examined. UB, ubiquitin. b, Graphs showing the fraction of ubiquitin-primed peptide substrates converted to ubiquitylated product as a function of UBE2R2 levels in the presence of unneddylated CRL (w/o NEDD8, gray), neddylated CRL ( + NEDD8, yellow), and unneddylated CRL with deletion of the CUL1 WHB domain (ΔWHB, light green). CRL1βTRCP2 (left) and CRL1FBXW7 (right) E3s were examined. c, Bar graphs showing the fraction of ubiquitin-primed peptide substrates converted to product in the presence of the E2 UBE2D3 and the indicated CRL complexes. CRL1βTRCP2 (top) and CRL2FEM1C (bottom) E3s were examined. d, Same as c, except with the E3s ARIH1 and CRL2FEM1C. e, Cryo-EM map of the neddylated CRL2FEM1C complex in the absence of UBE2R2 selected amongst multiple reconstructions. Ribbon diagrams of models corresponding to Elongin B/C-FEM1C (this study) and CUL2 (PDB code 5N4W) were fit into the density. Note the presence of additional electron density potentially corresponding to the RBX1 RING domain. f, Same as in e, except showing a cryo-EM map of the unneddylated CRL2FEM1C complex. g, Same as in f except with ribbon diagrams of CUL2-RBX1 (top; PDB code 5N4W) or CUL1-RBX1 (bottom; PDB code 1LDJ) fit into the density. h, Superposition of CUL2-RBX1 (green and blue, respectively; PDB code 5N4W) onto the structure of a neddylated CRL1 bound to UBE2D (PDB code 6TTU, yellow). Severe steric clashing may be observed between NEDD8 and CUL2. The structural alignment was performed on the WHB domains. i, Ribbon diagram showing CUL1’s WHB domain (green) in complex with conjugated NEDD8 (yellow; PDB code 6TTU). The position of NEDD8’s Gln40 residue is shown. j, Graph corresponding to ubiquitylation reactions with ubiquitin-primed Sil1 peptide substrate and either unneddylated CRL2FEM1C (w/o NEDD8, gray), neddylated CRL2FEM1C (yellow), or neddylated CRL2FEM1C harboring Q40E NEDD8 (red). Graphs are representative of triplicate (a,b and j) or duplicate (c and d) technical replicates. w/o, without.

Source data

Extended Data Fig. 8 Cryo-EM structure determination of unneddylated or neddylated CRL2FEM1C complexes.

a, Flow chart showing the processing of the cryo-EM dataset for the neddylated CRL2FEM1C complex (also see Table 1). Two major conformations that were apparent during classification are depicted. b, same as in a, except for the unneddylated CRL2FEM1C complex.

Extended Data Table 1 Estimates of Km and kobs for CRL1/2-mediated poly-ubiquitin chain formation

Estimates of Km and kobs for CRL1/2-mediated poly-ubiquitin chain formation

aAll substrates are peptides except BRD4BD2 which is a protein; bKm of UBE2R2 for the CRL; cMZ1 is a PROTAC targeting BRD4 neo-substrate through the von Hippel-Lindau (VHL) CRL substrate receptor; BRD4BD2, BRD4 (346-460); 3 K, D660K E664K D675K CUL2-RBX1. The standard error of measurements are shown for all estimates.

Extended data

is available for this paper at 10.1038/s41594-023-01206-1.

Supplementary information

The online version contains supplementary material available at 10.1038/s41594-023-01206-1.

Acknowledgements

We thank J. Kellerman, K. Baek, D. Horn-Ghetko, L. Hopf, L. Hehl, L. Henneberg, J. Basquin, S. von Gronau S. Uebel, S. Pettera and V. Sanchez for assistance, reagents and helpful discussions; and D. Bollschweiler, T. Schäfer and the cryo-EM facility at the Max Planck Institute of Biochemistry (MPIB). We also thank P. Laragan for technical assistance (University of Nevada, Las Vegas) and S. Übel and S. Petera in the MPIB Bioorganic Chemistry and Biophysics Core for peptide synthesis. Molecular graphics and analyses were performed with UCSF ChimeraX, developed by the Resource for Biocomputing, Visualization, and Informatics at the University of California, San Francisco, with support from National Institutes of Health (NIH) R01-GM129325 and the Office of Cyber Infrastructure and Computational Biology, National Institute of Allergy and Infectious Diseases. This research was supported by ALSAC, St. Jude Children’s Research Hospital, NIH P30CA021765 to St. Jude, NIH R01GM125885 (D.C.S. and B.A.S.), NIH R01GM141409 (J. Li, N.P., C.R. and G.K.) and Max-Planck-Gesellschaft and the EU H2020 ERC Advanced Grant Nedd8Activate-789016 (J. Liwocha, S.M., D.T.K., J.R.P. and B.A.S.). The funders had no role in study design, data collection and analysis, decision to publish or preparation of the manuscript.

Author contributions

J. Liwocha, J. Li, N.P., C.R., S.M., D.T.K., B.S. and D.C.S. generated protein complexes and/or performed biochemical and biophysical characterization. J. Liwocha designed and generated activity-based probes. J. Li, N.P., C.R. and G.K. performed ubiquitylation assays, kinetics experiments and analyzed the results. J. Liwocha and S.M. collected, processed and refined the neddylated CRL2VHL-MZ1-BRD4 poly-ubiquitin chain formation complex dataset. J. Liwocha collected, processed and refined all other cryo-EM datasets. J. Liwocha and J.R.P. built and refined the poly-ubiquitin chain formation structure. J. Liwocha, B.A.S. and G.K. prepared the paper with input from all other authors. B.A.S. and G.K. supervised the project.

Peer review

Peer review information

Nature Structural & Molecular Biology thanks Yogesh Kulathu and the other, anonymous, reviewer(s) for their contribution to the peer review of this work. Primary Handling Editor: Dimitris Typas, in collaboration with the rest of the Nature Structural & Molecular Biology team. Peer reviewer reports are available.

Funding

Open access funding provided by Max Planck Society.

Data availability

The atomic coordinates and electron microscopy maps have been deposited in the Protein Data Bank with accession code PDB 8PQL and in the Electron Microscopy Data Bank with codes EMD-17803 (consensus map) and EMD-17822 (composite map) for the neddylated CRL2FEM1C poly-ubiquitin chain formation complex, EMD-17802 for the neddylated CRL1FBXW7 poly-ubiquitin chain formation complex, EMD-18767 for the neddylated CRL2VHL-MZ1-BRD4 poly-ubiquitin chain formation complex, EMD-17798 and EMD-17799 for the CRL2FEM1C complex and EMD-17800 and EMD-17801 for the neddylated CRL2FEM1C complex. Publicly available PDB entries are 1LDJ, 1LM8, 4AP4, 5AIT, 5N4W, 6LBN, 6NYO, 6TTU, 7B5L, 7MEY and 7OJX. Source data are provided with this paper.

Competing interests

B.A.S. is a member of the scientific advisory boards of Proxygen and BioTheryX, and co-inventor of intellectual property licensed to Cinsano. The other authors declare no competing interests.

Publisher’s note Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

These authors contributed equally: Joanna Liwocha, Jerry Li.

These authors jointly supervised this work: Brenda A Schulman, Gary Kleiger.
==== Refs
References

1. Rape M Ubiquitylation at the crossroads of development and disease Nat. Rev. Mol. Cell Biol. 2018 19 59 70 28928488
2. Komander D Rape M The ubiquitin code Annu. Rev. Biochem. 2012 81 203 229 22524316
3. Spence J Sadis S Haas AL Finley D A ubiquitin mutant with specific defects in DNA repair and multiubiquitination Mol. Cell. Biol. 1995 15 1265 1273 7862120
4. Xu P Quantitative proteomics reveals the function of unconventional ubiquitin chains in proteasomal degradation Cell 2009 137 133 145 19345192
5. Kim W Systematic and quantitative assessment of the ubiquitin-modified proteome Mol. Cell 2011 44 325 340 21906983
6. Chau V A multiubiquitin chain is confined to specific lysine in a targeted short-lived protein Science 1989 243 1576 1583 2538923
7. Goebl MG The yeast cell cycle gene CDC34 encodes a ubiquitin-conjugating enzyme Science 1988 241 1331 1335 2842867
8. Mathias N Cdc53p acts in concert with Cdc4p and Cdc34p to control the G1-to-S-phase transition and identifies a conserved family of proteins Mol. Cell. Biol. 1996 16 6634 6643 8943317
9. Feldman RM Correll CC Kaplan KB Deshaies RJ A complex of Cdc4p, Skp1p, and Cdc53p/cullin catalyzes ubiquitination of the phosphorylated CDK inhibitor Sic1p Cell 1997 91 221 230 9346239
10. Skowyra D Craig KL Tyers M Elledge SJ Harper JW F-box proteins are receptors that recruit phosphorylated substrates to the SCF ubiquitin-ligase complex Cell 1997 91 209 219 9346238
11. Harper JW Schulman BA Cullin-RING ubiquitin ligase regulatory circuits: a quarter century beyond the F-box hypothesis Annu. Rev. Biochem. 2021 90 403 429 33823649
12. Rusnac DV Zheng N Structural biology of CRL ubiquitin ligases Adv. Exp. Med. Biol. 2020 1217 9 31 31898219
13. Willems AR Schwab M Tyers M A hitchhiker’s guide to the cullin ubiquitin ligases: SCF and its kin Biochim. Biophys. Acta 2004 1695 133 170 15571813
14. Mahrour N Characterization of cullin-box sequences that direct recruitment of Cul2–Rbx1 and Cul5–Rbx2 modules to Elongin BC-based ubiquitin ligases J. Biol. Chem. 2008 283 8005 8013 18187417
15. Ivan M HIFα targeted for VHL-mediated destruction by proline hydroxylation: implications for O2 sensing Science 2001 292 464 468 11292862
16. Yan X Molecular basis for ubiquitin ligase CRL2FEM1C-mediated recognition of C-degron Nat. Chem. Biol. 2021 17 263 271 33398170
17. Chen X Molecular basis for arginine C-terminal degron recognition by Cul2FEM1 E3 ligase Nat. Chem. Biol. 2021 17 254 262 33398168
18. Koren I The eukaryotic proteome is shaped by E3 ubiquitin ligases targeting C-terminal degrons Cell 2018 173 1622 1635.e14 29779948
19. Pierce NW Kleiger G Shan SO Deshaies RJ Detection of sequential polyubiquitylation on a millisecond timescale Nature 2009 462 615 619 19956254
20. Pan ZQ Kentsis A Dias DC Yamoah K Wu K Nedd8 on cullin: building an expressway to protein destruction Oncogene 2004 23 1985 1997 15021886
21. Horn-Ghetko D Ubiquitin ligation to F-box protein targets by SCF–RBR E3–E3 super-assembly Nature 2021 590 671 676 33536622
22. Baek K NEDD8 nucleates a multivalent cullin–RING–UBE2D ubiquitin ligation assembly Nature 2020 578 461 466 32051583
23. Wu K Kovacev J Pan ZQ Priming and extending: a UbcH5/Cdc34 E2 handoff mechanism for polyubiquitination on a SCF substrate Mol. Cell 2010 37 784 796 20347421
24. Schwob E Bohm T Mendenhall MD Nasmyth K The B-type cyclin kinase inhibitor p40SIC1 controls the G1 to S transition in S. cerevisiae Cell 1994 79 233 244 7954792
25. Brzovic PS Klevit RE Ubiquitin transfer from the E2 perspective: Why is UbcH5 so promiscuous? Cell Cycle 2006 5 2867 2873 17218787
26. Metzger MB Pruneda JN Klevit RE Weissman AM RING-type E3 ligases: master manipulators of E2 ubiquitin-conjugating enzymes and ubiquitination Biochim. Biophys. Acta 2014 1843 47 60 23747565
27. Deshaies RJ Joazeiro CA RING domain E3 ubiquitin ligases Annu. Rev. Biochem. 2009 78 399 434 19489725
28. Saha A Lewis S Kleiger G Kuhlman B Deshaies RJ Essential role for ubiquitin–ubiquitin-conjugating enzyme interaction in ubiquitin discharge from Cdc34 to substrate Mol. Cell 2011 42 75 83 21474069
29. Williams KM Structural insights into E1 recognition and the ubiquitin-conjugating activity of the E2 enzyme Cdc34 Nat. Commun. 2019 10 3296 31341161
30. Liwocha J Linkage-specific ubiquitin chain formation depends on a lysine hydrocarbon ruler Nat. Chem. Biol. 2021 17 272 279 33288957
31. Kleiger G Hao B Mohl DA Deshaies RJ The acidic tail of the Cdc34 ubiquitin-conjugating enzyme functions in both binding to and catalysis with ubiquitin ligase SCFCdc4 J. Biol. Chem. 2009 284 36012 36023 19875449
32. Ziemba A Multimodal mechanism of action for the Cdc34 acidic loop: a case study for why ubiquitin-conjugating enzymes have loops and tails J. Biol. Chem. 2013 288 34882 34896 24129577
33. Petroski MD Deshaies RJ Mechanism of lysine 48-linked ubiquitin-chain synthesis by the cullin-RING ubiquitin-ligase complex SCF-Cdc34 Cell 2005 123 1107 1120 16360039
34. Mathias N Steussy CN Goebl MG An essential domain within Cdc34p is required for binding to a complex containing Cdc4p and Cdc53p in Saccharomyces cerevisiae J. Biol. Chem. 1998 273 4040 4045 9461595
35. Silver ET Gwozd TJ Ptak C Goebl M Ellison MJ A chimeric ubiquitin conjugating enzyme that combines the cell cycle properties of CDC34 (UBC3) and the DNA repair properties of RAD6 (UBC2): implications for the structure, function and evolution of the E2s EMBO J. 1992 11 3091 3098 1639076
36. Liu Y Mathias N Steussy CN Goebl MG Intragenic suppression among CDC34 (UBC3) mutations defines a class of ubiquitin-conjugating catalytic domains Mol. Cell. Biol. 1995 15 5635 5644 7565715
37. Pitluk ZW McDonough M Sangan P Gonda DK Novel CDC34 (UBC3) ubiquitin-conjugating enzyme mutants obtained by charge-to-alanine scanning mutagenesis Mol. Cell. Biol. 1995 15 1210 1219 7862115
38. Gazdoiu S Yamoah K Wu K Pan Z-Q Human Cdc34 employs distinct sites to coordinate attachment of ubiquitin to a substrate and assembly of polyubiquitin chains Mol. Cell. Biol. 2007 27 7041 7052 17698585
39. Hill S Robust cullin-RING ligase function is established by a multiplicity of poly-ubiquitylation pathways Elife 2019 8 e51163 31868589
40. Sandoval D Ubiquitin-conjugating enzyme Cdc34 and ubiquitin ligase Skp1–Cullin–F-box ligase (SCF) interact through multiple conformations J. Biol. Chem. 2015 290 1106 1118 25425648
41. Kleiger G Saha A Lewis S Kuhlman B Deshaies RJ Rapid E2–E3 assembly and disassembly enable processive ubiquitylation of cullin-RING ubiquitin ligase substrates Cell 2009 139 957 968 19945379
42. Sakata E Direct interactions between NEDD8 and ubiquitin E2 conjugating enzymes upregulate cullin-based E3 ligase activity Nat. Struct. Mol. Biol. 2007 14 167 168 17206147
43. Saha A Deshaies RJ Multimodal activation of the ubiquitin ligase SCF by Nedd8 conjugation Mol. Cell 2008 32 21 31 18851830
44. Yamoah K Autoinhibitory regulation of SCF-mediated ubiquitination by human cullin 1’s C-terminal tail Proc. Natl Acad. Sci. USA 2008 105 12230 12235 18723677
45. Cardote TAF Gadd MS Ciulli A Crystal structure of the Cul2–Rbx1–EloBC–VHL ubiquitin ligase complex Structure 2017 25 901 911.e3 28591624
46. Hamilton KS Ellison MJ Shaw GS Identification of the ubiquitin interfacial residues in a ubiquitin-E2 covalent complex J. Biomol. NMR 2000 18 319 327 11200526
47. Plechanovova A Jaffray EG Tatham MH Naismith JH Hay RT Structure of a RING E3 ligase and ubiquitin-loaded E2 primed for catalysis Nature 2012 489 115 120 22842904
48. Pruneda JN Structure of an E3:E2~Ub complex reveals an allosteric mechanism shared among RING/U-box ligases Mol. Cell 2012 47 933 942 22885007
49. Dou H Buetow L Sibbet GJ Cameron K Huang DT BIRC7–E2 ubiquitin conjugate structure reveals the mechanism of ubiquitin transfer by a RING dimer Nat. Struct. Mol. Biol. 2012 19 876 883 22902369
50. Ceccarelli DF An allosteric inhibitor of the human Cdc34 ubiquitin-conjugating enzyme Cell 2011 145 1075 1087 21683433
51. Huang H E2 enzyme inhibition by stabilization of a low-affinity interface with ubiquitin Nat. Chem. Biol. 2014 10 156 163 24316736
52. Welsh KA Functional conservation and divergence of the helix-turn-helix motif of E2 ubiquitin-conjugating enzymes EMBO J. 2022 41 e108823 34942047
53. Bulatov E Ciulli A Targeting cullin-RING E3 ubiquitin ligases for drug discovery: structure, assembly and small-molecule modulation Biochem. J. 2015 467 365 386 25886174
54. Sievers QL Gasser JA Cowley GS Fischer ES Ebert BL Genome-wide screen identifies cullin-RING ligase machinery required for lenalidomide-dependent CRL4CRBN activity Blood 2018 132 1293 1303 30042095
55. Teng M Gray NS The rise of degrader drugs Cell Chem. Biol. 2023 30 864 878 37494935
56. Wu T Targeted protein degradation as a powerful research tool in basic biology and drug target discovery Nat. Struct. Mol. Biol. 2020 27 605 614 32541897
57. Burslem GM Crews CM Proteolysis-targeting chimeras as therapeutics and tools for biological discovery Cell 2020 181 102 114 31955850
58. Winter GE Phthalimide conjugation as a strategy for in vivo target protein degradation Science 2015 348 1376 1381 25999370
59. Mayor-Ruiz C Plasticity of the cullin-RING ligase repertoire shapes sensitivity to ligand-induced protein degradation Mol. Cell 2019 75 849 858.e8 31442425
60. Cowan AD Ciulli A Driving E3 ligase substrate specificity for targeted protein degradation: lessons from nature and the laboratory Annu. Rev. Biochem. 2022 91 295 319 35320687
61. Bekes M Langley DR Crews CM PROTAC targeted protein degraders: the past is prologue Nat. Rev. Drug Discov. 2022 21 181 200 35042991
62. Gadd MS Structural basis of PROTAC cooperative recognition for selective protein degradation Nat. Chem. Biol. 2017 13 514 521 28288108
63. Zengerle M Chan KH Ciulli A Selective small molecule induced degradation of the BET bromodomain protein BRD4 ACS Chem. Biol. 2015 10 1770 1777 26035625
64. Nakasone MA Structure of UBE2K-Ub/E3/polyUb reveals mechanisms of K48-linked Ub chain extension Nat. Chem. Biol. 2022 18 422 431 35027744
65. Pan M Structural insights into Ubr1-mediated N-degron polyubiquitination Nature 2021 600 334 338 34789879
66. Branigan E Plechanovova A Jaffray EG Naismith JH Hay RT Structural basis for the RING-catalyzed synthesis of K63-linked ubiquitin chains Nat. Struct. Mol. Biol. 2015 22 597 602 26148049
67. Henneberg, L. T. et al. Activity-based profiling of cullin–RING E3 networks by conformation-specific probes. Nat. Chem. Biol. 19, 1513–1523 (2023).
68. Cui J Glutamine deamidation and dysfunction of ubiquitin/NEDD8 induced by a bacterial effector family Science 2010 329 1215 1218 20688984
69. Jubelin G Pathogenic bacteria target NEDD8-conjugated cullins to hijack host-cell signaling pathways PLoS Pathog. 2010 6 e1001128 20941356
70. Schreiber G Fersht AR Rapid, electrostatically assisted association of proteins Nat. Struct. Biol. 1996 3 427 431 8612072
71. Fersht, A. Enzyme structure and mechanism (W.H. Freeman, 1985).
72. Thrower JS Hoffman L Rechsteiner M Pickart CM Recognition of the polyubiquitin proteolytic signal EMBO J. 2000 19 94 102 10619848
73. Sadowski M Mawson A Baker R Sarcevic B Cdc34 C-terminal tail phosphorylation regulates Skp1/cullin/F-box (SCF)-mediated ubiquitination and cell cycle progression Biochem. J. 2007 405 569 581 17461777
74. Choi YS The human Cdc34 carboxyl terminus contains a non-covalent ubiquitin binding activity that contributes to SCF-dependent ubiquitination J. Biol. Chem. 2010 285 17754 17762 20353940
75. Cavadini S Cullin-RING ubiquitin E3 ligase regulation by the COP9 signalosome Nature 2016 531 598 603 27029275
76. Fischer ES The molecular basis of CRL4DDB2/CSA ubiquitin ligase architecture, targeting, and activation Cell 2011 147 1024 1039 22118460
77. Enchev RI Structural basis for a reciprocal regulation between SCF and CSN Cell Rep. 2012 2 616 627 22959436
78. Emberley ED Mosadeghi R Deshaies RJ Deconjugation of Nedd8 from Cul1 is directly regulated by Skp1-F-box and substrate, and the COP9 signalosome inhibits deneddylated SCF by a noncatalytic mechanism J. Biol. Chem. 2012 287 29679 29689 22767593
79. Mosadeghi R Structural and kinetic analysis of the COP9-Signalosome activation and the cullin-RING ubiquitin ligase deneddylation cycle Elife 2016 5 e12102 27031283
80. Lu G UBE2G1 governs the destruction of cereblon neomorphic substrates Elife 2018 7 e40958 30234487
81. Das R Allosteric regulation of E2:E3 interactions promote a processive ubiquitination machine EMBO J. 2013 32 2504 2516 23942235
82. Petroski MD Deshaies RJ In vitro reconstitution of SCF substrate ubiquitination with purified proteins Methods Enzymol. 2005 398 143 158 16275326
83. Scott DC Two distinct types of E3 ligases work in unison to regulate substrate ubiquitylation Cell 2016 166 1198 1214.e24 27565346
84. Brown NG Mechanism of polyubiquitination by human anaphase-promoting complex: RING repurposing for ubiquitin chain assembly Mol. Cell 2014 56 246 260 25306923
85. Scott DC Structure of a RING E3 trapped in action reveals ligation mechanism for the ubiquitin-like protein NEDD8 Cell 2014 157 1671 1684 24949976
86. Weissmann F biGBac enables rapid gene assembly for the expression of large multisubunit protein complexes Proc. Natl Acad. Sci. USA 2016 113 E2564 E2569 27114506
87. Diaz S Li L Wang K Liu X Expression and purification of functional recombinant CUL2•RBX1 from E. coli Sci. Rep. 2021 11 11224 34045610
88. Duda DM Structural insights into NEDD8 activation of cullin-RING ligases: conformational control of conjugation Cell 2008 134 995 1006 18805092
89. Yunus AA Lima CD Lysine activation and functional analysis of E2-mediated conjugation in the SUMO pathway Nat. Struct. Mol. Biol. 2006 13 491 499 16732283
90. Zivanov J New tools for automated high-resolution cryo-EM structure determination in RELION-3 Elife 2018 7 e42166 30412051
91. Zheng SQ MotionCor2: anisotropic correction of beam-induced motion for improved cryo-electron microscopy Nat. Methods 2017 14 331 332 28250466
92. Rohou A Grigorieff N CTFFIND4: fast and accurate defocus estimation from electron micrographs J. Struct. Biol. 2015 192 216 221 26278980
93. Punjani A Rubinstein JL Fleet DJ Brubaker MA cryoSPARC: algorithms for rapid unsupervised cryo-EM structure determination Nat. Methods 2017 14 290 296 28165473
94. Sanchez-Garcia R DeepEMhancer: a deep learning solution for cryo-EM volume post-processing Commun. Biol. 2021 4 874 34267316
95. Pettersen EF UCSF Chimera—a visualization system for exploratory research and analysis J. Comput. Chem. 2004 25 1605 1612 15264254
96. Jumper J Highly accurate protein structure prediction with AlphaFold Nature 2021 596 583 589 34265844
97. Emsley P Lohkamp B Scott WG Cowtan K Features and development of Coot Acta Crystallogr. Biol. Crystallogr. 2010 66 486 501
98. Afonine PV New tools for the analysis and validation of cryo-EM maps and atomic models Acta Crystallogr. Struct. Biol. 2018 74 814 840
99. Goddard TD UCSF ChimeraX: meeting modern challenges in visualization and analysis Protein Sci. 2018 27 14 25 28710774
