doc_id	sent_index	relation_id	relation	trigger	trigger_offset	arg_num	arg_base_np	arg_protein	arg_domain	arg_site	arg_sugar	PSource	SiteSource	NProtein	NID	SiteName	sent_text
34074422	5	50	gly	1737 N-glycosites	1083:1099	arg2	1737 N-glycosites			1737 N-glycosites						1737 N-glycosites	With control of spectrum-level FDR≤1%, 5515 intact N-glycopeptides were identified (1737 N-glycosites, 1705 peptide backbones and 1516 intact N-glycoproteins; 181 putative N-glycan linkages and 68 monosaccharide compositions).
34074422	5	53	gly	identified	1071:1080	arg1	1737 N-glycosites			1737 N-glycosites						1737 N-glycosites	With control of spectrum-level FDR≤1%, 5515 intact N-glycopeptides were identified (1737 N-glycosites, 1705 peptide backbones and 1516 intact N-glycoproteins; 181 putative N-glycan linkages and 68 monosaccharide compositions).
34074422	5	65	gly	N-glycoproteins	1141:1155	arg1	1516 intact N-glycoproteins	1516 intact N-glycoproteins				Fterm		N-glycoproteins			With control of spectrum-level FDR≤1%, 5515 intact N-glycopeptides were identified (1737 N-glycosites, 1705 peptide backbones and 1516 intact N-glycoproteins; 181 putative N-glycan linkages and 68 monosaccharide compositions).
34074422	5	95	gly	N-glycopeptides	1050:1064	arg2	5515 intact N-glycopeptides			5515 intact N-glycopeptides						N-glycopeptides	With control of spectrum-level FDR≤1%, 5515 intact N-glycopeptides were identified (1737 N-glycosites, 1705 peptide backbones and 1516 intact N-glycoproteins; 181 putative N-glycan linkages and 68 monosaccharide compositions).
34872779	2	36	gly	used	447:450	arg2	The chitosan composite			The chitosan composite						composite	The chitosan composite of the iron metal-organic framework (CS/MOF-235), MOF-235 and chitosan were used for the removal of methylene blue (MB) and methyl orange (MO) from aqueous solutions.
34973768	5	8	gly	sequence	784:791	arg1	the monosaccharide composition, sequence and linkage pattern				the monosaccharide composition, sequence and linkage pattern						Applying this combinatorial approach, the monosaccharide composition, sequence and linkage pattern of this novel polymer was determined via HPLC-MS, GC-MS and NMR.
32511307	4	10	part_of	peptides	713:720	arg1	the S glycoprotein	S glycoprotein		peptides		Cterm		S glycoprotein	43740568		Lastly, we have identified peptides in the S glycoprotein that are likely to be presented in human leukocyte antigen (HLA) complexes, and discuss the role of S protein glycosylation in potentially modulating the adaptive immune response to the SARS-CoV-2 virus or to a related vaccine.
32649905	6	20	gly	glycosylation	1202:1214	arg1	a receptor	a receptor				Fterm		receptor			The combined data show that in situ cell-surface fucosylation can be exploited to regulate a specific signaling pathway via endocytosis promoted by a fucose-binding protein, thereby linking glycosylation of a receptor with its intracellular signaling.
32607666	2	80	gly	Cal+	354:357	arg1	Calcofluor-binding polysaccharides	Cal			Calcofluor-binding polysaccharides	OGER		Cal	Q9HD26		Its major surface glycopolymers consist of lipopolysaccharides (LPS) and Calcofluor-binding polysaccharides (Cal+ phenotype).
32214327	10	31	part_of	enzyme	1274:1279	arg1	the intact loop peptide	enzyme		the intact loop peptide		Fterm	Site	enzyme		peptide	TRACP 5a is a less active monomeric enzyme (35kD), with the intact loop peptide and TRACP 5b is proteolytically cleaved highly active enzyme encompassing two subunits (23 kD and 16 kD) held together by disulfide bonds.
34973766	4	28	part_of	→1	648:649	arg1	→1)-l-Araf, →3)-l-Araf-(1→, →5)-l-Araf-(1→, →3,5)-l-Araf-(1→, →2,5)-l-Araf-(1→, →4)-d-Glcp-(1→, →6)-d-Galp-(1→, and →1)-d-Rhap residues	1→, and →1		→1)-l-Araf, →3)-l-Araf-(1→, →5)-l-Araf-(1→, →3,5)-l-Araf-(1→, →2,5)-l-Araf-(1→, →4)-d-Glcp-(1→, →6)-d-Galp-(1→, and →1)-d-Rhap residues		OGER	Site	1→, and →1	O75717	residues	The backbone of AQP70-2B consisted of →1)-l-Araf, →3)-l-Araf-(1→, →5)-l-Araf-(1→, →3,5)-l-Araf-(1→, →2,5)-l-Araf-(1→, →4)-d-Glcp-(1→, →6)-d-Galp-(1→, and →1)-d-Rhap residues.
31936588	8	64	gly	fucosylation	1215:1226	arg1	the N-glycan structures				the N-glycan structures						Combinations of both xylosylation and aGal and fucosylation and aGal were also found on the N-glycan structures.
32649905	0	9	gly	Fucosylation	8:19	arg1	the Wnt Co-receptor LRP6	the Wnt Co-receptor LRP6				PUBTATOR		LRP6	O75581		In Situ Fucosylation of the Wnt Co-receptor LRP6 Increases Its Endocytosis and Reduces Wnt/β-Catenin Signaling.
32649905	0	40	gly	LRP6	44:47	arg1	In Situ Fucosylation	LRP6			In Situ Fucosylation	PUBTATOR		LRP6	O75581		In Situ Fucosylation of the Wnt Co-receptor LRP6 Increases Its Endocytosis and Reduces Wnt/β-Catenin Signaling.
32763405	4	81	part_of	PVA	947:949	arg1	the PVA composites	PVA		the PVA composites		OGER	Site	PVA	P32926	composites	CNF allomorph had significant impact on crystal structure, mechanical and thermal properties of the PVA composites.
33058985	6	1	gly	A-6-5	979:983	arg1	the O-polysaccharide			A-6-5	the O-polysaccharide					A-6-5	Formation of a new coordination bond between uranyl and the O-polysaccharide from P. veronii A-6-5 was demonstrated using FTIR spectroscopy; it may affect uranyl migration in the groundwaters due to its immobilization on microbial biofilms.
33990962	7	33	part_of	MCC	1181:1183	arg1	MCC reinforced paper-plastic composites	MCC		MCC reinforced paper-plastic composites		OGER	Site	MCC		composites	Furthermore, MCC reinforced paper-plastic composites demonstrated good barrier properties which can meet the requirement of the need for lower water sensitive materials in the food packaging industry.
34146360	6	64	part_of	NPs	943:945	arg1	βG-Ag NPs composite	βG-Ag NPs		βG-Ag NPs composite		OGER	Site	βG-Ag NPs	P0C0P6	composite	The synthesized βG NPs, Ag NPs, and βG-Ag NPs composite were negatively charged and had minute particle sizes with mean diameters of 58.65, 6.72, and 63.88 nm, respectively.
34146360	6	69	part_of	βG-Ag	937:941	arg1	βG-Ag NPs composite	βG-Ag NPs		βG-Ag NPs composite		OGER	Site	βG-Ag NPs	P0C0P6	composite	The synthesized βG NPs, Ag NPs, and βG-Ag NPs composite were negatively charged and had minute particle sizes with mean diameters of 58.65, 6.72, and 63.88 nm, respectively.
33338254	8	71	gly	glycoproteins	1638:1650	arg1	the Ulva lactuca AGP-like glycoproteins	the Ulva lactuca AGP-like glycoproteins				Fterm		glycoproteins			The exceptional structure of the Ulva lactuca AGP-like glycoproteins implies a specialized adaptation to the marine environment and might bring new insight into the evolution of the plant cell wall.
33668637	5	49	gly	glycoprotein	1675:1686	arg1	glycoprotein composition	glycoprotein composition				Fterm		glycoprotein			Overall, dietary Slab51® induces morphological and region-specific changes in glycoprotein composition of guinea fowl intestine, promoting gut health.
33620143	6	24	part_of	LTA	847:849	arg1	LTA chemical composition	LTA		LTA chemical composition		OGER	Site	LTA	P01374	position	This fat-reducing capacity of both BPL1 and LTA-BPL1 is abolished under glucose restriction, as a result of changes in LTA chemical composition.
34960836	5	1	gly	glycosylated	811:822	arg1	highly glycosylated glycoproteins	highly glycosylated glycoproteins				Fterm		glycoproteins			To do this, different aqueous fractions were extracted, analyzed by classical carbohydrate analysis methods (GC-FID/MS, colorimetric assay and elemental analysis), and purified by ion-exchange chromatography, as well as selective precipitation with a detecting agent for highly glycosylated glycoproteins.
34960836	5	13	gly	glycoproteins	824:836	arg1	highly glycosylated glycoproteins	highly glycosylated glycoproteins				Fterm		glycoproteins			To do this, different aqueous fractions were extracted, analyzed by classical carbohydrate analysis methods (GC-FID/MS, colorimetric assay and elemental analysis), and purified by ion-exchange chromatography, as well as selective precipitation with a detecting agent for highly glycosylated glycoproteins.
32408264	3	10	gly	used	669:672	arg2	lipid raft compositions			lipid raft compositions						positions	In this study, we demonstrate that effects from chitosans on Langmuir monolayers are considerably higher if lipid raft compositions (ternary mixtures of dipalmitoyl phosphatidyl choline (DPPC), sphingomyelin (SM) and cholesterol) are used.
32891643	2	45	part_of	HNT	252:254	arg1	Halloysite nanotube (HNT) composites	HNT		Halloysite nanotube (HNT) composites		OGER	Site	HNT	Q62718	composites	Halloysite nanotube (HNT) composites were modified with different concentration of both poly (lactic-co-glycolic acid) (PLGA) and chitosan (CS) through the Layer-by-Layer (LbL) strategy for targeted and controlled drug delivery of minocycline (MC).
34646811	5	23	gly	glycoproteins	971:983	arg1	glycoproteins	glycoproteins				Fterm		glycoproteins			An amine reactive slide is used to immobilize glycoproteins from a few microliters of spotted samples, followed by peptide N-glycosidase digestion.
32610141	5	2	gly	N-glycosylated	882:895	arg1	the N-glycosylated GRP94 variant	the N-glycosylated GRP94 variant				PUBTATOR		GRP94 variant	22027		We show in cells, human specimens, and mouse xenografts that proteome connectivity is restorable by inhibition of the N-glycosylated GRP94 variant.
33978738	5	4	gly	glycosylation	1443:1455	arg2	glycosylation sites			glycosylation sites						sites	The PDB Exchange MacroMolecular Crystallographic Information File data dictionary now supports (i) standardized atom nomenclature that conforms to International Union of Pure and Applied Chemistry-International Union of Biochemistry and Molecular Biology (IUPAC-IUBMB) recommendations for carbohydrates, (ii) uniform representation of branched entities for oligosaccharides, (iii) commonly used linear descriptors of carbohydrates developed by the glycoscience community and (iv) annotation of glycosylation sites in proteins.
34248864	7	34	gly	O-antigen	1400:1408	arg1	LPS core biosynthesis activity encoding genes	O-antigen			LPS core biosynthesis activity encoding genes	Cterm		O-antigen			The transcriptome analysis also indicated that A. muciniphila was less affected by the environmental changes and was able to sustain its abundance in the presence of B. thetaiotaomicron while increasing the expression of LPS core biosynthesis activity encoding genes (O-antigen ligase, Lipid A and Glycosyl transferases) as well as ABC transporters.
32649905	3	1	gly	-fucosylation	547:559	arg1	the Galβ(1-4)-GlcNAc sequences				GlcNAc						Using a combination of Chinese hamster ovary cell mutants with different fucosylation levels and cell-surface fucose editing (in situ fucosylation [ISF]), we report that α(1-3)-fucosylation of N-acetylglucosamine (GlcNAc) in the Galβ(1-4)-GlcNAc sequences of complex N-glycans modulates Wnt/β-catenin activity by regulating the endocytosis of low-density lipoprotein receptor-related protein 6 (LRP6).
32649905	3	1	gly	-fucosylation	547:559	arg1	the Galβ(1-4)-GlcNAc sequences				N-acetylglucosamine						Using a combination of Chinese hamster ovary cell mutants with different fucosylation levels and cell-surface fucose editing (in situ fucosylation [ISF]), we report that α(1-3)-fucosylation of N-acetylglucosamine (GlcNAc) in the Galβ(1-4)-GlcNAc sequences of complex N-glycans modulates Wnt/β-catenin activity by regulating the endocytosis of low-density lipoprotein receptor-related protein 6 (LRP6).
32649905	3	2	gly	-fucosylation	547:559	arg1	the Galβ(1-4)-GlcNAc sequences				the Galβ(1-4)-GlcNAc sequences						Using a combination of Chinese hamster ovary cell mutants with different fucosylation levels and cell-surface fucose editing (in situ fucosylation [ISF]), we report that α(1-3)-fucosylation of N-acetylglucosamine (GlcNAc) in the Galβ(1-4)-GlcNAc sequences of complex N-glycans modulates Wnt/β-catenin activity by regulating the endocytosis of low-density lipoprotein receptor-related protein 6 (LRP6).
34758705	8	58	gly	used	1286:1289	arg2	GO/CMC composites			GO/CMC composites						composites	Furthermore, GO/CMC composites can be used as a renewable and eco-friendly adsorbent for the removal of UDMH wastewater.
32399726	3	23	gly	glycopeptides	568:580	arg2	glycopeptides			glycopeptides						glycopeptides	Based on the multivalent hydrophilic interactions between glycan moieties on glycopeptides and amino groups and hydroxyl groups on chitosan, the glycopeptides were enriched and separated by pGC beads.
32399726	3	32	gly	moieties	556:563	arg1	glycopeptides			glycopeptides	glycopeptides		Site			glycopeptides	Based on the multivalent hydrophilic interactions between glycan moieties on glycopeptides and amino groups and hydroxyl groups on chitosan, the glycopeptides were enriched and separated by pGC beads.
32399726	3	55	gly	glycopeptides	636:648	arg2	the glycopeptides			the glycopeptides						glycopeptides	Based on the multivalent hydrophilic interactions between glycan moieties on glycopeptides and amino groups and hydroxyl groups on chitosan, the glycopeptides were enriched and separated by pGC beads.
34254604	8	45	part_of	Si-HA/BCP	1072:1080	arg1	Si-HA/BCP composites	Si-HA/BCP		Si-HA/BCP composites		OGER	Site	Si-HA/BCP	P03999	composites	Conversely, Si-HA/BCP composites were fully degraded and beneficially influenced bone regeneration by increasing the space available for bone ingrowth, and by accelerating BCP granules turnover.
32800955	8	43	part_of	CHT	1171:1173	arg1	CHT 2%/ZnO composites	CHT		CHT 2%/ZnO composites		OGER	Site	CHT	Q9GZV3	composites	The highest antifouling activity was observed for CHT 2%/ZnO composites.
34638753	1	6	part_of	FAP/glucan	186:195	arg1	A novel fluorapatite/glucan composite	FAP		A novel fluorapatite/glucan composite		PUBTATOR	Site	FAP	2191	composite	A novel fluorapatite/glucan composite ("FAP/glucan") was developed for the treatment of bone defects.
32289421	4	46	part_of	g-NCC/PLLA	538:547	arg1	the g-NCC/PLLA composite	NCC		the g-NCC/PLLA composite		OGER	Site	NCC	P55017	composite	For the g-NCC/PLLA composite, its crystallization rate increases significantly compared with pure PLLA, indicating that g-NCC acted as a nucleating agent to promote the crystallization.
33128033	0	63	gly	aglycosylated	42:54	arg1	aglycosylated antibody-lectin	aglycosylated antibody-lectin				Fterm		antibody-lectin			Aglycosylated antibody-producing mice for aglycosylated antibody-lectin coupled immunoassay for the quantification of tumor markers (ALIQUAT).
32673719	4	27	part_of	CNC	875:877	arg1	the CNC composites	CNC		the CNC composites		OGER	Site	CNC	P32418	composites	By assembling the polyester modified lignin (H-lignin) into CNC matrix, the hydrogen bonding crosslinks between the H-lignin and CNC chains were successfully promoted, resulting in the CNC composites with the significantly improved mechanical strength, UV blocking and antioxidant activity.
34649174	7	24	gly	resolution	841:850	arg1	the disaccharide region			the disaccharide region	the disaccharide region						Oligosaccharide resolution, especially in the disaccharide region, is significantly improved and can be routinely achieved.
34074422	8	42	gly	N-glycoproteins	1638:1652	arg1	these 153 intact N-glycoproteins	these 153 intact N-glycoproteins				Fterm		N-glycoproteins			For these 153 intact N-glycoproteins, the molecular functions and biological processes of were comprehensively discussed, and side-to-side comparison of differential expression results with other method were also made.
32399726	0	41	gly	glycopeptides	131:143	arg2	glycopeptides			glycopeptides						glycopeptides	Porous graphene oxide/chitosan beads with honeycomb-biomimetic microchannels as hydrophilic adsorbent for the selective capture of glycopeptides.
31936588	7	42	gly	1,6-difucosylations	1097:1115	arg1	the core mannose				the core mannose						These CCDs include xylosylation of the core mannose, 1,3-mono and 1,3- and 1,6-difucosylations of the basal GlcNac and mono- or diantennary aGal.
34070741	2	8	gly	sites	311:315	arg1	Vacant N-glycosylation sites			Vacant N-glycosylation sites						sites	Vacant N-glycosylation sites (N220 and N229) of Kv3, voltage-gated K+ channels of high-firing neurons, deeply perturb channel activity in neuroblastoma (NB) cells.
34070741	2	59	gly	N-glycosylation	295:309	arg1	Kv3, voltage-gated K+ channels	channels		sites		Fterm		channels		sites	Vacant N-glycosylation sites (N220 and N229) of Kv3, voltage-gated K+ channels of high-firing neurons, deeply perturb channel activity in neuroblastoma (NB) cells.
33551170	6	106	gly	glycosylation	1079:1091	arg1	the major whey proteins	the major whey proteins				Fterm		proteins			In the current study, we evaluated intercow differences and the effects of macronutrient supply on the N-linked glycosylation profiles of the major whey proteins in milk samples of Holstein-Friesian cows.
32541028	2	42	part_of	O-glycoprotein	368:381	arg1	aberrant O-glycoprotein epitopes	O-glycoprotein		aberrant O-glycoprotein epitopes		Fterm	Site	O-glycoprotein		epitopes	It has been difficult to identify appropriate targets in nonhematopoietic tumors, but one class of antigens that have shown promise is aberrant O-glycoprotein epitopes.
32921414	1	28	gly	glycoprotein	141:152	arg1	a highly O-glycosylated glycoprotein	a highly O-glycosylated glycoprotein				Fterm		glycoprotein			Podoplanin (PDPN) is a highly O-glycosylated glycoprotein that is utilized as a specific lymphatic endothelial marker under pathophysiological conditions.
32921414	1	28	gly	glycoprotein	141:152	arg1	Podoplanin	Podoplanin				PUBTATOR		Podoplanin	10630		Podoplanin (PDPN) is a highly O-glycosylated glycoprotein that is utilized as a specific lymphatic endothelial marker under pathophysiological conditions.
32921414	1	34	gly	O-glycosylated	126:139	arg1	a highly O-glycosylated glycoprotein	a highly O-glycosylated glycoprotein				Fterm		glycoprotein			Podoplanin (PDPN) is a highly O-glycosylated glycoprotein that is utilized as a specific lymphatic endothelial marker under pathophysiological conditions.
32921414	1	34	gly	O-glycosylated	126:139	arg1	Podoplanin	Podoplanin				PUBTATOR		Podoplanin	10630		Podoplanin (PDPN) is a highly O-glycosylated glycoprotein that is utilized as a specific lymphatic endothelial marker under pathophysiological conditions.
33402867	4	14	part_of	IgG	415:417	arg1	the IgG Fc domain	IgG		the IgG Fc domain		PUBTATOR	Site	IgG	668542	domain	Therefore, the IgG Fc domain serves as a bridge between the innate and adaptive arms and is regulated by an evolutionarily conserved N-glycosylation with variable structures.
33277973	6	31	part_of	/ADA-GEL	1154:1161	arg1	Laponite® /ADA-GEL hydrogel composites	Laponite® /ADA		Laponite® /ADA-GEL hydrogel composites		OGER	Site	Laponite® /ADA	P00813	composites	Overall, Laponite® /ADA-GEL hydrogel composites are confirmed as promising inks for 3D bioprinting.
33277973	6	50	part_of	Laponite®	1144:1152	arg1	Laponite® /ADA-GEL hydrogel composites	Laponite® /ADA		Laponite® /ADA-GEL hydrogel composites		OGER	Site	Laponite® /ADA	P00813	composites	Overall, Laponite® /ADA-GEL hydrogel composites are confirmed as promising inks for 3D bioprinting.
34408229	3	67	gly	sugars	439:444	arg1	The chemical composition			The chemical composition	The chemical composition		Site			position	The chemical composition of S. latifolium is rich in total sugars (41.08%) and uronic acids (47.4%); while, proteins, lipids and sulfates contents are 4.61, 1.13 and 0.09%, respectively.
34740855	5	74	part_of	dentin	655:660	arg1	composition	dentin		composition		Fterm	Site	dentin		position,	Here, we assess the viscoelastic behavior, composition, and ultrastructure of young and old root dentin using nano-dynamic mechanical analysis, micro-Raman spectroscopy, small angle X-ray scattering, atomic force and transmission electron microscopies.
34807566	0	81	gly	Heterogeneity	68:80	arg1	Complex Bacterial Lipopolysaccharides				Complex Bacterial Lipopolysaccharides						Nanoflow LC-MS Method Allowing In-Depth Characterization of Natural Heterogeneity of Complex Bacterial Lipopolysaccharides.
33604750	0	42	gly	G11	50:52	arg1	Exopolysaccharide	G11			Exopolysaccharide	OGER		G11	P49842		Exopolysaccharide of Anoxybacillus pushchinoensis G11 has antitumor and antibiofilm activities.
34436648	3	74	gly	glycoprotein	432:443	arg1	the glycoprotein AXC-MEC	the glycoprotein AXC-MEC				Fterm		glycoprotein			In this work, the glycoprotein AXC-MEC, composed of subunits of amylolytic, xylanolytic, and cellulolytic enzymes, was isolated from crude extracellular enzyme of the mesophilic anaerobic bacterium Clostridium manihotivorum CT4, grown on cassava pulp, using a milled cassava pulp column and Sephacryl S-500 gel filtration chromatography.
34574138	6	34	part_of	CMP-derived	718:728	arg1	CMP-derived peptides	CMP		CMP-derived peptides		OGER	Site	CMP	P21941	peptides	In this study, we developed a top-down glycopeptidomics-based analytical method to profile CMP and CMP-derived peptides using Orbitrap mass spectrometry combined with nano-liquid chromatography with electron-transfer/higher-energy collision dissociation.
33990962	6	27	part_of	MCC	1081:1083	arg1	MCC@TPS/paper composites	MCC		MCC@TPS/paper composites		OGER	Site	MCC		composites	In particular, it was found that the water contact angle of MCC@TPS/paper composites and TPS/paper composites were higher than single-layer paper.
32781125	11	83	gly	used	1743:1746	arg2	the composite			the composite						composite	Furthermore, the composite was used for the removal of methylene blue (MB) from water.
32128391	4	12	gly	fucosylated	694:704	arg1	fucosylated glycans				fucosylated glycans						We confirmed in vitro that knockdown of IKZF1 decreases the expression of fucosyltransferase FUT8, resulting in increased levels of fucosylated glycans, and suggest that RUNX1 and RUNX3, together with SMARCB1, regulate expression of glycosyltransferase MGAT3.
32637953	5	50	gly	epitope	806:812	arg1	the spike S2 domain			the spike S2 domain	the spike S2 domain		Site			domain	A 3.1 Å resolution cryo-EM structure of the S protein ectodomain bound to glycan-dependent HIV-1 bnAb 2G12 revealed a quaternary glycan epitope on the spike S2 domain involving multiple protomers.
33463166	3	69	gly	utilized	420:427	arg2	Antimicrobial peptides			Antimicrobial peptides						peptides	Antimicrobial peptides (AMPs) have been utilized to address the limitations of antiseptics and antibiotics.
32657144	3	65	gly	contained	785:793	arg1	TSP-3a AND GlcA	TSP-3a			GlcA	OGER		TSP	P07996		TSP-3a (758.6 kDa) mainly contained Man, GalN, GlcA, Rha, Glc, Gal, Ara, and Fuc in a molar ratio of 0.26:0.24:0.19:1.80:0.45:12.56:1.09:0.21.
32657144	3	65	gly	contained	785:793	arg1	TSP-3a AND Fuc	TSP-3a			Fuc	OGER		TSP	P07996		TSP-3a (758.6 kDa) mainly contained Man, GalN, GlcA, Rha, Glc, Gal, Ara, and Fuc in a molar ratio of 0.26:0.24:0.19:1.80:0.45:12.56:1.09:0.21.
32657144	3	65	gly	contained	785:793	arg1	TSP-3a AND Ara	TSP-3a			Ara	OGER		TSP	P07996		TSP-3a (758.6 kDa) mainly contained Man, GalN, GlcA, Rha, Glc, Gal, Ara, and Fuc in a molar ratio of 0.26:0.24:0.19:1.80:0.45:12.56:1.09:0.21.
32657144	3	65	gly	contained	785:793	arg1	TSP-3a AND Man	TSP-3a			Man	OGER		TSP	P07996		TSP-3a (758.6 kDa) mainly contained Man, GalN, GlcA, Rha, Glc, Gal, Ara, and Fuc in a molar ratio of 0.26:0.24:0.19:1.80:0.45:12.56:1.09:0.21.
32657144	3	65	gly	contained	785:793	arg1	TSP-3a AND Rha	TSP-3a			Rha	OGER		TSP	P07996		TSP-3a (758.6 kDa) mainly contained Man, GalN, GlcA, Rha, Glc, Gal, Ara, and Fuc in a molar ratio of 0.26:0.24:0.19:1.80:0.45:12.56:1.09:0.21.
32657144	3	65	gly	contained	785:793	arg1	TSP-3a AND GalN	TSP-3a			GalN	OGER		TSP	P07996		TSP-3a (758.6 kDa) mainly contained Man, GalN, GlcA, Rha, Glc, Gal, Ara, and Fuc in a molar ratio of 0.26:0.24:0.19:1.80:0.45:12.56:1.09:0.21.
32657144	3	65	gly	contained	785:793	arg1	TSP-3a AND Glc	TSP-3a			Glc	OGER		TSP	P07996		TSP-3a (758.6 kDa) mainly contained Man, GalN, GlcA, Rha, Glc, Gal, Ara, and Fuc in a molar ratio of 0.26:0.24:0.19:1.80:0.45:12.56:1.09:0.21.
32673719	8	0	part_of	CNC-based	1485:1493	arg1	CNC-based composite	CNC		CNC-based composite		OGER	Site	CNC	P32418	composite	The H-lignin provides a new insight into the multifunctional exploration of CNC-based composite.
32349995	7	2	gly	fucosylated	962:972	arg1	fucosylated and fucosylated disialylated structures				fucosylated and fucosylated disialylated structures						Bisecting GlcNAc in fucosylated and fucosylated disialylated structures and monosialylation of fucosylated digalactosylated structures were associated with a faster decrease of eGFR.
32349995	7	17	gly	monosialylation	1018:1032	arg1	fucosylated digalactosylated structures				fucosylated digalactosylated structures						Bisecting GlcNAc in fucosylated and fucosylated disialylated structures and monosialylation of fucosylated digalactosylated structures were associated with a faster decrease of eGFR.
32349995	7	24	gly	fucosylated	978:988	arg1	fucosylated and fucosylated disialylated structures				fucosylated and fucosylated disialylated structures						Bisecting GlcNAc in fucosylated and fucosylated disialylated structures and monosialylation of fucosylated digalactosylated structures were associated with a faster decrease of eGFR.
32349995	7	35	gly	disialylated	990:1001	arg1	fucosylated and fucosylated disialylated structures				fucosylated and fucosylated disialylated structures						Bisecting GlcNAc in fucosylated and fucosylated disialylated structures and monosialylation of fucosylated digalactosylated structures were associated with a faster decrease of eGFR.
32349995	7	50	gly	fucosylated	1037:1047	arg1	fucosylated digalactosylated structures				fucosylated digalactosylated structures						Bisecting GlcNAc in fucosylated and fucosylated disialylated structures and monosialylation of fucosylated digalactosylated structures were associated with a faster decrease of eGFR.
34890854	6	71	part_of	CDs	1507:1509	arg1	composition	CDs		composition		OGER	Site	CDs	Q92903	position	Moreover, the observed migration order could be rationalized based on the composition and substitution pattern of the CDs.
32399726	8	3	gly	glycopeptides	1447:1459	arg2	capturing and identifying low-abundant glycopeptides			capturing and identifying low-abundant glycopeptides						glycopeptides	The pGC was successfully applied to capturing and identifying low-abundant glycopeptides from biological samples.
34294293	3	46	part_of	odorranain	564:573	arg1	antimicrobial peptides	odorranain A (OA		antimicrobial peptides		Cterm	Site	odorranain A (OA		peptides	Here, agarose oligosaccharides (AGO) obtained from marine red algae were used as a reducing and stabilizer for green synthesis of silver nanoparticles (AgNPs), and further successfully connected with odorranain A (OA), one of antimicrobial peptides (AMPs), to obtain a novel composite nanomaterial (AGO-AgNPs-OA).
32518941	8	93	gly	glycopeptide	1240:1251	arg2	glycopeptide			glycopeptide						glycopeptide	MS/MS fragmentation clearly established the glycopeptide identities.
33013929	6	59	gly	O-glycosylation	1340:1354	arg2	3 O-glycosylation sites			3 O-glycosylation sites						sites	In addition, we detected 9 predicted N-glycosylation sites and 3 O-glycosylation sites unique to SARS-CoV-2, but no evidently observed variation of the glycan sites so far.
33013929	6	87	gly	N-glycosylation	1312:1326	arg2	predicted N-glycosylation sites			predicted N-glycosylation sites						sites	In addition, we detected 9 predicted N-glycosylation sites and 3 O-glycosylation sites unique to SARS-CoV-2, but no evidently observed variation of the glycan sites so far.
33338254	6	21	gly	glycosylation	1335:1347	arg1	the Ulva lactuca AGP-like glycoproteins	the Ulva lactuca AGP-like glycoproteins				Fterm		glycoproteins			While the amino acid analysis of the AGP-like glycoproteins purified by the β-d-glucosyl Yariv reagent showed a similarity between algal and land plant AGP-like glycoproteins, neutral saccharide analysis revealed unique glycosylation of the Ulva lactuca AGP-like glycoproteins.
33338254	6	32	gly	glycoproteins	1161:1173	arg1	the AGP-like glycoproteins	the AGP-like glycoproteins				Fterm		glycoproteins			While the amino acid analysis of the AGP-like glycoproteins purified by the β-d-glucosyl Yariv reagent showed a similarity between algal and land plant AGP-like glycoproteins, neutral saccharide analysis revealed unique glycosylation of the Ulva lactuca AGP-like glycoproteins.
33338254	6	50	gly	glycoproteins	1276:1288	arg1	plant AGP-like glycoproteins	plant AGP-like glycoproteins				Fterm		glycoproteins			While the amino acid analysis of the AGP-like glycoproteins purified by the β-d-glucosyl Yariv reagent showed a similarity between algal and land plant AGP-like glycoproteins, neutral saccharide analysis revealed unique glycosylation of the Ulva lactuca AGP-like glycoproteins.
33338254	6	58	gly	glycoproteins	1378:1390	arg1	the Ulva lactuca AGP-like glycoproteins	the Ulva lactuca AGP-like glycoproteins				Fterm		glycoproteins			While the amino acid analysis of the AGP-like glycoproteins purified by the β-d-glucosyl Yariv reagent showed a similarity between algal and land plant AGP-like glycoproteins, neutral saccharide analysis revealed unique glycosylation of the Ulva lactuca AGP-like glycoproteins.
32763405	6	2	part_of	PVA	1190:1192	arg1	PVA nanocomposite	PVA		PVA nanocomposite		OGER	Site	PVA	P32926	nanocomposite	Addition of CNFs raised onset degradation temperature (Tonset) and thermal decomposition temperature (Tmax) of PVA nanocomposite, while decreased the melting temperature (Tm).
33418875	7	27	gly	sialylated-fucosylated	1102:1123	arg1	biantennary neutral, sialylated but nonfucosylated, and sialylated-fucosylated structures				biantennary neutral, sialylated but nonfucosylated, and sialylated-fucosylated structures						Altered distribution of biantennary neutral, sialylated but nonfucosylated, and sialylated-fucosylated structures were found to be the most significant changes.
33418875	7	62	gly	sialylated	1067:1076	arg1	biantennary neutral, sialylated but nonfucosylated, and sialylated-fucosylated structures				biantennary neutral, sialylated but nonfucosylated, and sialylated-fucosylated structures						Altered distribution of biantennary neutral, sialylated but nonfucosylated, and sialylated-fucosylated structures were found to be the most significant changes.
32204030	4	18	part_of	KGM/PVA	601:607	arg1	konjac glucomannan/polyvinyl alcohol (KGM/PVA) composites	KGM/PVA		konjac glucomannan/polyvinyl alcohol (KGM/PVA) composites		OGER	Site	KGM/PVA	P32926	composites	A series of konjac glucomannan/polyvinyl alcohol (KGM/PVA) composites with different ratio are fabricated and their role in enhancing the skin repair is tested by in vitro cell culture and in vivo study.
34574138	0	36	part_of	Kappa-Casein	19:30	arg1	Bovine Kappa-Casein Glycomacropeptide	Bovine Kappa-Casein		Bovine Kappa-Casein Glycomacropeptide		PUBTATOR	Site	Bovine Kappa-Casein	281728	Glycomacropeptide	Analysis of Bovine Kappa-Casein Glycomacropeptide by Liquid Chromatography-Tandem Mass Spectrometry.
34574138	0	41	part_of	Bovine	12:17	arg1	Bovine Kappa-Casein Glycomacropeptide	Bovine Kappa-Casein		Bovine Kappa-Casein Glycomacropeptide		PUBTATOR	Site	Bovine Kappa-Casein	281728	Glycomacropeptide	Analysis of Bovine Kappa-Casein Glycomacropeptide by Liquid Chromatography-Tandem Mass Spectrometry.
32460635	5	16	part_of	AuNP-PMS/FGF2	1022:1034	arg1	this AuNP-PMS/FGF2 composite	FGF2		this AuNP-PMS/FGF2 composite		PUBTATOR	Site	FGF2	14173	composite	In this AuNP-PMS/FGF2 composite, PMS, playing as the high-active mimic of heparin/heparan sulfate (HS), is covalently anchored to AuNPs and bound with FGF2 on the surface of nanoparticles, forming a HS/FGF2 complex nanomimics to facilitate its binding to FGF receptor (FGFR) and promote high neural-inductive activity of mESCs.
34560151	5	15	part_of	PCL/CNC	848:854	arg1	PCL/CNC bio-composites	PCL/CNC		PCL/CNC bio-composites		OGER	Site	PCL/CNC	P32418	bio-composites	Improved thermal stability was observed in PCL/CNC bio-composites by ~10 °C rise.
32460635	10	26	part_of	AuNP-PMS/FGF2	2245:2257	arg1	AuNP-PMS/FGF2 composite	FGF2		AuNP-PMS/FGF2 composite		PUBTATOR	Site	FGF2	14173	composite	Meanwhile, both mESCs and L929 cells showed desirable growth during the incubation with AuNP-PMS/FGF2 composite.
32810535	8	12	part_of	FGF2	1165:1168	arg1	the binding sites	FGF2		the binding sites		OGER	Site	FGF2	P09038	sites	GalNAc 4S of YG-1 could be the binding sites of FGF2 and FGFR.
31970866	9	83	gly	glycopeptides	1111:1123	arg2	88.15% glycopeptides			88.15% glycopeptides						glycopeptides	Boronic acid@fibrous cellulose is selective up to 1:250 for spiked horseradish peroxidase in bovine serum albumin digest, sensitive down to 0.1 femtomol and recovering 88.15% glycopeptides.
34254604	9	33	part_of	Si-HA/BCP	1349:1357	arg1	Si-HA/BCP composites	Si-HA/BCP		Si-HA/BCP composites		OGER	Site	Si-HA/BCP	P03999	composites	Our study demonstrates that the degradation rate is key to control bone regeneration and that Si-HA/BCP composites are promising biomaterials to regenerate bone defects.
32475601	3	51	gly	contains	440:447	arg1	The chemical composition AND glucose			The chemical composition	glucose					position	The chemical composition of the extracted polysaccharide contains fructose and glucose with protein-free identified by gas chromatography-mass spectrometer (GC-MS) method.
32475601	3	51	gly	contains	440:447	arg1	The chemical composition AND fructose			The chemical composition	fructose					position	The chemical composition of the extracted polysaccharide contains fructose and glucose with protein-free identified by gas chromatography-mass spectrometer (GC-MS) method.
34920059	6	62	part_of	CNC/NiO	902:908	arg1	CNC/NiO composite	CNC		CNC/NiO composite		OGER	Site	CNC	P32418	composite	Besides this, CNC/NiO composite showed good antibacterial activity against Escherichia coli (E. coli) bacteria and its bacterial activity increased with Cu doping.
34890854	2	24	part_of	β-CDs	634:638	arg1	different composition	CDs		different composition		OGER	Site	CDs	Q92903	position	Opposite enantiomer migration order was observed for randomly substituted CDs compared to 2,6-DM-β-CD as well as methylated β-CDs with different composition according to the specifications of the manufacturers.
34890854	2	72	part_of	2,6-DM-β-CD	600:610	arg1	different composition	-CD		different composition		PUBTATOR	Site	-CD	65057	position	Opposite enantiomer migration order was observed for randomly substituted CDs compared to 2,6-DM-β-CD as well as methylated β-CDs with different composition according to the specifications of the manufacturers.
31970866	1	27	gly	glycoproteins	107:119	arg1	glycoproteins	glycoproteins				Fterm		glycoproteins			Enrichment of glycoproteins has been important because of their dynamicity and role in biological systems.
32399726	5	25	gly	N-glycosylated	1010:1023	arg1	152 N-glycosylated proteins	152 N-glycosylated proteins				Fterm		proteins			By combing pGC beads and nano LC-MS/MS analysis, a total of 325 N-glycosylated peptides corresponding to 152 N-glycosylated proteins were identified from 2 μL human serum.
32399726	5	49	gly	N-glycosylated	965:978	arg1	325 N-glycosylated peptides			325 N-glycosylated peptides						peptides	By combing pGC beads and nano LC-MS/MS analysis, a total of 325 N-glycosylated peptides corresponding to 152 N-glycosylated proteins were identified from 2 μL human serum.
34782210	6	4	gly	DP	984:985	arg1	galactooligosaccharides	DP 2-4			galactooligosaccharides	OGER		DP 2-4	Q14188		This approach is shown to work for the preparation of food-grade fructooligosaccharides of DP 3 and 4, galactooligosaccharides of DP 3 and 4, and xylooligosaccharides of DP 2-4.
34782210	6	4	gly	DP	984:985	arg1	xylooligosaccharides	DP 2-4			xylooligosaccharides	OGER		DP 2-4	Q14188		This approach is shown to work for the preparation of food-grade fructooligosaccharides of DP 3 and 4, galactooligosaccharides of DP 3 and 4, and xylooligosaccharides of DP 2-4.
34782210	6	4	gly	DP	984:985	arg1	food-grade fructooligosaccharides	DP 2-4			food-grade fructooligosaccharides	OGER		DP 2-4	Q14188		This approach is shown to work for the preparation of food-grade fructooligosaccharides of DP 3 and 4, galactooligosaccharides of DP 3 and 4, and xylooligosaccharides of DP 2-4.
34782210	6	8	gly	DP	905:906	arg1	galactooligosaccharides	DP 3 and 4			galactooligosaccharides	PUBTATOR		DP 3 and 4	324		This approach is shown to work for the preparation of food-grade fructooligosaccharides of DP 3 and 4, galactooligosaccharides of DP 3 and 4, and xylooligosaccharides of DP 2-4.
34782210	6	8	gly	DP	905:906	arg1	xylooligosaccharides	DP 3 and 4			xylooligosaccharides	PUBTATOR		DP 3 and 4	324		This approach is shown to work for the preparation of food-grade fructooligosaccharides of DP 3 and 4, galactooligosaccharides of DP 3 and 4, and xylooligosaccharides of DP 2-4.
34782210	6	8	gly	DP	905:906	arg1	food-grade fructooligosaccharides	DP 3 and 4			food-grade fructooligosaccharides	PUBTATOR		DP 3 and 4	324		This approach is shown to work for the preparation of food-grade fructooligosaccharides of DP 3 and 4, galactooligosaccharides of DP 3 and 4, and xylooligosaccharides of DP 2-4.
34782210	6	34	gly	DP	944:945	arg1	galactooligosaccharides	DP 3 and 4			galactooligosaccharides	PUBTATOR		DP 3 and 4	324		This approach is shown to work for the preparation of food-grade fructooligosaccharides of DP 3 and 4, galactooligosaccharides of DP 3 and 4, and xylooligosaccharides of DP 2-4.
34782210	6	34	gly	DP	944:945	arg1	xylooligosaccharides	DP 3 and 4			xylooligosaccharides	PUBTATOR		DP 3 and 4	324		This approach is shown to work for the preparation of food-grade fructooligosaccharides of DP 3 and 4, galactooligosaccharides of DP 3 and 4, and xylooligosaccharides of DP 2-4.
34782210	6	34	gly	DP	944:945	arg1	food-grade fructooligosaccharides	DP 3 and 4			food-grade fructooligosaccharides	PUBTATOR		DP 3 and 4	324		This approach is shown to work for the preparation of food-grade fructooligosaccharides of DP 3 and 4, galactooligosaccharides of DP 3 and 4, and xylooligosaccharides of DP 2-4.
32469526	7	38	part_of	chitin/MoS2	1334:1344	arg1	the chitin/MoS2 nanocomposites	chitin		the chitin/MoS2 nanocomposites		Fterm	Site	chitin		nanocomposites	The results also show that the dielectric constant and breakdown strength of the chitin/MoS2 nanocomposites were increased, while the dielectric loss remained low.
34661088	3	20	gly	N-glycosylation	460:474	arg1	S1 protein	S1 protein				Cterm		S1 protein	Q15517		In this study, we investigated the effect of different N-glycosylation of S1 protein on its binding to ACE2.
34872779	2	1	part_of	MOF-235	421:427	arg1	The chitosan composite	MOF		The chitosan composite		OGER	Site	MOF	Q9H7Z6	composite	The chitosan composite of the iron metal-organic framework (CS/MOF-235), MOF-235 and chitosan were used for the removal of methylene blue (MB) and methyl orange (MO) from aqueous solutions.
34354349	13	71	part_of	PVA	2056:2058	arg1	the electrospun PVA NFs composites	PVA		the electrospun PVA NFs composites		OGER	Site	PVA	P32926	composites	CONCLUSION The obtained results suggest that the electrospun PVA NFs composites containing 0.9% PE-CS-Au NPs can be used as antibacterial agents against antibiotic-resistant bacteria, and as suitable scaffolds for cell adhesion, growth and proliferation of fibroblast populations.
34628317	5	73	part_of	MCP	804:806	arg1	The MCP nanocomposite	MCP		The MCP nanocomposite		OGER	Site	MCP	P15529	nanocomposite	The MCP nanocomposite was capable to remove up to 58.5 mg Pb2+ g-1 of MCP from water with a good agreement of experimental data to the Langmuir isotherm model (R2 = 0.98).
32527472	6	13	part_of	ECM	935:937	arg1	the final ECM composition	ECM		the final ECM composition		OGER	Site	ECM	Q13201	position	AIM Estimation of the detergent (Triton X-100) flow parameters and anthropometric donors' decellularization process accuracy on the final ECM composition.
33013929	0	23	part_of	SARS-CoV-2	14:23	arg1	SARS-CoV-2 Spike Protein Cell Epitopes	SARS		SARS-CoV-2 Spike Protein Cell Epitopes		OGER		SARS	P49591		Variations in SARS-CoV-2 Spike Protein Cell Epitopes and Glycosylation Profiles During Global Transmission Course of COVID-19.
33013929	0	43	part_of	Protein	31:37	arg1	SARS-CoV-2 Spike Protein Cell Epitopes	Spike Protein		SARS-CoV-2 Spike Protein Cell Epitopes		PUBTATOR		Spike Protein	43740568		Variations in SARS-CoV-2 Spike Protein Cell Epitopes and Glycosylation Profiles During Global Transmission Course of COVID-19.
33013929	0	85	part_of	Spike	25:29	arg1	SARS-CoV-2 Spike Protein Cell Epitopes	Spike Protein		SARS-CoV-2 Spike Protein Cell Epitopes		PUBTATOR		Spike Protein	43740568		Variations in SARS-CoV-2 Spike Protein Cell Epitopes and Glycosylation Profiles During Global Transmission Course of COVID-19.
34694716	5	26	part_of	AGA	1056:1058	arg1	a PPyNT@AGA hybrid composite	AGA		a PPyNT@AGA hybrid composite		OGER	Site	AGA	P20933	composite	This study establishes the good inhibition of a PPyNT@AGA hybrid composite against various microorganisms.
35087313	6	40	gly	glycoproteins	845:857	arg1	Pharmaceutical glycoproteins	Pharmaceutical glycoproteins				Fterm		glycoproteins			Pharmaceutical glycoproteins with these characteristics would be valuable for cellular delivery through the MR, and safe for human therapy.
32511389	1	44	gly	fully-glycosylated	165:182	arg1	a fully-glycosylated full-length SARS-CoV-2 spike (S) protein	a fully-glycosylated full-length SARS-CoV-2 spike (S) protein				Fterm		protein			This technical study describes all-atom modeling and simulation of a fully-glycosylated full-length SARS-CoV-2 spike (S) protein in a viral membrane.
32511389	1	30	gly	protein	217:223	arg1	all-atom modeling and simulation	protein			all-atom modeling and simulation	Fterm		protein			This technical study describes all-atom modeling and simulation of a fully-glycosylated full-length SARS-CoV-2 spike (S) protein in a viral membrane.
31954790	3	15	gly	utilized	488:495	arg2	The synthesized sodium alginate cross-linked acrylic acid/graphite (NaA-cl-AAc/GP) hydrogel composite			The synthesized sodium alginate cross-linked acrylic acid/graphite (NaA-cl-AAc/GP) hydrogel composite						composite	The synthesized sodium alginate cross-linked acrylic acid/graphite (NaA-cl-AAc/GP) hydrogel composite was utilized in the removal of malachite green (MG) dye from aqueous solution using batch adsorption experiments.
31970866	2	64	gly	glycoproteins	209:221	arg1	glycoproteins	glycoproteins				Fterm		glycoproteins			Study of glycoproteins is complex because of the simultaneous glycosylation and deglycosylation inside the body.
32902634	0	15	gly	glycoproteins	64:76	arg1	glycoproteins	glycoproteins				Fterm		glycoproteins			Sparse isotope labeling for nuclear magnetic resonance (NMR) of glycoproteins using 13C-glucose.
32607666	7	53	part_of	Sp245	1117:1121	arg1	the coding sequence	Sp245		the coding sequence		Cterm	Site	Sp245		sequence	Because of the limited experimental data on the genetic aspects of surface glycopolymer production and flagellar motility in azospirilla, the aim of this study was to identify and examine in more detail the coding sequence of strain Sp245, inactivated in the mutant.
34940684	8	8	part_of	receptor	1257:1264	arg1	the S-protein receptor binding domain	S-protein receptor		the S-protein receptor binding domain		PUBTATOR	Site	S-protein receptor	7448	domain	In competitive binding studies, the IC50 of RS against the S-protein receptor binding domain (RBD) binding to immobilized heparin was 1.6 ng/mL, which is much lower than the IC50 for heparin (~750 ng/mL).
34940684	8	55	part_of	S-protein	1247:1255	arg1	the S-protein receptor binding domain	S-protein receptor		the S-protein receptor binding domain		PUBTATOR	Site	S-protein receptor	7448	domain	In competitive binding studies, the IC50 of RS against the S-protein receptor binding domain (RBD) binding to immobilized heparin was 1.6 ng/mL, which is much lower than the IC50 for heparin (~750 ng/mL).
34074422	7	19	gly	N-glycoproteins	1538:1552	arg1	153 intact N-glycoproteins	153 intact N-glycoproteins				Fterm		N-glycoproteins			With the three technical replicates and the criteria of fold change≥1.5 and p value<0.05, 380 DEGPs (corresponding to 153 intact N-glycoproteins) were found along with 293 down-regulated and 87 up-regulated.
32507236	6	0	gly	glycans	999:1005	arg1	Asn112			Asn112	Asn112		AminoAcid			Asn109 and Asn112	Our results revealed 10 glycan compositions for salivary AZGP1, including core fucosylated glycans on Asn128 and sialylated glycans on Asn109 and Asn112.
32507236	6	0	gly	glycans	999:1005	arg1	Asn109			Asn109	Asn109		AminoAcid			Asn109 and Asn112	Our results revealed 10 glycan compositions for salivary AZGP1, including core fucosylated glycans on Asn128 and sialylated glycans on Asn109 and Asn112.
32507236	6	0	gly	glycans	999:1005	arg1	Asn128			Asn128	Asn128		AminoAcid			Asn128	Our results revealed 10 glycan compositions for salivary AZGP1, including core fucosylated glycans on Asn128 and sialylated glycans on Asn109 and Asn112.
32507236	6	39	gly	glycans	1032:1038	arg1	Asn112			Asn112	Asn112		AminoAcid			Asn109 and Asn112	Our results revealed 10 glycan compositions for salivary AZGP1, including core fucosylated glycans on Asn128 and sialylated glycans on Asn109 and Asn112.
32507236	6	39	gly	glycans	1032:1038	arg1	Asn109			Asn109	Asn109		AminoAcid			Asn109 and Asn112	Our results revealed 10 glycan compositions for salivary AZGP1, including core fucosylated glycans on Asn128 and sialylated glycans on Asn109 and Asn112.
32507236	6	39	gly	glycans	1032:1038	arg1	Asn128			Asn128	Asn128		AminoAcid			Asn128	Our results revealed 10 glycan compositions for salivary AZGP1, including core fucosylated glycans on Asn128 and sialylated glycans on Asn109 and Asn112.
32507236	6	65	gly	sialylated	1021:1030	arg1	sialylated glycans				sialylated glycans						Our results revealed 10 glycan compositions for salivary AZGP1, including core fucosylated glycans on Asn128 and sialylated glycans on Asn109 and Asn112.
32507236	6	78	gly	fucosylated	987:997	arg1	core fucosylated glycans				core fucosylated glycans						Our results revealed 10 glycan compositions for salivary AZGP1, including core fucosylated glycans on Asn128 and sialylated glycans on Asn109 and Asn112.
33183596	3	34	part_of	BC/PHB	427:432	arg1	BC/PHB composites	BC/PHB		BC/PHB composites		OGER	Site	BC/PHB	P35232	composites	The synthesis processes of BC/PHB composites described until now are complicated with multiple steps.
34693955	0	16	part_of	ECM-based	51:59	arg1	the ECM-based composites	ECM		the ECM-based composites		OGER	Site	ECM	Q13201	composites	Exploring the match between the degradation of the ECM-based composites and tissue remodeling in a full-thickness abdominal wall defect model.
32283375	1	17	part_of	protein	343:349	arg1	their composition	protein		their composition		Fterm	Site	protein		position	Inter-relationship between lactose crystallization (LC), the amount and composition of surface free fat (SFF); and their effect on physico-chemical properties of infant formula (IF) containing hydrolyzed and intact (non-hydrolyzed) whey protein in their composition were investigated at two temperatures (25 and 45 °C) and five RH (11-65%) conditions.
33125939	2	4	gly	content	310:316	arg1	lignin	lignin			content	Fterm		lignin			Its chemical characterization revealed to have an interesting composition, with a high polysaccharides content and low content in lignin, which makes it particularly relevant for the biorefinery's biochemical platform.
34432331	6	28	part_of	elastin-like	1067:1078	arg1	Human elastin-like polypeptides	Human elastin		Human elastin-like polypeptides		OGER	Site	Human elastin	P15502	polypeptides	Human elastin-like polypeptides (HELPs) are stimuli-responsive biopolymers.
34432331	6	33	part_of	Human	1061:1065	arg1	Human elastin-like polypeptides	Human elastin		Human elastin-like polypeptides		OGER	Site	Human elastin	P15502	polypeptides	Human elastin-like polypeptides (HELPs) are stimuli-responsive biopolymers.
32204030	7	19	part_of	KGM/PVA	1022:1028	arg1	KGM/PVA (5:5) composite	KGM/PVA		KGM/PVA (5:5) composite		OGER	Site	KGM/PVA	P32926	composite	The results show the blood adsorption capacity of KGM/PVA (5:5) composite can reach about 13 g/g.
32693272	1	17	part_of	SA-PAM/GO	170:178	arg1	SA-PAM/GO hydrogel composites	PAM		SA-PAM/GO hydrogel composites		OGER	Site	PAM	P19021	composites	A novel bio-adsorbent named SA-PAM/GO hydrogel composites was synthesized through free radical polymerization.
32541028	7	1	gly	Tn-glycoproteins	1388:1403	arg1	multiple Tn-glycoproteins	multiple Tn-glycoproteins				Fterm		Tn-glycoproteins			Selection with a noncognate human antigen, Tn-MUC1, yielded scFv variants that were broadly reactive with multiple Tn-glycoproteins.
32804173	7	4	gly	derived	1069:1075	arg1	dextrin AND the glucose units	dextrin			the glucose units	Fterm		dextrin			GUI values for glycan compositions were calculated with respect to the glucose units derived from dextrin, which was employed as an elution standard.
34574138	3	15	part_of	has	314:316	arg1	CMP AND two major amino acid sequences	CMP		two major amino acid sequences		OGER	Site	CMP	P21941	sequences	CMP has two major amino acid sequences with different modifications, including glycosylation, phosphorylation and oxidation.
33125195	11	49	gly	used	1848:1851	arg2	starch-clay biocomposites			starch-clay biocomposites						biocomposites	CONCLUSIONS The study showed that starch-clay biocomposites could be used in the controlled release of tramadol.
32478036	3	34	gly	glycopeptides	802:814	arg2	structure-defined homogeneous N-linked glycopeptides			structure-defined homogeneous N-linked glycopeptides						glycopeptides	This glycosylation strategy is highly compatible with the free carboxylic acids and hydroxyl groups of peptides and carbohydrates, and readily available for the assembly of structure-defined homogeneous N-linked glycopeptides, such as segments derived from glycoprotein EPO and IL-5.
32478036	3	36	gly	glycoprotein	847:858	arg1	glycoprotein EPO	glycoprotein EPO				Fterm		glycoprotein			This glycosylation strategy is highly compatible with the free carboxylic acids and hydroxyl groups of peptides and carbohydrates, and readily available for the assembly of structure-defined homogeneous N-linked glycopeptides, such as segments derived from glycoprotein EPO and IL-5.
32478036	3	44	gly	peptides	693:700	arg1	carbohydrates			peptides	carbohydrates					peptides	This glycosylation strategy is highly compatible with the free carboxylic acids and hydroxyl groups of peptides and carbohydrates, and readily available for the assembly of structure-defined homogeneous N-linked glycopeptides, such as segments derived from glycoprotein EPO and IL-5.
31915902	11	27	gly	N-glycoforms	1608:1619	arg1	IgG N-glycoforms	IgG N-glycoforms				Cterm		IgG			• BSA's skewing of IgG N-glycoforms should be considered in IgG production.
32306780	7	77	gly	horses	1679:1684	arg1	r2 = 0.85			r2 = 0.85						r2 	SF and serum proteoglycan-4 concentrations were correlated in normal horses (r2 = 0.85, p < 0.05), but not in clinical groups.
33090346	2	25	part_of	keratin/cellulose-based	310:332	arg1	The keratin/cellulose-based composites	keratin		The keratin/cellulose-based composites		PUBTATOR	Site	keratin	396479	composites	The keratin/cellulose-based composites were obtained by combining the dissolution of CF and C waste in 1-butyl-3-methylimidazolium chloride (Bmim-Cl+) ionic liquid green solvent via regeneration, simply by the freeze-drying method.
32070555	2	21	gly	used	367:370	arg2	Compositional			Compositional						position	Compositional and FTIR analysis were initially used to confirm the removal of impurities.
34925283	8	65	gly	N-glycosylation	1342:1356	arg1	Hbt	Hbt				OGER		Hbt	Q9Y6M7		Moreover, this study demonstrated how compromised N-glycosylation affects various facets of Hbt.
33183601	1	7	part_of	curcumin	315:322	arg1	a pharmacological composite	curcumin		a pharmacological composite		Fterm	Site	curcumin		composite	The goal of this work was to assess the usability of yeast glucan particles (GPs) as carriers for curcumin and determine the beneficial effect of a pharmacological composite of curcumin in GPs on dextran sulfate sodium induced colitis in rats.
33183601	1	26	part_of	composite	302:310	arg1	GPs	GPs		composite		OGER	Site	GPs		composite	The goal of this work was to assess the usability of yeast glucan particles (GPs) as carriers for curcumin and determine the beneficial effect of a pharmacological composite of curcumin in GPs on dextran sulfate sodium induced colitis in rats.
31915902	7	19	gly	N-glycoforms	1182:1193	arg1	IgG N-glycoforms	IgG N-glycoforms				Cterm		IgG			Together, our finding suggests that BSA increases the complexity of IgG N-glycoforms, thus raising the difficulty in maintaining glycoforms consistency during antibody production.
32763405	9	60	part_of	CNF/PVA	1635:1641	arg1	high-performance CNF/PVA composites	CNF/PVA		high-performance CNF/PVA composites		OGER	Site	CNF/PVA	P32926	composites	This comparative study provided important knowledge of selecting CNF allomorph for fabrication of high-performance CNF/PVA composites.
34057448	6	14	part_of	composite	1498:1506	arg1	CNC	CNC		composite		OGER	Site	CNC	P70414	composite	However, BMMCs cultured on the CNC/agarose/D-mannitol substrate appeared to slightly increase their expression of the high-affinity IgE receptor (FcεRI) and the stem cell factor receptor (Kit; CD117), although this does not appear to be dependent on the amount of CNC in the bioink composite.
34057448	6	22	part_of	CNC	1480:1482	arg1	the bioink composite	CNC		the bioink composite		OGER	Site	CNC	P70414	composite	However, BMMCs cultured on the CNC/agarose/D-mannitol substrate appeared to slightly increase their expression of the high-affinity IgE receptor (FcεRI) and the stem cell factor receptor (Kit; CD117), although this does not appear to be dependent on the amount of CNC in the bioink composite.
33445487	9	70	gly	glycosylation	1091:1103	arg2	most sites			sites						sites	However, while glycosylation at most sites was dispensable for gB expression and fusogenicity, inactivation of N154 and N700 affected gB processing by furin cleavage and surface localization.
33674390	3	13	part_of	possesses	484:492	arg1	The procollagen C-Pro domain AND a single N-glycosylation site	The procollagen C-Pro domain		a single N-glycosylation site						site	The procollagen C-Pro domain possesses a single N-glycosylation site that is widely conserved in all the fibrillar procollagens across humans and diverse other species.
32569469	9	57	part_of	HSA	1999:2001	arg1	domain III	HSA		domain III		OGER	Site	HSA	Q15070	domain	Rod-shaped dextran-40 and spherical ficoll-70 hinder the microsecond conformational dynamics of domain III of HSA in all states except the intermediate state.
31970866	3	44	gly	glycopeptides	343:355	arg2	glycopeptides			glycopeptides						glycopeptides	Often employed affinities for glycopeptides are hydrazide, boronic acid, or physiosorbed lectin on support materials.
34655594	5	27	part_of	TiO2	786:789	arg1	the TiO2@GGH composite	TiO2@GGH		the TiO2@GGH composite		OGER	Site	TiO2@GGH	Q92820	composite	The mercury intrusion and N2 sorption isotherm indicate the macroporous structure of the TiO2@GGH composite, showing the presence of pore sizes ~420 μm.
34655594	5	43	part_of	@	790:790	arg1	the TiO2@GGH composite	TiO2@GGH		the TiO2@GGH composite		OGER	Site	TiO2@GGH	Q92820	composite	The mercury intrusion and N2 sorption isotherm indicate the macroporous structure of the TiO2@GGH composite, showing the presence of pore sizes ~420 μm.
34655594	5	50	part_of	GGH	791:793	arg1	the TiO2@GGH composite	TiO2@GGH		the TiO2@GGH composite		OGER	Site	TiO2@GGH	Q92820	composite	The mercury intrusion and N2 sorption isotherm indicate the macroporous structure of the TiO2@GGH composite, showing the presence of pore sizes ~420 μm.
33049125	5	14	part_of	WJ-MSC-laden	908:919	arg1	WJ-MSC-laden CHT/HA/PCL composites	MSC		WJ-MSC-laden CHT/HA/PCL composites		OGER	Site	MSC	O60682	composites	Although cell attachment and metabolic activity [3-4,5-dimethylthiazol-2yl-(2,5 diphenyl-2H-tetrazoliumbromide) assay] were ore enhanced in WJ-MSC-laden CHT/HA/PCL composites, scanning electron microscopy, real-time gene expression (alkaline phosphatase [ALP], collagen type I [Col I], osteocalcin [OCN], and bone morphogenetic protein 4 [BMP-4]), and immunostaining (COL I, β-CATENIN, OCN, and SCLEROSTIN [SOST]) demonstrated pronounced osteogenesis with terminal differentiation on BM-MSC-laden CHT/HA/PCL composites only.
33049125	5	36	part_of	CHT/HA/PCL	921:930	arg1	WJ-MSC-laden CHT/HA/PCL composites	CHT		WJ-MSC-laden CHT/HA/PCL composites		OGER	Site	CHT	Q9GZV3	composites	Although cell attachment and metabolic activity [3-4,5-dimethylthiazol-2yl-(2,5 diphenyl-2H-tetrazoliumbromide) assay] were ore enhanced in WJ-MSC-laden CHT/HA/PCL composites, scanning electron microscopy, real-time gene expression (alkaline phosphatase [ALP], collagen type I [Col I], osteocalcin [OCN], and bone morphogenetic protein 4 [BMP-4]), and immunostaining (COL I, β-CATENIN, OCN, and SCLEROSTIN [SOST]) demonstrated pronounced osteogenesis with terminal differentiation on BM-MSC-laden CHT/HA/PCL composites only.
33049125	5	47	part_of	BM-MSC-laden	1252:1263	arg1	BM-MSC-laden CHT/HA/PCL composites	MSC		BM-MSC-laden CHT/HA/PCL composites		OGER	Site	MSC	O60682	composites	Although cell attachment and metabolic activity [3-4,5-dimethylthiazol-2yl-(2,5 diphenyl-2H-tetrazoliumbromide) assay] were ore enhanced in WJ-MSC-laden CHT/HA/PCL composites, scanning electron microscopy, real-time gene expression (alkaline phosphatase [ALP], collagen type I [Col I], osteocalcin [OCN], and bone morphogenetic protein 4 [BMP-4]), and immunostaining (COL I, β-CATENIN, OCN, and SCLEROSTIN [SOST]) demonstrated pronounced osteogenesis with terminal differentiation on BM-MSC-laden CHT/HA/PCL composites only.
33049125	5	93	part_of	CHT/HA/PCL	1265:1274	arg1	BM-MSC-laden CHT/HA/PCL composites	CHT		BM-MSC-laden CHT/HA/PCL composites		OGER	Site	CHT	Q9GZV3	composites	Although cell attachment and metabolic activity [3-4,5-dimethylthiazol-2yl-(2,5 diphenyl-2H-tetrazoliumbromide) assay] were ore enhanced in WJ-MSC-laden CHT/HA/PCL composites, scanning electron microscopy, real-time gene expression (alkaline phosphatase [ALP], collagen type I [Col I], osteocalcin [OCN], and bone morphogenetic protein 4 [BMP-4]), and immunostaining (COL I, β-CATENIN, OCN, and SCLEROSTIN [SOST]) demonstrated pronounced osteogenesis with terminal differentiation on BM-MSC-laden CHT/HA/PCL composites only.
32894594	4	81	part_of	ECM	583:585	arg1	ECM composition	Defining ECM		ECM composition		OGER	Site	Defining ECM	Q13201	position	Defining ECM composition involving insoluble polymeric assemblies poses unique challenges to analysis and, thus, to comparing strains with quantitative ECM molecular correlates.
31896575	3	86	part_of	melanin	481:487	arg1	melanin deposition	melanin		melanin deposition		Fterm	Site	melanin		position	In C. neoformans, the pigment associates with key cellular constituents that are essential for melanin deposition within the cell wall.
34070741	2	97	part_of	channels	358:365	arg1	Vacant N-glycosylation sites	channels		Vacant N-glycosylation sites		Fterm	Site	channels		sites	Vacant N-glycosylation sites (N220 and N229) of Kv3, voltage-gated K+ channels of high-firing neurons, deeply perturb channel activity in neuroblastoma (NB) cells.
33013929	5	0	part_of	epitopes	1064:1071	arg1	the viral S protein	S protein		epitopes		PUBTATOR	Site	S protein	7448	epitopes	Among the predicted 69 linear B cell epitopes, 175 discontinuous B cell epitopes and 41 cytotoxic T lymphocyte epitopes in the viral S protein, we found that the protein structure and its potential function of some sites changed, such as the linear epitope length shortened and discontinuous epitope disappeared of G476S.
33013929	5	31	part_of	epitopes	990:997	arg1	the viral S protein	S protein		epitopes		PUBTATOR	Site	S protein	7448	epitopes	Among the predicted 69 linear B cell epitopes, 175 discontinuous B cell epitopes and 41 cytotoxic T lymphocyte epitopes in the viral S protein, we found that the protein structure and its potential function of some sites changed, such as the linear epitope length shortened and discontinuous epitope disappeared of G476S.
33013929	5	37	part_of	epitopes	1025:1032	arg1	the viral S protein	S protein		epitopes		PUBTATOR	Site	S protein	7448	epitopes	Among the predicted 69 linear B cell epitopes, 175 discontinuous B cell epitopes and 41 cytotoxic T lymphocyte epitopes in the viral S protein, we found that the protein structure and its potential function of some sites changed, such as the linear epitope length shortened and discontinuous epitope disappeared of G476S.
32902634	4	37	part_of	protein	811:817	arg1	the N-terminal domain	protein		the N-terminal domain		Fterm	Site	protein		domain	We describe a simple, relatively inexpensive procedure in which standard commercial media is supplemented with 13C-enriched glucose to achieve labeling of all glycans plus all alanines of the N-terminal domain of the highly glycosylated protein, CEACAM1.
32815934	2	12	part_of	pasta	490:494	arg1	The proximate composition	pasta		The proximate composition		OGER	Site	pasta	Q9Y2W3	position,	The proximate composition, total and resistant starch, and total, soluble and insoluble dietary fibre content as well as the cooking and sensorial quality of uncooked and cooked pasta were determined.
32942073	2	11	gly	fucosylated	266:276	arg1	fucosylated glycosaminoglycan				fucosylated glycosaminoglycan						A depolymerized fraction of fucosylated glycosaminoglycan from sea cucumber Holothuria fuscopunctata, dHG-5 (Mw 5.2 kDa), showed potent and selective inhibition of iXase (IC50, 14 nM).
34364549	2	35	part_of	PVA/CNC	539:545	arg1	the PVA/CNC nanocomposites	PVA		the PVA/CNC nanocomposites		OGER	Site	PVA	P32926	nanocomposites	The prepared CNC-PEGs were further used to reinforce the polyvinyl alcohol (PVA) at the loading of 0, 1, 3, 5, and 7 wt% in order to demonstrate the effects of the PEG length on the properties of the PVA/CNC nanocomposites.
34389423	8	54	part_of	PBC-rich	1491:1498	arg1	the PBC-rich domains	PBC		the PBC-rich domains		OGER	Site	PBC	P10515	domains	On the other hand, sufficient SDS admixed in SDs could suppress the size enhancement of the PBC-rich domains during water immersion and nanoparticle evolution (agglomeration and crystallization) after aqueous dispersion.
34560151	4	35	part_of	PCL/CNC	781:787	arg1	the developed PCL/WABR and PCL/CNC bio-composites	PCL/CNC		the developed PCL/WABR and PCL/CNC bio-composites		OGER	Site	PCL/CNC	P32418	bio-composites	FTIR, XRD, TGA, UTM, DSC, POM, and SAXS characterized the developed PCL/WABR and PCL/CNC bio-composites.
33256221	8	36	gly	fucosylated	1008:1018	arg1	The fucosylated and NeuAc-containing O-glycans				The fucosylated and NeuAc-containing O-glycans						The fucosylated and NeuAc-containing O-glycans were inversely proportional, with infected fish on the lower scale of NeuAc abundance and high on fucosylated structures.
33256221	8	47	gly	fucosylated	1149:1159	arg1	fucosylated structures				fucosylated structures						The fucosylated and NeuAc-containing O-glycans were inversely proportional, with infected fish on the lower scale of NeuAc abundance and high on fucosylated structures.
32204030	6	45	part_of	KGM/PVA	904:910	arg1	PVA and KGM/PVA (5:5) composites	KGM/PVA		PVA and KGM/PVA (5:5) composites		OGER	Site	KGM/PVA	P32926	composites	The fibrinogen adsorption rates of PVA and KGM/PVA (5:5) composites can reach about 20% and 60%, respectively.
32204030	6	54	part_of	PVA	896:898	arg1	PVA and KGM/PVA (5:5) composites	PVA		PVA and KGM/PVA (5:5) composites		OGER	Site	PVA	P32926	composites	The fibrinogen adsorption rates of PVA and KGM/PVA (5:5) composites can reach about 20% and 60%, respectively.
34074422	4	22	gly	N-glycopeptides	916:930	arg2	differentially expressed intact N-glycopeptides			differentially expressed intact N-glycopeptides						N-glycopeptides	To investigate the differentially expressed N-glycosylation in adriamycin-resistant breast cancer stem cells MCF-7/ADR CSCs (relative to MCF-7 CSCs) and find the putative biomarkers, 1:1 paired ZIC-HILIC-enriched and stable isotopic diethyl labelled (SIDE) intact N-glycopeptides from MCF-7/ADR CSCs and MCF-7 CSCs were analyzed with C18-RPLC-ESI-MS/MS (HCD with stepped NCE); differentially expressed intact N-glycopeptides (DEGPs) were identified and quantified via search engine GPSeeker.
34074422	4	73	gly	N-glycopeptides	771:785	arg2	1:1 paired ZIC-HILIC-enriched and stable isotopic diethyl labelled (SIDE) intact N-glycopeptides			1:1 paired ZIC-HILIC-enriched and stable isotopic diethyl labelled (SIDE) intact N-glycopeptides						N-glycopeptides	To investigate the differentially expressed N-glycosylation in adriamycin-resistant breast cancer stem cells MCF-7/ADR CSCs (relative to MCF-7 CSCs) and find the putative biomarkers, 1:1 paired ZIC-HILIC-enriched and stable isotopic diethyl labelled (SIDE) intact N-glycopeptides from MCF-7/ADR CSCs and MCF-7 CSCs were analyzed with C18-RPLC-ESI-MS/MS (HCD with stepped NCE); differentially expressed intact N-glycopeptides (DEGPs) were identified and quantified via search engine GPSeeker.
32172856	1	14	gly	Col/HA-Tyr	224:233	arg1	enzymatically-crosslinked Collagen/Tyramine hyaluronan derivative (Col/HA-Tyr) hydrogels			Tyr	enzymatically-crosslinked Collagen/Tyramine hyaluronan derivative (Col/HA-Tyr) hydrogels					Tyr	A platform of enzymatically-crosslinked Collagen/Tyramine hyaluronan derivative (Col/HA-Tyr) hydrogels with tunable compositions and gelation conditions was developed to evaluate the impact of the preparation conditions on their physical, chemical and biological properties.
32066333	6	67	gly	used	912:915	arg2	The synthesized Ag NPs-alginate composite			The synthesized Ag NPs-alginate composite						composite	The synthesized Ag NPs-alginate composite was further used to develop a paper-based sensor for the detection of H2O2.
34142506	18	66	part_of	nano-PPy/chitosan	2612:2628	arg1	nano-PPy/chitosan composite	PPy		nano-PPy/chitosan composite		OGER	Site	PPy	P01298	composite	CONCLUSION The modified chitosan basedon conductive composite nerve conduit made of nano-PPy/chitosan composite with different acetylation degrees has good biocompatibility, conductivity, and biodegradability correlated with acetylation degree in vivo, which provide a new scaffold material for the construction of tissue engineered nerve.
33256221	9	1	gly	fucosylated	1177:1187	arg1	The fucosylated epitopes			The fucosylated epitopes						epitopes	The fucosylated epitopes were of three types: Fuc-HexNAc-R, Gal-[Fuc-]HexNAc-R and HexNAc-[Fuc-]HexNAc-R.
34806923	11	16	part_of	VMT-Alg-6APA	1720:1731	arg1	the VMT-Alg-6APA composite	VMT-Alg-6APA		the VMT-Alg-6APA composite		OGER	Site	VMT-Alg-6APA		composite	The results showed that the VMT-Alg-6APA composite had strong activity against Gram-positive and Gram-negative bacteria.
32297468	2	71	part_of	Cu-HAP/CS/PVP	514:526	arg1	The Cu-HAP/CS/PVP composite	HAP		The Cu-HAP/CS/PVP composite		OGER	Site	HAP	O95197	composite	The Cu-HAP/CS/PVP composite with 80 wt% Cu-HAP showed 98.73 ± 1.14% of porosity with highest tensile strength (101.45 ± 0.98 MPa) and less swelling percentage (19.51 ± 1.03%) compared to others.
32128391	2	1	gly	glycosylation	268:280	arg1	IgG	IgG				PUBTATOR		IgG	16059		Aberrant glycosylation of IgG has been observed in many diseases, but little is understood about the underlying mechanisms.
32902634	5	54	gly	sequence	1009:1016	arg1	partially occupied N-glycan sites			sequence	partially occupied N-glycan sites					sequence	We demonstrate an ability to detect partially occupied N-glycan sites, sites less susceptible to processing by an endoglycosidase, and some unexpected truncation of the amino acid sequence.
31970866	0	73	gly	glycopeptides	78:90	arg2	glycopeptides			glycopeptides						glycopeptides	Boronic acid functionalized fibrous cellulose for the selective enrichment of glycopeptides.
33990962	5	6	part_of	MCC	893:895	arg1	MCC@TPS/paper composites	MCC		MCC@TPS/paper composites		OGER	Site	MCC		composites	TPS/paper composites and MCC@TPS/paper composites have better physical properties (i.e. smoothness, flexibility and folding resistance) than only paper.
33463166	10	4	part_of	LL37	1701:1704	arg1	the cCBD-LL37 and LL37 peptides	LL37		the cCBD-LL37 and LL37 peptides		PUBTATOR	Site	LL37	820	peptides	The presence of alginate in solution induced conformational changes in the cCBD-LL37 and LL37 peptides, resulting in increased peptide helicity, and reduced antimicrobial activity against P. aeruginosa.
33463166	10	42	part_of	cCBD-LL37	1687:1695	arg1	the cCBD-LL37 and LL37 peptides	LL37		the cCBD-LL37 and LL37 peptides		PUBTATOR	Site	LL37	820	peptides	The presence of alginate in solution induced conformational changes in the cCBD-LL37 and LL37 peptides, resulting in increased peptide helicity, and reduced antimicrobial activity against P. aeruginosa.
34390795	7	69	part_of	TPP	1000:1002	arg1	The composition	TPP		The composition		OGER	Site	TPP	Q5SSZ5	position,	The composition, molecular weight, and structural characterization of TPP and its fractions were evaluated by various techniques.
34694716	4	22	part_of	AGA	789:791	arg1	the prepared PPyNT@AGA nanocomposite	AGA		the prepared PPyNT@AGA nanocomposite		OGER	Site	AGA	P20933	nanocomposite	Interestingly, the prepared PPyNT@AGA nanocomposite exhibited 90% biofilm inhibition against gram-negative Pseudomonas aeruginosa, gram-positive Streptococcus pneumoniae and fungal strain Candida albicans with promising antimicrobial performance.
33381142	1	15	gly	glycoproteins	152:164	arg1	Plant cell wall associated hydroxyproline-rich glycoproteins	Plant cell wall associated hydroxyproline-rich glycoproteins				Fterm		glycoproteins			Plant cell wall associated hydroxyproline-rich glycoproteins (HRGPs) are involved in several aspects of plant growth and development, including wood formation in trees.
34960836	7	56	gly	glycoproteins	1007:1019	arg1	glycoproteins	glycoproteins				Fterm		glycoproteins			Only low amounts of glycoproteins, as well as medium amounts of the characteristic apiogalacturonan were likely to be present, while xylan seemed to be the most abundant polysaccharide in most fractions.
32652759	3	21	part_of	Cationic	476:483	arg1	Cationic fragments	Cationic		Cationic fragments		Cterm	Site	Cationic		fragments	Cationic fragments were generated from glycosyl donors carrying trichloroacetimidate or thioethyl leaving groups of different anomeric configuration.
32297468	1	33	part_of	Cu-HAP/CS/PVP	485:497	arg1	Cu-HAP/CS/PVP composite	HAP		Cu-HAP/CS/PVP composite		OGER	Site	HAP	O95197	composite	The tricomponent composite chitosan/polyvinyl pyrrolidone (CS/PVP) with different weight ratios of (0, 20, 40, 60, and 80 wt%) of copper-hydroxyapatite (Cu-HAP) were prepared by solvent casting technique, which was characterized by X-ray diffraction, Fourier-transform infrared, and scanning electron microscopy with energy-dispersive X-ray to confirm the formation of Cu-HAP/CS/PVP composite.
34687415	8	53	part_of	NPs	1111:1113	arg1	CS/AC/TiO2 NPs composite	TiO2 NPs		CS/AC/TiO2 NPs composite		OGER	Site	TiO2 NPs	P0C0P6	composite	The results showed that CS/AC/TiO2 NPs composite has an inhibitory effect and therefore considered antibacterial agents.
34687415	8	58	part_of	CS/AC/TiO2	1100:1109	arg1	CS/AC/TiO2 NPs composite	TiO2 NPs		CS/AC/TiO2 NPs composite		OGER	Site	TiO2 NPs	P0C0P6	composite	The results showed that CS/AC/TiO2 NPs composite has an inhibitory effect and therefore considered antibacterial agents.
32919574	6	1	part_of	PVA-GG-AgNPs	995:1006	arg1	The PVA-GG-AgNPs hydrogel composite	PVA		The PVA-GG-AgNPs hydrogel composite		OGER	Site	PVA	P32926	composite	The PVA-GG-AgNPs hydrogel composite exhibited excellent catalytic activity and antibacterial property, which makes them a suitable candidate for industrial applications.
34052274	8	12	part_of	CHT	1159:1161	arg1	CHT and CHT-metal composites	CHT		CHT and CHT-metal composites		OGER	Site	CHT	Q9GZV3	composites	The study showed that CMC and CMC-metal composites performed better at inhibiting the growth of microorganisms than CHT and CHT-metal composites.
34052274	8	40	part_of	CHT-metal	1167:1175	arg1	CHT and CHT-metal composites	CHT		CHT and CHT-metal composites		OGER	Site	CHT	Q9GZV3	composites	The study showed that CMC and CMC-metal composites performed better at inhibiting the growth of microorganisms than CHT and CHT-metal composites.
34354534	1	16	gly	glycosylated	354:365	arg1	glycosylated proteins	glycosylated proteins				Fterm		proteins			α-L-Rhamnosidases (α-L-Rha-ases, EC 3.2.1.40) are glycosyl hydrolases (GHs) that hydrolyze a terminal α-linked L-rhamnose residue from a wide spectrum of substrates such as heteropolysaccharides, glycosylated proteins, and natural flavonoids.
34925283	3	13	gly	glycoprotein	620:631	arg1	S-layer glycoprotein	S-layer glycoprotein				Fterm		glycoprotein			Following deletion of each encoding gene, the impact on N-glycosylation of the S-layer glycoprotein and archaellins, major glycoproteins in this organism, was assessed by mass spectrometry.
34925283	3	25	gly	glycoproteins	656:668	arg1	major glycoproteins	major glycoproteins				Fterm		glycoproteins			Following deletion of each encoding gene, the impact on N-glycosylation of the S-layer glycoprotein and archaellins, major glycoproteins in this organism, was assessed by mass spectrometry.
33049125	6	17	part_of	CHT/HA/PCL	1328:1337	arg1	CHT/HA/PCL composites	CHT		CHT/HA/PCL composites		OGER	Site	CHT	Q9GZV3	composites	The enhanced cell functionality on CHT/HA/PCL composites was explained in terms of interplay among the surface properties and the optimal source of MSCs.
32553494	3	21	part_of	β-CD	567:570	arg1	increased β-CD composition	-CD		increased β-CD composition		PUBTATOR	Site	-CD	65057	position	VE loading capacity was directly correlated with increased β-CD composition in the polymers and morphological changes were observed upon VE binding.
32541028	4	9	part_of	epitope	891:897	arg1	podoplanin	podoplanin		epitope		OGER	Site	podoplanin	Q62011	Tn-glycopeptide epitope	Previously, we used the scFv fragment of antibody 237 as a chimeric antigen receptor (CAR) to mediate recognition of mouse tumor cells that bear its cognate Tn-glycopeptide epitope in podoplanin, also called OTS8.
32541028	4	34	part_of	chimeric	777:784	arg1	the scFv fragment	chimeric antigen receptor		the scFv fragment		PUBTATOR	Site	chimeric antigen receptor	12355	fragment	Previously, we used the scFv fragment of antibody 237 as a chimeric antigen receptor (CAR) to mediate recognition of mouse tumor cells that bear its cognate Tn-glycopeptide epitope in podoplanin, also called OTS8.
32541028	4	68	part_of	scFv	742:745	arg1	the scFv fragment	scFv		the scFv fragment		PUBTATOR	Site	scFv	652070	fragment	Previously, we used the scFv fragment of antibody 237 as a chimeric antigen receptor (CAR) to mediate recognition of mouse tumor cells that bear its cognate Tn-glycopeptide epitope in podoplanin, also called OTS8.
32541028	4	82	part_of	antigen	786:792	arg1	the scFv fragment	chimeric antigen receptor		the scFv fragment		PUBTATOR	Site	chimeric antigen receptor	12355	fragment	Previously, we used the scFv fragment of antibody 237 as a chimeric antigen receptor (CAR) to mediate recognition of mouse tumor cells that bear its cognate Tn-glycopeptide epitope in podoplanin, also called OTS8.
32507236	2	30	gly	glycoprotein	405:416	arg1	a model glycoprotein	a model glycoprotein				Fterm		glycoprotein			AZGP1 is a potential biomarker for salivary diagnostics of lung cancer, which is used as a model glycoprotein in this study for method development.
33748076	9	75	gly	glycoproteins	1213:1225	arg1	The N-glycans	glycoproteins			The N-glycans	Fterm		glycoproteins			The N-glycans from DSA-enriched glycoproteins were released by PNGase F and further identified by MALDI-TOF/TOF-MS to obtain the precise structural information of the altered glycans.
32204030	8	16	part_of	KGM/PVA	1149:1155	arg1	KGM/PVA (5:5) composite	KGM/PVA		KGM/PVA (5:5) composite		OGER	Site	KGM/PVA	P32926	composite	After 7 days of cell culture, the optical density values of 3T3 fibroblasts on KGM/PVA (5:5) composite could reach 0.8.
32902634	6	38	gly	glycosylated	1302:1313	arg1	the many glycosylated proteins	the many glycosylated proteins				Fterm		proteins			The labeling of both the protein (through alanines) and the glycans in a single culture requiring no additional technical expertise past standard mammalian expression requirements is anticipated to have several applications, including structural and functional screening of the many glycosylated proteins important to human health.
32827799	0	33	part_of	Hep/silk-PLCL	43:55	arg1	Hep/silk-PLCL composite	Hep		Hep/silk-PLCL composite		PUBTATOR	Site	Hep	728489	composite	Construction and performance evaluation of Hep/silk-PLCL composite nanofiber small-caliber artificial blood vessel graft.
33020657	1	44	gly	glycopeptides	163:175	arg2	intact glycopeptides			intact glycopeptides						glycopeptides	Recent advances in methods for enrichment and mass spectrometric analysis of intact glycopeptides have produced large-scale glycoproteomics datasets, but interpreting these data remains challenging.
32518941	0	22	part_of	SARS-CoV-2	59:68	arg1	SARS-CoV-2 and accessible surface glycopeptide motifs	SARS		SARS-CoV-2 and accessible surface glycopeptide motifs		OGER	Site	SARS	P49591	glycopeptide motifs	Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics.
32518941	0	69	part_of	N-glycosites	21:32	arg1	spike glycoprotein	spike glycoprotein		N-glycosites		PUBTATOR	Site	spike glycoprotein	43740568	N-glycosites	Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics.
32399726	5	62	part_of	N-glycosylated	965:978	arg1	325 N-glycosylated peptides	325 N-glycosylated		325 N-glycosylated peptides		Cterm	Site	325 N-glycosylated		peptides	By combing pGC beads and nano LC-MS/MS analysis, a total of 325 N-glycosylated peptides corresponding to 152 N-glycosylated proteins were identified from 2 μL human serum.
33664475	2	23	gly	sialylated	203:212	arg1	sialylated human milk oligosaccharides	HMOs			sialylated human milk oligosaccharides	OGER		HMOs	P00540		While sialylated human milk oligosaccharides (HMOs) have been implicated in phenotypic programming, their selective role and underlying mechanisms remained elusive.
32719787	1	30	gly	glycoproteins	275:287	arg1	N-glycans	glycoproteins			N-glycans	Fterm		glycoproteins			Peptide-N 4-(N-acetyl-β-glucosaminyl) asparagine amidases (PNGases, N-glycanases, EC 3.5.1.52) are indispensable tools in releasing N-glycans from glycoproteins.
35164571	8	7	gly	precursors	1462:1471	arg1	the UDP-MurNAc-monopeptide	precursors			the UDP-MurNAc-monopeptide	Fterm		precursors			Through X-ray crystallographic and biochemical analyses, we demonstrate that YfiH is a hydrolase with a previously unknown activity specific for the UDP-MurNAc-monopeptide, one of the nucleotide precursors from the cytoplasmic steps of the PG biosynthesis pathway.
32204004	5	32	part_of	nHAp/CS	924:930	arg1	phase composition	HAp		phase composition		OGER	Site	HAp		position,	The microstructure, porosity, phase composition, swelling ratio, mechanical properties, and biocompatibility of the nHAp/CS scaffolds were thoroughly investigated.
33369080	4	17	part_of	TF	540:541	arg1	The composite	TF		The composite		Cterm	Site	TF	P13726	composite	The composite of TF, collagen and alginate (TCA) was made into hydrogel beads with a diameter range of 2.5-3.5 mm, followed by electron microscopy, infrared spectroscopy, rheological, and swelling characterization to confirm its composition and hydrogel nature.
32569469	7	8	part_of	HSA	1707:1709	arg1	domain III	HSA		domain III		OGER	Site	HSA	Q15070	domain	Moreover, while a two-state model can approximate the overall thermal denaturation of HSA in the absence and presence of various crowders, the thermal denaturation profile of domain III of HSA involves a distinct intermediate state.
33223210	2	8	gly	peroxidase	544:553	arg1	polysaccharide	peroxidase			polysaccharide	Fterm		peroxidase			Therefore, the aim of this study was to investigate the mechanism by which AM fungi immobilize Pb within the cell wall by measuring the Pb content in the cell wall, the polysaccharide and the uronic acid contents of different cell wall fractions, and the activity of cell wall peroxidase.
31915902	4	77	gly	N-glycoforms	489:500	arg1	IgG N-glycoforms	IgG N-glycoforms				Cterm		IgG			Here, we studied the effects on IgG N-glycoforms of different components in hybridoma culture media, specifically compared bovine serum albumin (BSA) with other small molecules, using a matrix-assisted laser desorption/ionization quadrupole ion trap time-of-flight multistage mass spectrometry (MALDI-QIT-TOF MSn)-based approach.
33551170	4	37	gly	glycosylation	730:742	arg1	whey proteins	whey proteins				Fterm		proteins			It is therefore highly relevant to understand whether and how the glycosylation of whey proteins (and their functionality) can be modulated.
32511307	2	9	gly	glycoproteins	368:380	arg1	the nascent glycoproteins	the nascent glycoproteins				Fterm		glycoproteins			We also analyze structures for glycoforms representing those present in the nascent glycoproteins (prior to enzymatic modifications in the Golgi), as well as those that are commonly observed on antigens present in other viruses.
34420745	0	31	part_of	protein	51:57	arg1	protein composition	protein		protein composition		Fterm	Site	protein		position	Starch molecular fine structure is associated with protein composition in chickpea seed.
32541028	5	0	gly	Tn-OTS8-glycopeptide	971:990	arg2	the 237 Fab:Tn-OTS8-glycopeptide complex			the 237 Fab:Tn-OTS8-glycopeptide complex						Tn-OTS8-glycopeptide	Guided by the structure of the 237 Fab:Tn-OTS8-glycopeptide complex, here we conducted a deep mutational scan showing that residues flanking the Tn-glycan contributed significant binding energy to the interaction.
33551170	0	62	gly	glycosylation	23:35	arg1	glycosylation-dependent cell adhesion molecule 1 (GlyCAM-1) whey protein	glycosylation-dependent cell adhesion molecule 1 (GlyCAM-1) whey protein				Fterm		protein			Variations in N-linked glycosylation of glycosylation-dependent cell adhesion molecule 1 (GlyCAM-1) whey protein: Intercow differences and dietary effects.
31970866	12	81	gly	glycoproteins	1526:1538	arg1	secreted glycoproteins	secreted glycoproteins				Fterm		glycoproteins			Enrichment from human serum recovers 18% extracellular and 72% secreted glycoproteins via bottom-up approach and online tools.
32511307	3	27	gly	glycoprotein	672:683	arg1	the S glycoprotein	the S glycoprotein				PUBTATOR		S glycoprotein	43740568		These models were subjected to molecular dynamics (MD) simulation to determine the extent to which glycan microheterogeneity impacts the antigenicity of the S glycoprotein.
33551170	7	26	gly	pool	1215:1218	arg1	milk protein	milk protein			pool	PUBTATOR		milk protein	281099		Overall, approximately 60% of the N-glycan pool in milk protein was sialylated, or fucosylated, or both; GlyCAM-1 contributed approximately 78% of the total number of glycans in the overall whey protein N-linked glycan pool.
33551170	7	66	gly	sialylated	1240:1249	arg1	the N-glycan pool				the N-glycan pool						Overall, approximately 60% of the N-glycan pool in milk protein was sialylated, or fucosylated, or both; GlyCAM-1 contributed approximately 78% of the total number of glycans in the overall whey protein N-linked glycan pool.
33551170	7	76	gly	protein	1228:1234	arg1	the N-glycan pool	milk protein			the N-glycan pool	PUBTATOR		milk protein	281099		Overall, approximately 60% of the N-glycan pool in milk protein was sialylated, or fucosylated, or both; GlyCAM-1 contributed approximately 78% of the total number of glycans in the overall whey protein N-linked glycan pool.
33551170	7	123	gly	fucosylated	1255:1265	arg1	the N-glycan pool				the N-glycan pool						Overall, approximately 60% of the N-glycan pool in milk protein was sialylated, or fucosylated, or both; GlyCAM-1 contributed approximately 78% of the total number of glycans in the overall whey protein N-linked glycan pool.
33183601	3	13	part_of	GPs	795:797	arg1	Composites	GPs		Composites		OGER	Site	GPs		Composites	Composites of GPs with incorporated curcumin showed promising results with the capability to lower symptoms of colitis and significantly decrease the production of pro-inflammatory cytokines TNF-α, IL-1β, IL-6, and the activity of MPO, as well.
32518941	7	52	part_of	SARS-CoV-2	1145:1154	arg1	All 22 N-glycosylated sites	SARS		All 22 N-glycosylated sites		OGER	Site	SARS	P49591	sites	All 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose N-glycans.
34628317	3	29	part_of	MCP	418:420	arg1	a magnetic chitosan-palygorskite (MCP) nanocomposite	MCP		a magnetic chitosan-palygorskite (MCP) nanocomposite		OGER	Site	MCP	P15529	nanocomposite	In the present study, a magnetic chitosan-palygorskite (MCP) nanocomposite was prepared through a straight-forward one pot synthesis approach to evaluate its lead (Pb2+) removal capacity from aqueous solution.
32511307	4	45	gly	glycoprotein	731:742	arg1	the S glycoprotein	the S glycoprotein				Cterm		S glycoprotein	43740568		Lastly, we have identified peptides in the S glycoprotein that are likely to be presented in human leukocyte antigen (HLA) complexes, and discuss the role of S protein glycosylation in potentially modulating the adaptive immune response to the SARS-CoV-2 virus or to a related vaccine.
33668637	5	62	part_of	glycoprotein	1675:1686	arg1	glycoprotein composition	glycoprotein		glycoprotein composition		Fterm	Site	glycoprotein		position	Overall, dietary Slab51® induces morphological and region-specific changes in glycoprotein composition of guinea fowl intestine, promoting gut health.
32297468	5	2	part_of	Cu-HAP/CS/PVP	1128:1140	arg1	the optimized Cu-HAP/CS/PVP composite	HAP		the optimized Cu-HAP/CS/PVP composite		OGER	Site	HAP	O95197	composite	In vitro bioactivity study revealed the formation of apatite on the optimized Cu-HAP/CS/PVP composite (80 wt% of Cu-HAP) in simulated body fluid (SBF) solution.
32289421	6	29	part_of	g-NCC/PLLA	923:932	arg1	g-NCC/PLLA biodegradable composites	NCC		g-NCC/PLLA biodegradable composites		OGER	Site	NCC	P55017	composites	This study provides a fast and effective modification method for g-NCC/PLLA biodegradable composites.
32902634	3	56	gly	glycosylated	451:462	arg1	glycosylated proteins	glycosylated proteins				Fterm		proteins			However, it can be expensive for glycosylated proteins expressed in mammalian culture where more costly isotopically enriched amino acids are usually used.
32810535	8	12	gly	FGF2	1165:1168	arg1	GalNAc 4S	FGF2			GalNAc 4S	OGER		FGF2	P09038		GalNAc 4S of YG-1 could be the binding sites of FGF2 and FGFR.
31970866	10	80	part_of	protein	1239:1245	arg1	all eight glycosylation sites	protein		all eight glycosylation sites		Fterm	Site	protein		sites	Moreover, protein binding capacity is determined as 213 mg/g and 41% sequence coverage of horseradish peroxidase protein with all eight glycosylation sites detected.
34202788	8	5	part_of	FOS	1419:1421	arg1	the composition	FOS		the composition		OGER	Site	FOS	P01100	position	Thus, it can be concluded that the DO concentration affects not only the yield of FOS but also the composition of FOS with different degrees of polymerization, which is the key factor in the fermentative production of FOS with a high polymerization degree.
34202788	8	29	part_of	FOS	1387:1389	arg1	the composition	FOS		the composition		OGER	Site	FOS	P01100	position	Thus, it can be concluded that the DO concentration affects not only the yield of FOS but also the composition of FOS with different degrees of polymerization, which is the key factor in the fermentative production of FOS with a high polymerization degree.
34890854	5	14	part_of	CDs	1250:1252	arg1	composition	CDs		composition		OGER	Site	CDs	Q92903	position	The study indicated the importance of the type and composition of derivatized CDs on chiral separations in capillary electrophoresis as well as the importance of proper quality control for cyclodextrin manufacturers.
31896257	5	32	gly	composition	1013:1023	arg1	the purified cell wall polysaccharides			position	the purified cell wall polysaccharides					position	However, the intact cell sample had a shape more similar to microbiota composition with the purified cell wall polysaccharides, rather than the damaged cells.
33291979	7	44	part_of	pasta	1084:1088	arg1	the composition	pasta		the composition		OGER	Site	pasta	Q9Y2W3	position	Irrespective of the composition of rice-based pasta, the optimal cooking time ranged within 2-4 min (unlike T0) and these samples could also be rehydrated in hot water within a short span of 5 min to attain textural qualities at par with their cooked counterparts and with sensorial scores well above the limit of acceptable range (≥5) (except T3 (80%RF + 20%WF)); nonetheless the cooked ones led to higher preference from the sensory panel.
32355733	8	29	gly	P-glycoprotein	1179:1192	arg1	P-glycoprotein	P-glycoprotein				PUBTATOR		P-glycoprotein	5243		Cisplatin-resistant variants were confirmed by higher half maximal inhibitory concentration (IC50) values and increased P-glycoprotein (ABCB1, P-gp) expression compared to A2780 cells.
34788748	0	34	part_of	MSC-laden	15:23	arg1	MSC-laden composites	MSC		MSC-laden composites		OGER	Site	MSC	O60682	composites	Fabrication of MSC-laden composites of hyaluronic acid hydrogels reinforced with MEW scaffolds for cartilage repair.
34074422	4	77	part_of	ZIC-HILIC-enriched	701:718	arg1	1:1 paired ZIC-HILIC-enriched and stable isotopic diethyl labelled (SIDE) intact N-glycopeptides	ZIC		1:1 paired ZIC-HILIC-enriched and stable isotopic diethyl labelled (SIDE) intact N-glycopeptides		OGER	Site	ZIC	Q15915	N-glycopeptides	To investigate the differentially expressed N-glycosylation in adriamycin-resistant breast cancer stem cells MCF-7/ADR CSCs (relative to MCF-7 CSCs) and find the putative biomarkers, 1:1 paired ZIC-HILIC-enriched and stable isotopic diethyl labelled (SIDE) intact N-glycopeptides from MCF-7/ADR CSCs and MCF-7 CSCs were analyzed with C18-RPLC-ESI-MS/MS (HCD with stepped NCE); differentially expressed intact N-glycopeptides (DEGPs) were identified and quantified via search engine GPSeeker.
32517333	6	9	part_of	GXM	1272:1274	arg1	short GXM fragments	GXM		short GXM fragments		Cterm	Site	GXM		fragments	This work provides mechanistic rationales for clinical observations-the importance of O-acetylation for antibody binding; the lack of binding of protective antibodies to short GXM fragments; the existence of epitopes that elicit non-protective antibodies; and the self-aggregation of GXM chains-indicating that molecular modelling can play a role in the rational design of conjugate vaccines.
33620143	1	25	part_of	fat	100:102	arg1	fat deposition	fat		fat deposition		PUBTATOR	Site	fat	2195	position	lactis BPL1: a novel postbiotic that reduces fat deposition via IGF-1 pathway.
32541028	2	73	gly	O-glycoprotein	368:381	arg1	aberrant O-glycoprotein epitopes	aberrant O-glycoprotein epitopes				Fterm		O-glycoprotein			It has been difficult to identify appropriate targets in nonhematopoietic tumors, but one class of antigens that have shown promise is aberrant O-glycoprotein epitopes.
33389854	0	18	gly	Tail	7:10	arg1	Crude Exopolysaccharides				Crude Exopolysaccharides						Turkey Tail Medicinal Mushroom, Trametes versicolor (Agaricomycetes), Crude Exopolysaccharides with Antioxidative Activity.
32478036	1	4	gly	glycopeptides	183:195	arg2	homogeneous complex N-linked glycopeptides			homogeneous complex N-linked glycopeptides						glycopeptides	Chemical synthesis is an attractive approach allows for the assembly of homogeneous complex N-linked glycopeptides and glycoproteins, but the limited coupling efficiency between glycans and peptides hampered the synthesis and research in the related field.
32478036	1	8	gly	glycoproteins	201:213	arg1	glycoproteins	glycoproteins				Fterm		glycoproteins			Chemical synthesis is an attractive approach allows for the assembly of homogeneous complex N-linked glycopeptides and glycoproteins, but the limited coupling efficiency between glycans and peptides hampered the synthesis and research in the related field.
32478036	2	15	gly	glycopeptide	410:421	arg2	N-linked glycopeptide			N-linked glycopeptide						glycopeptide	Herein we developed an alternative glycosylation to construct N-linked glycopeptide via efficient selenoester-assisted aminolysis, which employs the peptidyl ω-asparagine selenoester and unprotected glycosylamine to perform rapid amide-bond ligation.
34628317	4	1	part_of	MCP	649:651	arg1	the newly-developed MCP composite	MCP		the newly-developed MCP composite		OGER	Site	MCP	P15529	composite	The nano-architectural and physicochemical properties of the newly-developed MCP composite were described via micro- and nano-morphological analyses, and crystallinity, surface porosity and magnetic susceptibility measurements.
32460635	7	101	part_of	AuNP-PMS/FGF2	1467:1479	arg1	the AuNP-PMS/FGF2 composite	FGF2		the AuNP-PMS/FGF2 composite		PUBTATOR	Site	FGF2	14173	composite	The results showed that the AuNP-PMS/FGF2 composite could maintain a long-term stability at room temperature for at least 8 days, and greatly promote the neural differentiation of mESCs.
31954790	8	32	part_of	NaA-cl-AAc/GP	1193:1205	arg1	the NaA-cl-AAc/GP hydrogel composite	AAc		the NaA-cl-AAc/GP hydrogel composite		OGER	Site	AAc	Q6IB77	composite	Therefore, the NaA-cl-AAc/GP hydrogel composite is a potentially favourable material towards dye pollution remediation owing to its better swelling rate, environment friendliness, high adsorption potential and regeneration capability.
35087313	1	10	gly	glycoproteins	191:203	arg1	pharmaceutical glycoproteins	pharmaceutical glycoproteins				Fterm		glycoproteins			N-Glycosylation is essential for protein stability, activity and characteristics, and is often needed to deliver pharmaceutical glycoproteins to target cells.
33006278	10	33	gly	moieties	1705:1712	arg1	the heparosan chain	chain			moieties	OGER		chain	Q9Y251		This analytical tool could be applied towards heparosan chain mapping and analysis of unnatural sugar moieties in the heparosan chain.
34651560	12	53	part_of	Silver-ciprofloxacin	1524:1543	arg1	Silver-ciprofloxacin nano-composites	ciprofloxacin		Silver-ciprofloxacin nano-composites		Fterm	Site	ciprofloxacin		nano-composites	Silver-ciprofloxacin nano-composites exhibited comparable activity (zone of inhibition 19-30 mm) against E. coli to that of ciprofloxacin (standard, 21-35 mm) and relatively lower activity in case of S. aureus (zone of inhabitation 11-17 mm).
31970866	11	11	gly	glycopeptides	1304:1316	arg2	18 glycopeptides			18 glycopeptides						glycopeptides	Total of 18 glycopeptides are enriched from immunoglobulin digest showing ability of boronic acid@fibrous cellulose to enrich glycoproteins from multiglycoforms.
31970866	11	34	gly	glycoproteins	1418:1430	arg1	glycoproteins	glycoproteins				Fterm		glycoproteins			Total of 18 glycopeptides are enriched from immunoglobulin digest showing ability of boronic acid@fibrous cellulose to enrich glycoproteins from multiglycoforms.
32511307	5	42	part_of	ACE2	1108:1111	arg1	the ACE2 receptor binding domain	ACE2		the ACE2 receptor binding domain		PUBTATOR	Site	ACE2	59272	domain	The 3D structures show that the protein surface is extensively shielded from antibody recognition by glycans, with the exception of the ACE2 receptor binding domain, and also that the degree of shielding is largely insensitive to the specific glycoform.
32682974	8	6	part_of	@	1175:1175	arg1	the MC@CA(1) aerogel composite	MC@CA(1		the MC@CA(1) aerogel composite		OGER	Site	MC@CA(1	P00915	composite	Finally, the MC@CA(1) aerogel composite was reused in five successive cycles, with a slight loss of its activity during the fifth cycle due to the slight leaching of iron in the reaction medium.
32682974	8	21	part_of	CA	1176:1177	arg1	the MC@CA(1) aerogel composite	MC@CA(1		the MC@CA(1) aerogel composite		OGER	Site	MC@CA(1	P00915	composite	Finally, the MC@CA(1) aerogel composite was reused in five successive cycles, with a slight loss of its activity during the fifth cycle due to the slight leaching of iron in the reaction medium.
32682974	8	30	part_of	MC	1173:1174	arg1	the MC@CA(1) aerogel composite	MC@CA(1		the MC@CA(1) aerogel composite		OGER	Site	MC@CA(1	P00915	composite	Finally, the MC@CA(1) aerogel composite was reused in five successive cycles, with a slight loss of its activity during the fifth cycle due to the slight leaching of iron in the reaction medium.
33978738	5	21	part_of	sites	1457:1461	arg1	proteins	proteins		sites		Fterm	Site	proteins		sites	The PDB Exchange MacroMolecular Crystallographic Information File data dictionary now supports (i) standardized atom nomenclature that conforms to International Union of Pure and Applied Chemistry-International Union of Biochemistry and Molecular Biology (IUPAC-IUBMB) recommendations for carbohydrates, (ii) uniform representation of branched entities for oligosaccharides, (iii) commonly used linear descriptors of carbohydrates developed by the glycoscience community and (iv) annotation of glycosylation sites in proteins.
34646811	2	36	gly	glycoproteins	345:357	arg1	glycoproteins	glycoproteins				Fterm		glycoproteins			These fluids contain an abundant number of glycoproteins and extracellular vesicles secreted by the prostate gland, and the ability to detect changes in their N-glycans composition as a reflection of disease state represents potential new biomarker candidates.
32460635	8	61	part_of	AuNP-PMS/FGF2	1665:1677	arg1	the AuNP-PMS/FGF2 composite	FGF2		the AuNP-PMS/FGF2 composite		PUBTATOR	Site	FGF2	14173	composite	Compared with the other materials, the AuNP-PMS/FGF2 composite could significantly stimulate the expression of the specific neural differentiation markers (nestin and β3-tubulin), while obviously down-regulate the mRNA production of pluripotency marker Oct-4 in mESCs.
32128391	0	35	gly	Glycosylation	0:12	arg1	immunoglobulin G	immunoglobulin G				Cterm		immunoglobulin G	16059		Glycosylation of immunoglobulin G is regulated by a large network of genes pleiotropic with inflammatory diseases.
32637953	6	64	part_of	epitope	891:897	arg1	the SARS-CoV-2 spike	spike		epitope		PUBTATOR	Site	spike	43740568	epitope	These data reveal a new epitope on the SARS-CoV-2 spike that can be targeted for vaccine design.
32673719	7	28	part_of	CNC-based	1319:1327	arg1	The CNC-based composites	CNC		The CNC-based composites		OGER	Site	CNC	P32418	composites	The CNC-based composites showed better thermal stability and improved crystallinity property.
34768961	0	34	gly	Heterogeneity	82:94	arg1	Glycosaminoglycans				Glycosaminoglycans						The Influences of Sulphation, Salt Type, and Salt Concentration on the Structural Heterogeneity of Glycosaminoglycans.
32027903	11	39	gly	used	1527:1530	arg2	cellulose/clay composite			cellulose/clay composite						composite	The results showed that cellulose/clay composite are efficient for the removal dyes and could possibly be used for the treatment of textile effluents.
32652759	2	22	part_of	B-type	432:437	arg1	B-type fragments	B-type		B-type fragments		Cterm	Site	B-type		fragments	Herein, we use cryogenic vibrational spectroscopy and ion mobility-mass spectrometry to study the structure of B-type fragments of protected galactosides.
34925283	2	51	gly	glycoproteins	488:500	arg1	glycoproteins	glycoproteins				Fterm		glycoproteins			Toward expanding the number of delineated archaeal N-glycosylation pathways, the involvement of the putative Halobacterium salinarum glycosyltransferases VNG1067G, VNG1066C, and VNG1062G in the assembly of an N-linked tetrasaccharide decorating glycoproteins in this species was addressed.
33338254	4	17	gly	glycoproteins	735:747	arg1	AGP-like glycoproteins	AGP-like glycoproteins				Fterm		glycoproteins			This article presents the first experimental confirmation of AGP-like glycoproteins in Ulva species and provides a simple extraction protocol of Ulva lactuca AGP-like glycoproteins, their partial characterization and unique comparison to scarcely described Solanum lycopersicum AGPs.
33338254	4	35	gly	glycoproteins	832:844	arg1	Ulva lactuca AGP-like glycoproteins	Ulva lactuca AGP-like glycoproteins				Fterm		glycoproteins			This article presents the first experimental confirmation of AGP-like glycoproteins in Ulva species and provides a simple extraction protocol of Ulva lactuca AGP-like glycoproteins, their partial characterization and unique comparison to scarcely described Solanum lycopersicum AGPs.
32518941	9	60	part_of	spike	1313:1317	arg1	the spike receptor-binding domain	spike		the spike receptor-binding domain		PUBTATOR	Site	spike	43740568	domain	Electron densities of glycans cover most of the spike receptor-binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1.
32518941	9	66	part_of	SARS-CoV-2	1346:1355	arg1	the spike receptor-binding domain	SARS		the spike receptor-binding domain		OGER	Site	SARS	P49591	domain	Electron densities of glycans cover most of the spike receptor-binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1.
33013929	7	3	gly	glycosylation	1577:1589	arg2	glycosylation sites			glycosylation sites						sites	Our findings provided an important snapshot of temporal and geographical distributions on SARS-CoV-2 S protein cell epitopes and glycosylation sites, which would be an essential basis for the selection of vaccine candidates.
33013929	7	3	gly	glycosylation	1577:1589	arg2	SARS-CoV-2 S protein cell epitopes			SARS-CoV-2 S protein cell epitopes						epitopes	Our findings provided an important snapshot of temporal and geographical distributions on SARS-CoV-2 S protein cell epitopes and glycosylation sites, which would be an essential basis for the selection of vaccine candidates.
34255124	0	13	gly	synthesis	50:58	arg1	Lactiplantibacillus plantarum VAL6			Lactiplantibacillus plantarum VAL6	Lactiplantibacillus plantarum VAL6		AminoAcid			VAL6	Expression of genes involved in exopolysaccharide synthesis in Lactiplantibacillus plantarum VAL6 under environmental stresses.
32473217	5	47	gly	TFP	1361:1363	arg1	monosaccharide composition	TFP			monosaccharide composition	OGER		TFP	Q9HCM9		High performance liquid chromatography, Fourier-transform infrared spectroscopy, Carbon-13 nuclear magnetic resonance, scanning electron microscopy, atomic force microscopy, and Congo red results indicated that the treatment could break down the polysaccharide chains, hinder the aggregation, and improve the conformation flexibility of the TFP molecules without changing the primary structure and monosaccharide composition of TFP.
34011985	6	10	part_of	factors	1083:1089	arg1	composition	factors		composition		Fterm	Site	factors		position	Production and localisation of the pulcherrimin strongly depended on composition of the media and other culture factors.
34638753	0	32	part_of	Fluorapatite/β-1,3-Glucan	14:38	arg1	Highly Porous Fluorapatite/β-1,3-Glucan Composite	-1,3		Highly Porous Fluorapatite/β-1,3-Glucan Composite		PUBTATOR	Site	-1,3	28888	Composite	Highly Porous Fluorapatite/β-1,3-Glucan Composite for Bone Tissue Regeneration: Characterization and In-Vitro Assessment of Biomedical Potential.
34574138	8	9	part_of	CMP-derived	1121:1131	arg1	159 CMP-derived peptides	159 CMP		159 CMP-derived peptides		OGER	Site	159 CMP	P21941	peptides	Fifty-one intact CMPs and 159 CMP-derived peptides were identified in four samples (one CMP standard, two commercial CMP products and one whey protein isolate).
34364549	6	19	part_of	PVA/CNC	1026:1032	arg1	PVA/CNC composites	PVA		PVA/CNC composites		OGER	Site	PVA	P32926	composites	The longer PEG graft length yields high graft-matrix entanglement, forming a thicker rubbery coating layer that enhances the toughness of PVA/CNC composites.
32637953	0	22	part_of	spike	35:39	arg1	the SARS-CoV-2 spike ectodomain	spike		the SARS-CoV-2 spike ectodomain		PUBTATOR	Site	spike	43740568	ectodomain	A glycan cluster on the SARS-CoV-2 spike ectodomain is recognized by Fab-dimerized glycan-reactive antibodies.
32637953	0	41	part_of	SARS-CoV-2	24:33	arg1	the SARS-CoV-2 spike ectodomain	SARS		the SARS-CoV-2 spike ectodomain		OGER	Site	SARS	P49591	ectodomain	A glycan cluster on the SARS-CoV-2 spike ectodomain is recognized by Fab-dimerized glycan-reactive antibodies.
32693141	7	11	part_of	had	905:907	arg1	Chitin AND composition	Chitin		composition		Fterm	Site	Chitin		position	Chitin and chitosan from both pupae and shells had similar structure and composition.
32921414	0	7	gly	disialylated	60:71	arg1	a disialylated O-linked glycopeptide			a disialylated O-linked glycopeptide						glycopeptide	Crystal structure of an anti-podoplanin antibody bound to a disialylated O-linked glycopeptide.
32921414	0	41	gly	glycopeptide	82:93	arg2	a disialylated O-linked glycopeptide			a disialylated O-linked glycopeptide						glycopeptide	Crystal structure of an anti-podoplanin antibody bound to a disialylated O-linked glycopeptide.
33391325	2	68	gly	glycoproteins	159:171	arg1	glycoproteins	glycoproteins				Fterm		glycoproteins			Since the majority of them are glycoproteins, their N-glycosylation profiles are major determinants for their activity, structural properties and safety.
33463166	0	50	part_of	LL37	58:61	arg1	Chimeric Collagen-Binding LL37 Antimicrobial Peptides	LL37		Chimeric Collagen-Binding LL37 Antimicrobial Peptides		PUBTATOR		LL37	820		Alginate Affects Bioactivity of Chimeric Collagen-Binding LL37 Antimicrobial Peptides Adsorbed to Collagen-Alginate Wound Dressings.
33291979	2	101	part_of	Pasta	189:193	arg1	T1-T10	Pasta		T1-T10		OGER	SiteSequence	Pasta	Q9Y2W3	T1-T10	Pasta samples (T1-T10) having different proportions of rice flour (RF, 60-80%), wheat flour (WF, 40-12%), malted green gram flour (MGGF, 5 and 10%) and guar gum (GG, 1-3%) were prepared using a single screw extruder.
34808780	3	49	part_of	HMW-GSs	511:517	arg1	their HMW-GSs compositions	GSs		their HMW-GSs compositions		OGER	Site	GSs	P48637	positions	Thus four recombinant inbred lines, SS 1, SS 2, ZZ 1 and ZZ 2, were selected based on their HMW-GSs compositions.
33013929	7	5	part_of	S	1549:1549	arg1	SARS-CoV-2 S protein cell epitopes	S protein		SARS-CoV-2 S protein cell epitopes		PUBTATOR	Site	S protein	7448	epitopes	Our findings provided an important snapshot of temporal and geographical distributions on SARS-CoV-2 S protein cell epitopes and glycosylation sites, which would be an essential basis for the selection of vaccine candidates.
33013929	7	5	part_of	S	1549:1549	arg1	glycosylation sites	S protein		glycosylation sites		PUBTATOR	Site	S protein	7448	sites	Our findings provided an important snapshot of temporal and geographical distributions on SARS-CoV-2 S protein cell epitopes and glycosylation sites, which would be an essential basis for the selection of vaccine candidates.
33013929	7	41	part_of	protein	1551:1557	arg1	SARS-CoV-2 S protein cell epitopes	S protein		SARS-CoV-2 S protein cell epitopes		PUBTATOR	Site	S protein	7448	epitopes	Our findings provided an important snapshot of temporal and geographical distributions on SARS-CoV-2 S protein cell epitopes and glycosylation sites, which would be an essential basis for the selection of vaccine candidates.
33013929	7	41	part_of	protein	1551:1557	arg1	glycosylation sites	S protein		glycosylation sites		PUBTATOR	Site	S protein	7448	sites	Our findings provided an important snapshot of temporal and geographical distributions on SARS-CoV-2 S protein cell epitopes and glycosylation sites, which would be an essential basis for the selection of vaccine candidates.
33013929	7	60	part_of	SARS-CoV-2	1538:1547	arg1	SARS-CoV-2 S protein cell epitopes	SARS		SARS-CoV-2 S protein cell epitopes		OGER	Site	SARS	P49591	epitopes	Our findings provided an important snapshot of temporal and geographical distributions on SARS-CoV-2 S protein cell epitopes and glycosylation sites, which would be an essential basis for the selection of vaccine candidates.
33013929	7	60	part_of	SARS-CoV-2	1538:1547	arg1	glycosylation sites	SARS		glycosylation sites		OGER	Site	SARS	P49591	sites	Our findings provided an important snapshot of temporal and geographical distributions on SARS-CoV-2 S protein cell epitopes and glycosylation sites, which would be an essential basis for the selection of vaccine candidates.
32588539	6	50	part_of	BGN/CH	740:745	arg1	several BGN/CH composites	BGN		several BGN/CH composites		OGER	Site	BGN	P21810	composites	In this work, several BGN/CH composites have been prepared by varying the proportion of BGN in the hybrid scaffold (20, 40, 60, and 80%).
32902634	4	3	gly	glycosylated	798:809	arg1	the highly glycosylated protein	the highly glycosylated protein				Fterm		protein			We describe a simple, relatively inexpensive procedure in which standard commercial media is supplemented with 13C-enriched glucose to achieve labeling of all glycans plus all alanines of the N-terminal domain of the highly glycosylated protein, CEACAM1.
32902634	4	3	gly	glycosylated	798:809	arg1	CEACAM1	CEACAM1				PUBTATOR		CEACAM1	634		We describe a simple, relatively inexpensive procedure in which standard commercial media is supplemented with 13C-enriched glucose to achieve labeling of all glycans plus all alanines of the N-terminal domain of the highly glycosylated protein, CEACAM1.
34661088	4	58	gly	de-N-glycosylated	655:671	arg1	de-N-glycosylated S1 proteins	de-N-glycosylated S1 proteins				Cterm		de-N-glycosylated S1 proteins	Q15517		Using real-time surface plasmon resonance assay the negative effects were demonstrated by the considerable increase of binding affinities of de-N-glycosylated S1 proteins produced from three different expression systems including baculovirus-insect, Chinese hamster ovarian and two variants of human embryonic kidney 293 cells.
34649200	0	31	part_of	polyurethane/chitin/rosin	37:61	arg1	sustainable polyurethane/chitin/rosin composites	chitin		sustainable polyurethane/chitin/rosin composites		Fterm	Site	chitin		composites	Rational formulations of sustainable polyurethane/chitin/rosin composites reinforced with ZnO-doped-SiO2 nanoparticles for green packaging applications.
31961483	4	67	gly	fucosylated	710:720	arg1	fucosylated N-glycans				fucosylated N-glycans						In the present study, matrix-assisted laser desorption/ionization-time-of-flight-mass spectrometry (MALDI-TOF-MS) analysis revealed that the composition profiling of fucosylated N-glycans differed between high metastatic C8161 and low metastatic A375P cells.
34146360	9	11	part_of	βG-Ag	1531:1535	arg1	the combined βG-Ag NPs nanocomposites	βG-Ag NPs		the combined βG-Ag NPs nanocomposites		OGER	Site	βG-Ag NPs	P0C0P6	nanocomposites	The inventive Ag NPs biosynthesis with βG NPs and the combined βG-Ag NPs nanocomposites could be impressively recommended as powerful antibacterial candidates with minor potential toxicity.
34146360	9	28	part_of	NPs	1537:1539	arg1	the combined βG-Ag NPs nanocomposites	βG-Ag NPs		the combined βG-Ag NPs nanocomposites		OGER	Site	βG-Ag NPs	P0C0P6	nanocomposites	The inventive Ag NPs biosynthesis with βG NPs and the combined βG-Ag NPs nanocomposites could be impressively recommended as powerful antibacterial candidates with minor potential toxicity.
34788748	8	17	part_of	MSC-laden	1736:1744	arg1	MSC-laden composites	MSC		MSC-laden composites		OGER	Site	MSC	O60682	composites	Lastly, integration of composites with native tissue was assessedex vivo; MSC-laden composites implanted after 28 d of pre-culture exhibited increased integration strengths and contact areas compared to acellular composites.
34638753	3	52	part_of	HAP/glucan	663:672	arg1	a hydroxyapatite/glucan composite	HAP		a hydroxyapatite/glucan composite		OGER	Site	HAP	O95197	composite	Its physicochemical and microstructural properties were evaluated using scanning electron microscopy (SEM), Fourier transform infrared spectroscopy (FTIR), mercury intrusion, mechanical testing and compared with the reference material, which was a hydroxyapatite/glucan composite ("HAP/glucan") with hydroxyapatite granules (HAP) instead of FAP.
32507236	3	12	gly	300 N-glycoproteins	557:575	arg1	300 N-glycoproteins	300 N-glycoproteins				Fterm		300 N-glycoproteins			We initially analyzed salivary N-glycoproteome by using lectin affinity chromatography and more than 300 N-glycoproteins were identified, including AZGP1.
32431565	8	29	gly	fucosylated	1530:1540	arg1	complex fucosylated N-linked glycans				complex fucosylated N-linked glycans						The utilization of this β-mannosylation was demonstrated by an efficient synthesis of the hexasaccharide core of complex fucosylated N-linked glycans.
35087313	2	32	gly	glycoproteins	316:328	arg1	glycoproteins	glycoproteins				Fterm		glycoproteins			A paucimannosidic structure, Man3GlcNAc2 (M3), has been reported to enable cellular uptake of glycoproteins through the mannose receptor (MR) in humans, and such uptake has been exploited for the treatment of certain diseases.
32507236	7	58	gly	AZGP1	1116:1120	arg1	the glycan structures	AZGP1			the glycan structures	PUBTATOR		AZGP1	563		We further compared the glycan structures of salivary AZGP1 from lung cancer group and control group.
32538381	8	52	part_of	chitosan-insulin	1485:1500	arg1	chitosan-insulin electrosprayed nanosphere composites	insulin		chitosan-insulin electrosprayed nanosphere composites		OGER	Site	insulin	P01308	composites	The results suggested that this injectable pH-temperature sensitive hydrogel containing chitosan-insulin electrosprayed nanosphere composites has promising potential applications for type 1 diabetes treatment.
34515908	9	52	gly	heparin	1409:1415	arg1	glycan composition	heparin			glycan composition	Fterm		heparin			The above results demonstrated that compared with the sulfate location and glycan composition of heparin, the content of sulfate was the most essential factor for the MB binding.
33125195	5	77	gly	used	1084:1087	arg2	The starch-clay composites			The starch-clay composites						composites	The starch-clay composites were characterized and used as direct compression excipients for the preparation of tramadol tablets.
33128033	2	74	gly	N-glycans	302:310	arg1	Fc region			Fc region	Fc region		Site			region	Because N-glycans in Fc region of antibodies show cross-reactivity with various lectins, high-quality aglycosylated antibodies are exceptionally important for immunoassay platform-based quantitative measurements.
32399726	1	1	gly	glycopeptides	356:368	arg2	glycopeptides			glycopeptides						glycopeptides	A porous hydrophilic affinity bead consisting of graphene oxide and chitosan (pGC) with the honeycomb-biomimetic microchannels has been synthesized and applied as hydrophilic adsorbent for selective capture of glycopeptides.
32804173	6	47	gly	glycoproteins	824:836	arg1	model glycoproteins fetuin and ribonuclease B (RNase B)	model glycoproteins fetuin and ribonuclease B (RNase B)				Fterm		glycoproteins			We evaluated this method with reduced and permethylated glycans derived from model glycoproteins fetuin and ribonuclease B (RNase B), and then implemented it to human blood serum to generate C18 and PGC column-based isomeric glycan libraries.
32804173	6	47	gly	glycoproteins	824:836	arg1	fetuin	fetuin				Fterm		fetuin			We evaluated this method with reduced and permethylated glycans derived from model glycoproteins fetuin and ribonuclease B (RNase B), and then implemented it to human blood serum to generate C18 and PGC column-based isomeric glycan libraries.
32804173	6	47	gly	glycoproteins	824:836	arg1	ribonuclease B	ribonuclease B				Cterm		ribonuclease B			We evaluated this method with reduced and permethylated glycans derived from model glycoproteins fetuin and ribonuclease B (RNase B), and then implemented it to human blood serum to generate C18 and PGC column-based isomeric glycan libraries.
33256116	3	53	gly	isolated	510:517	arg2	porcine heparin AND specifically glucuronic acids	porcine heparin			specifically glucuronic acids	Fterm		heparin			Uronic NRE (specifically glucuronic acids) have been isolated from porcine heparin, with GlcA-GlcNS,3S,6S identified as a porcine-specific NRE marker.
33691231	8	91	part_of	SA/DCP	982:987	arg1	SA/DCP cement composites	DCP		SA/DCP cement composites		OGER	Site	DCP	P12821	composites	SA/DCP cement composites were synthesized by dissolving different amounts of SA into water (1.0 mL) to obtain different final concentrations (0.5%, 1%, 2% and 3%).
33674390	9	37	gly	C-Pro	1451:1455	arg1	the C-Pro N-glycan			Pro	the C-Pro N-glycan					Pro	Finally, we show that the C-Pro N-glycan is actually critical for the folding and secretion of even wild-type procollagen under ER stress conditions.
32471515	12	90	part_of	composition	1985:1995	arg1	PsA	PsA		composition		OGER	Site	PsA	P07288	position	Beyond morphology, advanced MRI techniques may be used to assess cartilage composition in PsA and to identify early changes in the cartilage as an imaging biomarker with potential application in detection, monitoring, and prediction of outcomes of PsA.
32637953	5	2	part_of	S	714:714	arg1	the S protein ectodomain	cryo-EM structure of the S protein		the S protein ectodomain		OGER	Site	cryo-EM structure of the S protein	Q15517	ectodomain	A 3.1 Å resolution cryo-EM structure of the S protein ectodomain bound to glycan-dependent HIV-1 bnAb 2G12 revealed a quaternary glycan epitope on the spike S2 domain involving multiple protomers.
32637953	5	4	part_of	protein	716:722	arg1	the S protein ectodomain	cryo-EM structure of the S protein		the S protein ectodomain		OGER	Site	cryo-EM structure of the S protein	Q15517	ectodomain	A 3.1 Å resolution cryo-EM structure of the S protein ectodomain bound to glycan-dependent HIV-1 bnAb 2G12 revealed a quaternary glycan epitope on the spike S2 domain involving multiple protomers.
32637953	5	20	part_of	spike	821:825	arg1	the spike S2 domain	spike S2		the spike S2 domain		PUBTATOR	Site	spike S2	43740568	domain	A 3.1 Å resolution cryo-EM structure of the S protein ectodomain bound to glycan-dependent HIV-1 bnAb 2G12 revealed a quaternary glycan epitope on the spike S2 domain involving multiple protomers.
32637953	5	62	part_of	S2	827:828	arg1	the spike S2 domain	spike S2		the spike S2 domain		PUBTATOR	Site	spike S2	43740568	domain	A 3.1 Å resolution cryo-EM structure of the S protein ectodomain bound to glycan-dependent HIV-1 bnAb 2G12 revealed a quaternary glycan epitope on the spike S2 domain involving multiple protomers.
32800955	9	11	part_of	CHT/ZnO	1194:1200	arg1	CHT/ZnO composites	CHT		CHT/ZnO composites		OGER	Site	CHT	Q9GZV3	composites	CHT/ZnO composites can be good alternatives to the toxic antifouling paints.
34074422	6	46	gly	N-glycopeptide	1244:1257	arg2	5515 intact N-glycopeptide IDs			5515 intact N-glycopeptide IDs						N-glycopeptide	Among 5515 intact N-glycopeptide IDs, 3864 were identified with glycoform score≥1, i.e., one or more structure-diagnostic fragment ions were observed to distinguish sequence isomers.
33674390	1	41	part_of	trimers	291:297	arg1	composition	trimers		composition		Fterm	Site	trimers		position	Intracellular procollagen folding begins at the protein's C-terminal propeptide (C-Pro) domain, which initiates triple-helix assembly and defines the composition and chain register of fibrillar collagen trimers.
32597501	3	83	part_of	pectin-alginate	744:758	arg1	a pectin-alginate composite	pectin		a pectin-alginate composite		Fterm	Site	pectin		composite	The present study describes the encapsulation of rutin and trans-ferulic acid-rich extracts from papaya exocarp in a pectin-alginate composite, evaluating the performance of gallic acid encapsulation obtained through in situ and two-step entrapment methods.
33090346	0	39	part_of	keratin/cellulose-based	36:58	arg1	novel and ecological keratin/cellulose-based composites	keratin		novel and ecological keratin/cellulose-based composites		PUBTATOR	Site	keratin	396479	composites	Development of novel and ecological keratin/cellulose-based composites for absorption of oils and organic solvents.
34634327	1	13	part_of	CNC	399:401	arg1	konjac glucomannan (KGM)/cotton cellulose nanocrystals (CNC) composites	CNC		konjac glucomannan (KGM)/cotton cellulose nanocrystals (CNC) composites		OGER	Site	CNC	P32418	composites	In this study, environmentally friendly bionanocomposite films were prepared by incorporating phlorotannins from Sargassum (PS) into konjac glucomannan (KGM)/cotton cellulose nanocrystals (CNC) composites.
34694716	3	27	part_of	AGA	501:503	arg1	a PPyNT-enhanced AGA (PPyNT@AGA) hybrid nanocomposite	AGA		a PPyNT-enhanced AGA (PPyNT@AGA) hybrid nanocomposite		OGER	Site	AGA	P20933	nanocomposite	The morphology of a PPyNT-enhanced AGA (PPyNT@AGA) hybrid nanocomposite was studied by scanning electron microscopy and transmission electron microscopy and their affirmed interactions were characterised by X-ray diffraction, Raman, Fourier transform-infrared and UV-visible spectroscopy.
32921414	2	38	part_of	residue	502:508	arg1	hPDPN	hPDPN		residue		PUBTATOR	AminoAcid	hPDPN	10630	Thr76 residue	We previously developed an anti-human PDPN (hPDPN) monoclonal antibody (mAb), clone LpMab-3, which recognizes the epitope, including both the peptides and the attached disialy-core-l (NeuAcα2-3Galβl-3 [NeuAcα2-6]GalNAcαl-O-Thr) structure at the Thr76 residue in hPDPN.
32673719	5	53	part_of	CNC	1069:1071	arg1	the resulting CNC composites	CNC		the resulting CNC composites		OGER	Site	CNC	P32418	composites	The phenolic structure and the hydrogen donation of H-lignin also endowed the resulting CNC composites with excellent UV blocking and antioxidant activity.
32800955	3	26	part_of	/ZnO	366:369	arg1	CHT 1%/ZnO composite	CHT 1%/ZnO		CHT 1%/ZnO composite		OGER	Site	CHT 1%/ZnO	Q9GZV3	composite	CHT 1%/ZnO composite had ZnO NRs incorporated into chitosan (CHT) coating while ZnO NRs were not visible in the CHT 2%/ZnO NRs composite.
32800955	3	31	part_of	CHT	360:362	arg1	CHT 1%/ZnO composite	CHT 1%/ZnO		CHT 1%/ZnO composite		OGER	Site	CHT 1%/ZnO	Q9GZV3	composite	CHT 1%/ZnO composite had ZnO NRs incorporated into chitosan (CHT) coating while ZnO NRs were not visible in the CHT 2%/ZnO NRs composite.
32800955	3	52	part_of	%	365:365	arg1	CHT 1%/ZnO composite	CHT 1%/ZnO		CHT 1%/ZnO composite		OGER	Site	CHT 1%/ZnO	Q9GZV3	composite	CHT 1%/ZnO composite had ZnO NRs incorporated into chitosan (CHT) coating while ZnO NRs were not visible in the CHT 2%/ZnO NRs composite.
34617273	17	55	part_of	HAnp-CMC	2773:2780	arg1	The 1:5 HAnp-CMC composite	HAnp		The 1:5 HAnp-CMC composite		OGER	Site	HAnp	P01160	composite	The 1:5 HAnp-CMC composite has the potential to serve as a promising scaffold for dentine regeneration.
32541028	4	58	gly	Tn-glycopeptide	875:889	arg2	its cognate Tn-glycopeptide epitope			its cognate Tn-glycopeptide epitope						Tn-glycopeptide epitope	Previously, we used the scFv fragment of antibody 237 as a chimeric antigen receptor (CAR) to mediate recognition of mouse tumor cells that bear its cognate Tn-glycopeptide epitope in podoplanin, also called OTS8.
32518941	1	14	gly	coat	227:230	arg1	their spike glycoproteins	spike glycoproteins			coat	PUBTATOR		spike glycoproteins	43740568		Coronaviruses hijack human enzymes to assemble the sugar coat on their spike glycoproteins.
32518941	1	76	gly	glycoproteins	247:259	arg1	their spike glycoproteins	their spike glycoproteins				PUBTATOR		spike glycoproteins	43740568		Coronaviruses hijack human enzymes to assemble the sugar coat on their spike glycoproteins.
34920059	5	18	part_of	CNC/NiO	664:670	arg1	CNC/NiO composite	Both CNC		CNC/NiO composite		OGER	Site	Both CNC	P32418	composite	Both CNC/NiO composite and Cu-doped CNC/NiO showed higher catalytic potential compared to dopant-free NiO, while Cu-doped CNC/NiO nanostructures exhibited significant potential for use in industrial dye degradation applications.
35087313	5	11	gly	glycoproteins	703:715	arg1	glycoproteins	glycoproteins				Fterm		glycoproteins			Arabidopsis alg3 cell culture produced glycoproteins with predominantly M3 and GlcNAc-terminal structures, while the amount of plant-specific N-glycans was very low.
34074422	0	38	gly	N-glycoprotein	9:22	arg1	N-glycoprotein	N-glycoprotein				Fterm		N-glycoprotein			Putative N-glycoprotein markers of MCF-7/ADR cancer stem cells from N-glycoproteomics characterization of the whole cell lysate.
34661088	0	55	gly	N-glycosylation	14:28	arg1	SARS-CoV-2 spike protein	SARS-CoV-2 spike protein				PUBTATOR		spike protein	43740568		The effect of N-glycosylation of SARS-CoV-2 spike protein on the virus interaction with the host cell ACE2 receptor.
32172856	7	20	gly	Col/HA-Tyr	1172:1181	arg1	Those Col/HA-Tyr hydrogels			Tyr	Those Col/HA-Tyr hydrogels					Tyr	Those Col/HA-Tyr hydrogels appear promising for novel tissue engineering applications following a biomimetic approach.
35164571	9	60	gly	PG	1662:1663	arg1	UDP-MurNAc-Ala	PG			UDP-MurNAc-Ala	Cterm		PG			YfiH selectively hydrolyzes UDP-MurNAc-Ser, an incorrect by-product of the biosynthesis reaction, to ensure that only the correct PG precursor, UDP-MurNAc-Ala, is incorporated.
32693272	9	9	part_of	SA-PAM/GO	1132:1140	arg1	the SA-PAM/GO hydrogel composites	PAM		the SA-PAM/GO hydrogel composites		OGER	Site	PAM	P19021	composites	Therefore, the SA-PAM/GO hydrogel composites have potential to remove the heavy metal ions from water body effectively.
33838822	5	21	gly	contained	792:800	arg1	MPS-1 AND glucose based sugar residues	MPS-1			glucose based sugar residues	OGER		However, MPS-1	P42677		However, MPS-1 contained glucose based sugar residues such as 3-Glcp and 4-Glcp which were not shown on MPS-2.
34653482	5	58	part_of	albumin/ZnO	1011:1021	arg1	Egg white albumin/ZnO rice structured composite	albumin		Egg white albumin/ZnO rice structured composite		OGER	Site	albumin	P02768	composite	Based on these results, a novel screen printed sensor (Egg white albumin/ZnO rice structured composite) for the determination of formaldehyde was analysed using differential pulse voltammetry (DPV).
33049125	8	78	part_of	CHT/HA/PCL	1854:1863	arg1	CHT/HA/PCL composite	CHT		CHT/HA/PCL composite		OGER	Site	CHT	Q9GZV3	composite	The clinically conformant combination of 3D porous architecture with pore sizes varying in the range of 20 to 200 μm together with controlled in vitro degradation and early osseointegration establish the potential of CHT/HA/PCL composite as a potential cancellous bone analog.
31908039	1	2	gly	glycoprotein	153:164	arg1	a glycoprotein	a glycoprotein				Fterm		glycoprotein			Fms-like tyrosine kinase 3 (FLT3) is a glycoprotein, that is a member of the class III receptor tyrosine kinase family.
32814582	3	79	part_of	long-chain	709:718	arg1	gut microbiota composition	long-chain		gut microbiota composition		Fterm	Site	long-chain		position	Here, we performed a parallel two-arm, exploratory randomized controlled trial in 31 adults with overweight and class-I obesity to characterize the effects of long-chain, complex arabinoxylan (n = 15) at high supplementation doses (female: 25 g/day; male: 35 g/day) on gut microbiota composition and short-chain fatty acid production as compared to microcrystalline cellulose (n = 16, non-fermentable control), and integrated the findings using an ecological framework.
33338254	5	5	gly	glycoproteins	1100:1112	arg1	AGP-like glycoproteins	AGP-like glycoproteins				Fterm		glycoproteins			The reactivity with primary anti-AGP antibodies as well as Yariv reagent showed a great variety between Ulva lactuca and Solanum lycopersicum AGP-like glycoproteins.
33049125	7	29	part_of	BM-MSC-laden	1570:1581	arg1	BM-MSC-laden composites	MSC		BM-MSC-laden composites		OGER	Site	MSC	O60682	composites	In addition, osteogenesis in rat tibial model over 6 weeks confirmed a better ratio of bone volume to the total volume for BM-MSC-laden composites over scaffold-only and defect-only groups.
33381142	6	30	part_of	EXT	1011:1013	arg1	EXT epitopes	EXT		EXT epitopes		PUBTATOR	Site	EXT	815247	epitopes	In mature wood AGP epitopes were located in xylem ray cell walls, whereas EXT epitopes were specifically observed between neighboring xylem vessels, and on the ray cell side of the vessel walls, likely in association with pits.
34574138	9	6	part_of	CMP-derived	1332:1342	arg1	CMP-derived peptides	CMP		CMP-derived peptides		OGER	Site	CMP	P21941	peptides and glycopeptides	Overall, this novel approach provides comprehensive characterization of CMP and CMP-derived peptides and glycopeptides, and it can be applied in future studies of product quality, digestive survival and bioactivity.
34574138	9	22	part_of	CMP	1324:1326	arg1	glycopeptides	CMP		glycopeptides		OGER	Site	CMP	P21941	peptides and glycopeptides	Overall, this novel approach provides comprehensive characterization of CMP and CMP-derived peptides and glycopeptides, and it can be applied in future studies of product quality, digestive survival and bioactivity.
32719787	2	12	gly	glycoproteins	386:398	arg1	glycoproteins	glycoproteins				Fterm		glycoproteins			So far, only a limited number of PNGase candidates are available for the structural analysis of glycoproteins and their glycan moieties.
34990944	1	21	part_of	β-CD	187:190	arg1	a cinnamaldehyde essential oil (CEO)/β-Cyclodextrin (β-CD) composite	-CD		a cinnamaldehyde essential oil (CEO)/β-Cyclodextrin (β-CD) composite		PUBTATOR	Site	-CD	65057	composite	Here, a cinnamaldehyde essential oil (CEO)/β-Cyclodextrin (β-CD) composite with a high embedding rate (91.74 ± 0.82%) was prepared.
33992776	9	46	part_of	MS	1472:1473	arg1	the tandem MS fragments	MS		the tandem MS fragments		Cterm	Site	MS		fragments	In our implementation, the two partitions comprise every possible sequence for a given GAG composition and the tandem MS fragments found using GAGfinder.
32460635	9	6	part_of	AuNP-PMS/FGF2	2097:2109	arg1	AuNP-PMS/FGF2 composite	FGF2		AuNP-PMS/FGF2 composite		PUBTATOR	Site	FGF2	14173	composite	Moreover, the promotion effect of the composite on neuronal maturation marker β3-tubulin expression achieved maximally at the low concentration of FGF2 (4 ng/mL), which suggested the high efficiency of AuNP-PMS/FGF2 composite in neural differentiation of mESCs.
33020657	3	14	gly	glycopeptide	537:548	arg2	80% more glycopeptide spectrum matches			80% more glycopeptide spectrum matches						glycopeptide	Reanalysis of recent N-glycoproteomics data resulted in annotation of 80% more glycopeptide spectrum matches (glycoPSMs) than previously reported.
33328579	3	35	part_of	PPy-Alg	677:683	arg1	PPy-Alg composite	PPy		PPy-Alg composite		OGER	Site	PPy	P01298	composite	In addition, chitosan-based nanoparticles were synthesized by ionic gelation method and after characterization merged into PPy-Alg composite in order to fabricate a conductive, hydrophilic, processable and stable scaffold.
33183596	4	10	part_of	BC/PHB	508:513	arg1	BC/PHB composites	BC/PHB		BC/PHB composites		OGER	Site	BC/PHB	P35232	composites	Here, BC/PHB composites were synthesized by a facile Gluconacetobacter xylinus and Ralstonia eutropha co-culture method generating BC and PHB simultaneously in situ.
34354349	13	86	gly	used	2111:2114	arg2	the electrospun PVA NFs composites			the electrospun PVA NFs composites						composites	CONCLUSION The obtained results suggest that the electrospun PVA NFs composites containing 0.9% PE-CS-Au NPs can be used as antibacterial agents against antibiotic-resistant bacteria, and as suitable scaffolds for cell adhesion, growth and proliferation of fibroblast populations.
34013268	6	12	part_of	protein	1162:1168	arg1	S protein receptor binding domains	S protein		S protein receptor binding domains		OGER	Site	S protein	Q15517	domains	In addition, we explored the antibody binding modes, and the influences of antibody on the motion of S protein receptor binding domains.
34013268	6	73	part_of	S	1160:1160	arg1	S protein receptor binding domains	S protein		S protein receptor binding domains		OGER	Site	S protein	Q15517	domains	In addition, we explored the antibody binding modes, and the influences of antibody on the motion of S protein receptor binding domains.
32066333	6	6	part_of	Ag	874:875	arg1	The synthesized Ag NPs-alginate composite	Ag NPs		The synthesized Ag NPs-alginate composite		OGER	Site	Ag NPs	P0C0P6	composite	The synthesized Ag NPs-alginate composite was further used to develop a paper-based sensor for the detection of H2O2.
32066333	6	49	part_of	NPs-alginate	877:888	arg1	The synthesized Ag NPs-alginate composite	Ag NPs		The synthesized Ag NPs-alginate composite		OGER	Site	Ag NPs	P0C0P6	composite	The synthesized Ag NPs-alginate composite was further used to develop a paper-based sensor for the detection of H2O2.
34176028	4	44	part_of	N-deacetylase/N-sulfotransferase-1	779:812	arg1	the sulfotransferase domain	N-deacetylase/N-sulfotransferase-1		domain		PUBTATOR	Site	N-deacetylase/N-sulfotransferase-1	3340	domain	RESULTS The engineered strain EcN::T7M, carrying the λDE3 region of BL21(DE3) encoding T7 RNA polymerase, expressed the sulfotransferase domain (NST) of human N-deacetylase/N-sulfotransferase-1 (NDST-1) and the catalytic domain of mouse 3-O-sulfotransferase-1 (3-OST-1) in a flask.
32928385	1	31	gly	glycoprotein	202:213	arg1	Recombinant human erythropoietin	Recombinant human erythropoietin				PUBTATOR		erythropoietin	2056		Recombinant human erythropoietin (rhEPO) is a glycoprotein that acts as the main hormone involved in regulating red blood cell production to treat anemia caused by chronic kidney disease or chemotherapy.
32928385	1	31	gly	glycoprotein	202:213	arg1	a glycoprotein	a glycoprotein				Fterm		glycoprotein			Recombinant human erythropoietin (rhEPO) is a glycoprotein that acts as the main hormone involved in regulating red blood cell production to treat anemia caused by chronic kidney disease or chemotherapy.
34420745	2	3	part_of	enzymes	317:323	arg1	the composition	enzymes		the composition		Fterm	Site	enzymes		position	This study aims to find the relationships between the molecular fine structure of starch and the composition of storage proteins and metabolic enzymes, using different chickpea varieties.
34420745	2	42	part_of	proteins	294:301	arg1	the composition	proteins		the composition		Fterm	Site	proteins		position	This study aims to find the relationships between the molecular fine structure of starch and the composition of storage proteins and metabolic enzymes, using different chickpea varieties.
33978738	7	31	gly	glycoproteins	2007:2019	arg1	glycoproteins	glycoproteins				Fterm		glycoproteins			The uniform representation of carbohydrate molecules in the PDB described herein will facilitate broader usage of the resource by the glycoscience community and researchers studying glycoproteins.
32541028	3	4	gly	containing	575:584	arg1	cell surface proteins AND O-glycans	cell surface proteins			O-glycans	Fterm		proteins			It has long been known that dysregulated synthesis of O-linked (threonine or serine) sugars occurs in many cancers, and that this can lead to the expression of cell surface proteins containing O-glycans comprised of a single N-acetylgalactosamine (GalNAc, known as Tn antigen) rather than the normally extended carbohydrate.
31954790	3	38	part_of	NaA-cl-AAc/GP	450:462	arg1	The synthesized sodium alginate cross-linked acrylic acid/graphite (NaA-cl-AAc/GP) hydrogel composite	AAc		The synthesized sodium alginate cross-linked acrylic acid/graphite (NaA-cl-AAc/GP) hydrogel composite		OGER	Site	AAc	Q6IB77	composite	The synthesized sodium alginate cross-linked acrylic acid/graphite (NaA-cl-AAc/GP) hydrogel composite was utilized in the removal of malachite green (MG) dye from aqueous solution using batch adsorption experiments.
33463166	4	57	part_of	LL37	532:535	arg1	collagen-binding domains	AMP LL37		collagen-binding domains		PUBTATOR	Site	AMP LL37	820	domains	In previous work, we modified the human AMP LL37 with collagen-binding domains from collagenase (cCBD) or fibronectin (fCBD) to facilitate peptide tethering and delivery from collagen-based wound dressings.
33463166	4	72	part_of	fibronectin	594:604	arg1	collagen-binding domains	fibronectin		collagen-binding domains		PUBTATOR	Site	fibronectin	2335	domains	In previous work, we modified the human AMP LL37 with collagen-binding domains from collagenase (cCBD) or fibronectin (fCBD) to facilitate peptide tethering and delivery from collagen-based wound dressings.
32526303	7	1	part_of	cellulose-niacin	1081:1096	arg1	ethyl cellulose-niacin composite	niacin		ethyl cellulose-niacin composite		Fterm	Site	niacin		composite	The inhibition efficiency of ethyl cellulose-niacin composite (NEC) was 94.7% outperforms those of microcrystalline cellulose-niacin composite (NMCC) and carboxymethyl cellulose-niacin composite (NCMC) which were 33.2 and 83.4%, respectively, as green corrosion inhibitors for Copper in 3.5% NaCl solutions.
32526303	7	14	part_of	cellulose-niacin	1162:1177	arg1	microcrystalline cellulose-niacin composite	niacin		microcrystalline cellulose-niacin composite		Fterm	Site	niacin		composite	The inhibition efficiency of ethyl cellulose-niacin composite (NEC) was 94.7% outperforms those of microcrystalline cellulose-niacin composite (NMCC) and carboxymethyl cellulose-niacin composite (NCMC) which were 33.2 and 83.4%, respectively, as green corrosion inhibitors for Copper in 3.5% NaCl solutions.
32526303	7	49	part_of	cellulose-niacin	1214:1229	arg1	carboxymethyl cellulose-niacin composite	niacin		carboxymethyl cellulose-niacin composite		Fterm	Site	niacin		composite	The inhibition efficiency of ethyl cellulose-niacin composite (NEC) was 94.7% outperforms those of microcrystalline cellulose-niacin composite (NMCC) and carboxymethyl cellulose-niacin composite (NCMC) which were 33.2 and 83.4%, respectively, as green corrosion inhibitors for Copper in 3.5% NaCl solutions.
34968544	1	37	part_of	SA/PL	408:412	arg1	an electrostatically assembled SA/PL composites	SA/PL		an electrostatically assembled SA/PL composites		PUBTATOR	Site	SA/PL	20216	composites	In the work, a novel filamentou sodium alginate (SA) /ε-polylysine (PL) fiber with excellent mechanical properties and controllable sizes is prepared in an efficient and environmentally friendly manner via continuous pulling of an electrostatically assembled SA/PL composites at the contact interface of aqueous solutions of cationic polyelectrolyte ε-PL and anionic natural polysaccharide SA.
32637953	0	1	gly	cluster	9:15	arg1	the SARS-CoV-2 spike ectodomain			the SARS-CoV-2 spike ectodomain	the SARS-CoV-2 spike ectodomain		Site			ectodomain	A glycan cluster on the SARS-CoV-2 spike ectodomain is recognized by Fab-dimerized glycan-reactive antibodies.
32637953	3	27	gly	glycosylated	449:460	arg1	The S protein	The S protein				OGER		S protein	Q15517		The S protein, like many other viral fusion proteins such as HIV-1 envelope (Env) and influenza hemagglutinin, is glycosylated with both complex and high mannose glycans.
32518941	0	41	gly	N-glycosites	21:32	arg2	22 N-glycosites			22 N-glycosites						N-glycosites	Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics.
32518941	0	79	gly	glycopeptide	93:104	arg2	SARS-CoV-2 and accessible surface glycopeptide motifs			SARS-CoV-2 and accessible surface glycopeptide motifs						glycopeptide motifs	Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics.
32518941	0	91	gly	glycoprotein	43:54	arg1	spike glycoprotein	spike glycoprotein				PUBTATOR		spike glycoprotein	43740568		Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics.
33551170	11	72	gly	glycosylation	1917:1929	arg1	GlyCAM-1	GlyCAM-1				PUBTATOR		GlyCAM-1	282430		Overall, these data demonstrate that the glycosylation, and particularly fucosylation, of GlyCAM-1 was variable, although these shifts appear to be related more to individual cow variation than to nutrient supply.
33551170	12	96	gly	glycoprotein	2173:2184	arg1	a milk glycoprotein	a milk glycoprotein				Fterm		glycoprotein			To our knowledge, this is the first report of variation in glycosylation of a milk glycoprotein in mature, noncolostral milk.
33551170	12	102	gly	glycosylation	2149:2161	arg1	a milk glycoprotein	a milk glycoprotein				Fterm		glycoprotein			To our knowledge, this is the first report of variation in glycosylation of a milk glycoprotein in mature, noncolostral milk.
33402867	2	52	part_of	has	287:289	arg1	IgG AND 2 functional domains	IgG		2 functional domains		PUBTATOR	Site	IgG	668542	domains	Immunoglobulin G (IgG) produced by adaptive arm has 2 functional domains, Fc and Fab.
33402867	2	52	part_of	has	287:289	arg1	Immunoglobulin G AND 2 functional domains	Immunoglobulin G		2 functional domains		Cterm	Site	Immunoglobulin G		domains	Immunoglobulin G (IgG) produced by adaptive arm has 2 functional domains, Fc and Fab.
32511307	1	20	gly	glycoprotein	161:172	arg1	the spike (S) glycoprotein	the spike (S) glycoprotein				Fterm		glycoprotein			Here we have generated 3D structures of glycoforms of the spike (S) glycoprotein from SARS-CoV-2, based on reported 3D structures and glycomics data for the protein produced in HEK293 cells.
32511307	1	47	gly	glycoforms	133:142	arg1	the spike (S) glycoprotein	the spike (S) glycoprotein				Fterm		glycoprotein			Here we have generated 3D structures of glycoforms of the spike (S) glycoprotein from SARS-CoV-2, based on reported 3D structures and glycomics data for the protein produced in HEK293 cells.
33551170	1	16	gly	glycoprotein	360:371	arg1	GlyCAM-1	GlyCAM-1				PUBTATOR		GlyCAM-1	282430		In bovine milk serum, the whey proteins with the highest N-glycan contribution are lactoferrin, IgG, and glycosylation-dependent cellular adhesion molecule 1 (GlyCAM-1); GlyCAM-1 is the dominant N-linked glycoprotein in bovine whey protein products.
33551170	1	16	gly	glycoprotein	360:371	arg1	the dominant N-linked glycoprotein	the dominant N-linked glycoprotein				Fterm		glycoprotein			In bovine milk serum, the whey proteins with the highest N-glycan contribution are lactoferrin, IgG, and glycosylation-dependent cellular adhesion molecule 1 (GlyCAM-1); GlyCAM-1 is the dominant N-linked glycoprotein in bovine whey protein products.
33551170	1	56	gly	proteins	187:194	arg1	the highest N-glycan contribution	proteins			the highest N-glycan contribution	Fterm		proteins			In bovine milk serum, the whey proteins with the highest N-glycan contribution are lactoferrin, IgG, and glycosylation-dependent cellular adhesion molecule 1 (GlyCAM-1); GlyCAM-1 is the dominant N-linked glycoprotein in bovine whey protein products.
33748076	8	38	gly	glycoproteins	1105:1117	arg1	the GlcNAc or Galβ1-4GlcNA-containing glycoproteins	the GlcNAc or Galβ1-4GlcNA-containing glycoproteins				Fterm		glycoproteins			Datura stramonium (DSA) was selected to isolate the GlcNAc or Galβ1-4GlcNA-containing glycoproteins due to the distinct difference between ESCC patients and HVs.
32297468	4	74	part_of	Cu-HAP/CS/PVP	962:974	arg1	the Cu-HAP/CS/PVP composites	HAP		the Cu-HAP/CS/PVP composites		OGER	Site	HAP	O95197	composites	In vitro hemocompatibility study proves that the Cu-HAP/CS/PVP composites are blood compatible with the hemolytic ratio of less than 2%.
32541028	0	66	gly	Tn-glycopeptides	77:92	arg2	Tn-glycopeptides			Tn-glycopeptides						Tn-glycopeptides	Structure-guided engineering of the affinity and specificity of CARs against Tn-glycopeptides.
33445487	10	14	gly	N-glycosylation	1386:1400	arg2	all six N-glycosylation sites			all six N-glycosylation sites						sites	Although all single mutants were functional in cell-cell fusion and viral entry, simultaneous inactivation of all six N-glycosylation sites severely impaired fusion activity and viral entry, suggesting a critical role of N-glycans for maintaining gB structure and function.
34052274	5	1	part_of	CHT	838:840	arg1	the crystalline region	CHT		the crystalline region		OGER	Site	CHT	Q9GZV3	region	XRD spectra of CMC showed that the crystalline region of CHT was reduced by the modification.
32355733	11	61	gly	fucosylated	1829:1839	arg1	fucosylated glycans				fucosylated glycans						RESULTS Compared to the A2780 cells, MS analysis indicated that α2,3-linked sialic structures and N-glycan gal-ratios were significantly higher, while fucosylated glycans were lower in three cisplatin-resistant variants.
32460635	4	15	gly	containing	756:765	arg1	a new neural-differentiation inductive nanocomposite AND 2-methacrylamido glucopyranose-co-3-sulfopropyl acrylate			a new neural-differentiation inductive nanocomposite	2-methacrylamido glucopyranose-co-3-sulfopropyl acrylate					nanocomposite	Here we proposed a new neural-differentiation inductive nanocomposite, containing gold nanoparticles (AuNPs), poly(2-methacrylamido glucopyranose-co-3-sulfopropyl acrylate) (PMS), and basic fibroblast growth factor (FGF2), for the high efficient directional neural-specific differentiation of mouse embryonic stem cells (mESCs).
32460635	4	15	gly	containing	756:765	arg1	a new neural-differentiation inductive nanocomposite AND poly			a new neural-differentiation inductive nanocomposite	poly					nanocomposite	Here we proposed a new neural-differentiation inductive nanocomposite, containing gold nanoparticles (AuNPs), poly(2-methacrylamido glucopyranose-co-3-sulfopropyl acrylate) (PMS), and basic fibroblast growth factor (FGF2), for the high efficient directional neural-specific differentiation of mouse embryonic stem cells (mESCs).
35011343	7	74	gly	used	1565:1568	arg2	the composition			the composition						position	Furthermore, in eluent mixtures, enantioselectivity depends on the direction from which the composition of the eluent is approached, regardless of the eluent pair used on amylose-based columns.
33445487	5	60	gly	N-glycosylation	687:701	arg2	N-glycosylation sites			N-glycosylation sites						sites	Here, we investigated the occupancy and functional relevance of N-glycosylation sites in PrV gB.
33445487	5	82	gly	occupancy	649:657	arg2	N-glycosylation sites			N-glycosylation sites						sites	Here, we investigated the occupancy and functional relevance of N-glycosylation sites in PrV gB.
33677972	4	16	gly	fucosylated	668:678	arg1	total and fucosylated HMOs	total and fucosylated HMOs				OGER		HMOs	P00540		The amount of total and fucosylated HMOs were higher in secretor than non-secretor mothers, while Bifidobacterium genus were highly enriched in infants fed by non-secretor mothers.
33992776	0	25	gly	Sequence	40:47	arg1	Glycosaminoglycan Sequence Ranking				Glycosaminoglycan Sequence Ranking						GAGrank: Software for Glycosaminoglycan Sequence Ranking Using a Bipartite Graph Model.
33618343	10	30	part_of	MTX-loaded	1291:1300	arg1	the MTX-loaded UTCP/MAC composite	MTX		the MTX-loaded UTCP/MAC composite		OGER	Site	MTX	Q13505	composite	The UTCP/MAC and UTCP/MAC/MTX's osteoblast-like (MG-63) cell viability was investigated, and the MTX-loaded UTCP/MAC composite exhibits good viability behavior up to 96.0% in 14 d.
33445487	1	22	gly	glycoprotein	104:115	arg1	Envelope glycoprotein	glycoprotein (g				OGER		glycoprotein (g	P07996		Envelope glycoprotein (g)B is conserved throughout the Herpesviridae and mediates fusion of the viral envelope with cellular membranes for infectious entry and spread.
35014492	5	29	part_of	NR/CNC	1178:1183	arg1	NR/CNC composites	CNC		NR/CNC composites		OGER	Site	CNC	P32418	composites	In this study, our objective was to transport CNC particles from NR/CNC composites into immersed media to be used beneficially in biomedical applications.
34389423	6	39	part_of	PBC-rich	1124:1131	arg1	the PBC-rich domains	PBC		the PBC-rich domains		OGER	Site	PBC	P10515	domains	Based on 13C solid-state NMR spectroscopy, this phenomenon should be due to the enlarged size of the PBC-rich domains in SDs, which depended on the decreasing amounts of admixed HPMC.
34389423	6	90	part_of	domains	1133:1139	arg1	SDs	SDs		domains		OGER	Site	SDs		domains	Based on 13C solid-state NMR spectroscopy, this phenomenon should be due to the enlarged size of the PBC-rich domains in SDs, which depended on the decreasing amounts of admixed HPMC.
33090346	3	10	part_of	keratin/cellulose-based	587:609	arg1	the synthesized keratin/cellulose-based composites	keratin		the synthesized keratin/cellulose-based composites		PUBTATOR	Site	keratin	396479	composites	The characterization analysis of the synthesized keratin/cellulose-based composites was performed using Fourier transform infrared spectrometry, X-ray diffractometry, scanning electron microscopy, and thermogravimetry.
33973638	3	43	gly	C-type	495:500	arg1	Lectin-galC1	C-type			Lectin-galC1	Cterm		C-type			Using the Drosophila neuromuscular junction (NMJ) as a model glutamatergic synapse, we identify a new Ca2+-binding (C-type) lectin, Lectin-galC1 (LGC1), which modulates presynaptic function and neurotransmission strength.
33973638	3	45	gly	Ca2+-binding	481:492	arg1	Lectin-galC1	Ca2			Lectin-galC1	OGER		Ca2	P00918		Using the Drosophila neuromuscular junction (NMJ) as a model glutamatergic synapse, we identify a new Ca2+-binding (C-type) lectin, Lectin-galC1 (LGC1), which modulates presynaptic function and neurotransmission strength.
32172856	5	26	gly	Col/HA-Tyr	945:954	arg1	Col/HA-Tyr hydrogels			Tyr	Col/HA-Tyr hydrogels					Tyr	Unlike HA-Tyr hydrogels, encapsulation of human dermal fibroblasts within Col/HA-Tyr hydrogels allowed for high cell viability.
33445487	6	26	gly	N-glycosylation	747:761	arg2	all predicted N-glycosylation sites			all predicted N-glycosylation sites						sites	To this end, all predicted N-glycosylation sites were inactivated either singly or in combination by the introduction of conservative mutations (N➔Q).
31954790	4	34	part_of	NaA-cl-AAc/GP	602:614	arg1	The NaA-cl-AAc/GP hydrogel composite	AAc		The NaA-cl-AAc/GP hydrogel composite		OGER	Site	AAc	Q6IB77	composite	The NaA-cl-AAc/GP hydrogel composite was characterized by infrared spectroscopy, Raman spectroscopy, thermo-gravimetric analysis, scanning electron microscopy, x-ray photoelectron spectroscopy and x-ray diffraction.
32388896	2	4	gly	derived	410:416	arg2	antithrombin III-binding sites AND these tetrasaccharides	heparin		sites	these tetrasaccharides	Fterm		heparin		sites	Because these tetrasaccharides are derived from antithrombin III-binding sites of heparin, we examined whether this method could be applied to estimate the anticoagulant activity of heparin.
33674390	3	25	gly	N-glycosylation	503:517	arg2	a single N-glycosylation site			a single N-glycosylation site						site	The procollagen C-Pro domain possesses a single N-glycosylation site that is widely conserved in all the fibrillar procollagens across humans and diverse other species.
31970866	10	3	gly	glycosylation	1262:1274	arg2	all eight glycosylation sites			all eight glycosylation sites						sites	Moreover, protein binding capacity is determined as 213 mg/g and 41% sequence coverage of horseradish peroxidase protein with all eight glycosylation sites detected.
34693955	4	58	part_of	ECM-based	661:669	arg1	ECM-based (ECMB) composites	ECM		ECM-based (ECMB) composites		OGER	Site	ECM	Q13201	composites	In this study, a near-infrared (NIR) fluorescent dye Cy5.5 NHS ester was used to label ECM-based (ECMB) composites consisting of SIS and chitosan/elastin electrospun nanofibers for monitoring material degradation.
34661088	1	50	gly	glycosylated	129:140	arg1	The densely glycosylated spike (S) protein	The densely glycosylated spike (S) protein				Fterm		protein			The densely glycosylated spike (S) protein highly exposed on severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2) surface mediates host cell entry by binding to the receptor angiotensin-converting enzyme 2 (ACE2).
32518941	7	20	gly	N-glycosylated	1121:1134	arg1	All 22 N-glycosylated sites	SARS		sites		OGER		SARS	P49591	sites	All 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose N-glycans.
32518941	7	40	gly	modified	1160:1167	arg1	All 22 N-glycosylated sites AND high-mannose N-glycans	SARS		sites	high-mannose N-glycans	OGER		SARS	P49591	sites	All 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose N-glycans.
32349995	2	15	gly	Glycosylation	215:227	arg1	IgG	IgG				PUBTATOR		IgG	668542		Glycosylation of immunoglobulin G (IgG) is an important post-translation process affecting the inflammatory potential of IgG.
32349995	2	15	gly	Glycosylation	215:227	arg1	immunoglobulin G	immunoglobulin G				Cterm		immunoglobulin G			Glycosylation of immunoglobulin G (IgG) is an important post-translation process affecting the inflammatory potential of IgG.
32518941	5	15	gly	N-glycosylated	904:917	arg1	all 22 predicted N-glycosylated sites			all 22 predicted N-glycosylated sites						sites	We acquired tandem mass spectrometry (MS/MS) spectrums for glycopeptides of all 22 predicted N-glycosylated sites.
32518941	5	49	gly	glycopeptides	870:882	arg1	all 22 predicted N-glycosylated sites			all 22 predicted N-glycosylated sites						sites	We acquired tandem mass spectrometry (MS/MS) spectrums for glycopeptides of all 22 predicted N-glycosylated sites.
32518941	5	49	gly	glycopeptides	870:882	arg2	glycopeptides			glycopeptides						glycopeptides	We acquired tandem mass spectrometry (MS/MS) spectrums for glycopeptides of all 22 predicted N-glycosylated sites.
33183601	0	46	part_of	curcumin	41:48	arg1	Composites	curcumin		Composites		Fterm	Site	curcumin		Composites	Composites of yeast glucan particles and curcumin lead to improvement of dextran sulfate sodium-induced acute bowel inflammation in rats.
32299048	6	6	part_of	SHH	1016:1018	arg1	the composition	SHH		the composition		OGER	Site	SHH	Q15465	position	Finally, this study showed that the composition of the SHH impacts directly on the selected microorganism genus and the type and quantity of the value-added compounds obtained.
33058985	7	30	gly	strain	1210:1215	arg1	the O-polysaccharide	strain			the O-polysaccharide	Fterm		strain			Applied importance of this work is that the structure of the O-polysaccharide of a strain isolated from uranium-contaminated groundwater was determined and the character of interaction between the polysaccharide and the uranyl ion was established.
33058985	2	48	gly	A-6-5	336:340	arg1	the lipopolysaccharide			A-6-5	the lipopolysaccharide					A-6-5	The O-polysaccharide (OPS) was isolated by mild acid degradation of the lipopolysaccharide of P. veronii A-6-5 and studied using sugar analysis and 1D and 2D 1H and 13C NMR spectroscopy.
33990962	4	37	part_of	MCC	842:844	arg1	MCC@TPS/paper composites	MCC		MCC@TPS/paper composites		OGER	Site	MCC		composites	% MCC was added to reinforce the mechanical properties of TPS films, such that it also improved the barrier properties of MCC@TPS/paper composites and extended the path of water vapor through TPS films, which decreased the water vapor transmission rate of MCC@TPS/paper composites.
33990962	4	52	part_of	MCC	708:710	arg1	MCC@TPS/paper composites	MCC		MCC@TPS/paper composites		OGER	Site	MCC		composites	% MCC was added to reinforce the mechanical properties of TPS films, such that it also improved the barrier properties of MCC@TPS/paper composites and extended the path of water vapor through TPS films, which decreased the water vapor transmission rate of MCC@TPS/paper composites.
32921414	4	31	gly	glycopeptide	876:887	arg2	the synthesized glycopeptide			the synthesized glycopeptide						glycopeptide	In this study, we synthesized the binding epitope region of LpMab-3 that includes the peptide (-67LVATSVNSV-T-GIRIEDLP84-) possessing a disialyl-core-1 O-glycan at Thr76, and we determined the crystal structure of the LpMab-3 Fab fragment that was bound to the synthesized glycopeptide at a 2.8 Å resolution.
32921414	4	33	gly	possessing	726:735	arg1	the peptide AND a disialyl-core-1 O-glycan			the peptide	a disialyl-core-1 O-glycan					peptide	In this study, we synthesized the binding epitope region of LpMab-3 that includes the peptide (-67LVATSVNSV-T-GIRIEDLP84-) possessing a disialyl-core-1 O-glycan at Thr76, and we determined the crystal structure of the LpMab-3 Fab fragment that was bound to the synthesized glycopeptide at a 2.8 Å resolution.
34070741	4	36	gly	glycosylated	855:866	arg1	partially glycosylated (N220Q) Kv3.1b	partially glycosylated (N220Q) Kv3.1b				Cterm		Kv3.1b			We showed that caudal primary (CaP) motor neurons of zebrafish spinal cord transiently expressing fully glycosylated (WT) Kv3.1b have stereotypical morphology, while CaP neurons expressing partially glycosylated (N220Q) Kv3.1b showed severe maldevelopment with incomplete axonal branching and extension around the ventral musculature.
34070741	4	77	gly	glycosylated	760:771	arg1	fully glycosylated (WT) Kv3.1b	fully glycosylated (WT) Kv3.1b				Cterm		Kv3.1b			We showed that caudal primary (CaP) motor neurons of zebrafish spinal cord transiently expressing fully glycosylated (WT) Kv3.1b have stereotypical morphology, while CaP neurons expressing partially glycosylated (N220Q) Kv3.1b showed severe maldevelopment with incomplete axonal branching and extension around the ventral musculature.
33551170	8	125	gly	GlyCAM-1	1523:1530	arg1	the glycans	GlyCAM-1			the glycans	PUBTATOR		GlyCAM-1	282430		The degree of fucosylation ranged from 44.8 to 73.3% between cows, and this variation was mainly attributed to the glycans of GlyCAM-1.
32507236	5	16	gly	AZGP1	803:807	arg1	The isomeric glycan structures	AZGP1			The isomeric glycan structures	PUBTATOR		AZGP1	563		The isomeric glycan structures of AZGP1 in these spots were systematically characterized both at composition level and at structure level.
32289421	7	6	part_of	g-NCC/PLLA	1019:1028	arg1	the g-NCC/PLLA composites	NCC		the g-NCC/PLLA composites		OGER	Site	NCC	P55017	composites	According to the above-mentioned experimental results, the g-NCC/PLLA composites can be considered as a potential material in the packaging field, mainly due to its proper biological and physicochemical properties.
32388896	2	45	part_of	antithrombin	423:434	arg1	antithrombin III-binding sites	antithrombin III		antithrombin III-binding sites		PUBTATOR	Site	antithrombin III	462	sites	Because these tetrasaccharides are derived from antithrombin III-binding sites of heparin, we examined whether this method could be applied to estimate the anticoagulant activity of heparin.
32388896	2	49	part_of	III-binding	436:446	arg1	antithrombin III-binding sites	antithrombin III		antithrombin III-binding sites		PUBTATOR	Site	antithrombin III	462	sites	Because these tetrasaccharides are derived from antithrombin III-binding sites of heparin, we examined whether this method could be applied to estimate the anticoagulant activity of heparin.
32388896	2	50	part_of	heparin	457:463	arg1	antithrombin III-binding sites	heparin		antithrombin III-binding sites		Fterm	Site	heparin		sites	Because these tetrasaccharides are derived from antithrombin III-binding sites of heparin, we examined whether this method could be applied to estimate the anticoagulant activity of heparin.
32507236	11	47	gly	glycoprotein	1626:1637	arg1	a target glycoprotein biomarker	a target glycoprotein biomarker				Fterm		glycoprotein			Our developed strategy holds promise for thorough identification of glycan structures on a target glycoprotein biomarker.
31915902	10	40	gly	N-glycoforms	1550:1561	arg1	IgG N-glycoforms	IgG N-glycoforms				Cterm		IgG			• BSA significantly changes IgG N-glycoforms as a medium additive.
32707284	3	9	part_of	pectin	720:725	arg1	the pectin chemical composition	pectin		the pectin chemical composition		Fterm	Site	pectin		position	The inclusion of increasing concentrations of alginate in gel formulations promoted an increase in the microparticle gel strength and the formation of a smoother surface microrelief independently of the pectin chemical composition.
34925283	7	57	gly	glycoproteins	1277:1289	arg1	salinarum glycoproteins	salinarum glycoproteins				Fterm		glycoproteins			salinarum glycoproteins.
34574138	9	7	gly	glycopeptides	1357:1369	arg2	glycopeptides	CMP		peptides and glycopeptides		OGER		CMP	P21941	peptides and glycopeptides	Overall, this novel approach provides comprehensive characterization of CMP and CMP-derived peptides and glycopeptides, and it can be applied in future studies of product quality, digestive survival and bioactivity.
34574138	9	7	gly	glycopeptides	1357:1369	arg1	CMP-derived peptides	CMP		peptides and glycopeptides		OGER		CMP	P21941	peptides and glycopeptides	Overall, this novel approach provides comprehensive characterization of CMP and CMP-derived peptides and glycopeptides, and it can be applied in future studies of product quality, digestive survival and bioactivity.
34574138	9	7	gly	glycopeptides	1357:1369	arg1	CMP-derived peptides			peptides and glycopeptides						peptides and glycopeptides	Overall, this novel approach provides comprehensive characterization of CMP and CMP-derived peptides and glycopeptides, and it can be applied in future studies of product quality, digestive survival and bioactivity.
33020657	2	9	gly	glycopeptides	418:430	arg2	O-linked glycopeptides			O-linked glycopeptides						glycopeptides	We present MSFragger-Glyco, a glycoproteomics mode of the MSFragger search engine, for fast and sensitive identification of N- and O-linked glycopeptides and open glycan searches.
33872613	3	44	part_of	α-L-Araf-	446:454	arg1	a terminal branch α-L-Araf-(1 → residue	Araf-(1		a terminal branch α-L-Araf-(1 → residue		OGER	Site	Araf-(1	P10398	residue	The backbone of ADP80-2 comprised →5)-α-L-Araf-(1→, →3, 5)-α-L-Araf-(1→, →6)-α-D-Glcp-(1→, with a terminal branch α-L-Araf-(1 → residue.