uniprotkb_accession	epitope_description	data_source	iedb_id	begin_aa_pos	end_aa_pos	epitope_sequence	evidence_code	evidence_source	evidence_source_id
A0A3Q1LUG2	DAEFRHDSGY is a linear peptidic epitope (epitope ID 99922) tested in 51 B cell assays.	IEDB	99922	672	681	DAEFRHDSGY	ECO:0000213	PubMed	33109704
A0AAA9RRE8	NPKMVKVASLLVKR is a linear peptidic epitope (epitope ID 847570) tested in 8 MHC ligand assays.	IEDB	847570	154	167	NPKMVKVASLLVKR	ECO:0000213	PubMed	30573663
A0AAA9S1T1	LEHFIHLITGVAVF is a linear peptidic epitope (epitope ID 1872736) tested in 1 MHC ligand assay.	IEDB	1872736	297	310	LEHFIHLITGVAVF	ECO:0000213	PubMed	30573663
A0AAA9SKJ1	DKPIYKPEQTVKFR is a linear peptidic epitope (epitope ID 842581) tested in 4 MHC ligand assays.	IEDB	842581	134	147	DKPIYKPEQTVKFR	ECO:0000213	PubMed	30573663
A0AAA9T7E0	GIAGFKGEQGPKGEP is a linear peptidic epitope (epitope ID 20211) tested in 30 T cell assays, 5 B cell assays, 6 MHC ligand assays and has 3D structure(s) 2fse.	IEDB	20211	390	404	GIAGFKGEQGPKGEP	ECO:0000213	PubMed	8608633
A0AAA9T7E0	ARGLTGRPGDA is a linear peptidic epitope (epitope ID 107087) tested in 4 T cell assays and 22 B cell assays.	IEDB	107087	490	500	ARGLTGRPGDA	ECO:0000213	PubMed	22532778
A0AAA9T7E0	GEPGIAGFKGEQGPK is a linear peptidic epitope (epitope ID 107384) tested in 48 T cell assays, 1 B cell assay and 12 MHC ligand assays.	IEDB	107384	387	401	GEPGIAGFKGEQGPK	ECO:0000213	PubMed	14734614
A0AAA9T7E0	GPAGPAGER is a linear peptidic epitope (epitope ID 107867) tested in 11 T cell assays.	IEDB	107867	576	584	GPAGPAGER	ECO:0000213	PubMed	10479530
A0AAA9T7E0	GPAGPAGER is a linear peptidic epitope (epitope ID 107867) tested in 11 T cell assays.	IEDB	107867	576	584	GPAGPAGER	ECO:0000213	PubMed	15500626
A0AAA9T7E0	GPAGTAGAR is a linear peptidic epitope (epitope ID 107868) tested in 1 T cell assay.	IEDB	107868	741	749	GPAGTAGAR	ECO:0000213	PubMed	10479530
A0AAA9T7E0	GPEGAQGPRGEPGTP is a linear peptidic epitope (epitope ID 108394) tested in 11 T cell assays.	IEDB	108394	315	329	GPEGAQGPRGEPGTP	ECO:0000213	PubMed	8608633
A0AAA9T7E0	GPPGPAGTAGARGAP is a linear peptidic epitope (epitope ID 108398) tested in 7 T cell assays and 2 MHC ligand assays.	IEDB	108398	738	752	GPPGPAGTAGARGAP	ECO:0000213	PubMed	10605045
A0AAA9T7E0	GPPGPAGTAGARGAP is a linear peptidic epitope (epitope ID 108398) tested in 7 T cell assays and 2 MHC ligand assays.	IEDB	108398	738	752	GPPGPAGTAGARGAP	ECO:0000213	PubMed	9693969
A0AAA9T7E0	AQGPRGEP is a linear peptidic epitope (epitope ID 108790) tested in 3 B cell assays.	IEDB	108790	319	326	AQGPRGEP	ECO:0000213	PubMed	7514515
A0AAA9T7E0	EQGPKGEP is a linear peptidic epitope (epitope ID 108923) tested in 3 B cell assays.	IEDB	108923	397	404	EQGPKGEP	ECO:0000213	PubMed	7514515
A0AAA9T7E0	GAQGPRGE is a linear peptidic epitope (epitope ID 109030) tested in 3 B cell assays.	IEDB	109030	318	325	GAQGPRGE	ECO:0000213	PubMed	7514515
A0AAA9T7E0	GEQGPKGE is a linear peptidic epitope (epitope ID 109075) tested in 3 B cell assays.	IEDB	109075	396	403	GEQGPKGE	ECO:0000213	PubMed	7514515
A0AAA9T7E0	GPAGPPGPVGPAGGP is a linear peptidic epitope (epitope ID 109173) tested in 1 T cell assay.	IEDB	109173	282	296	GPAGPPGPVGPAGGP	ECO:0000213	PubMed	8608633
A0AAA9T7E0	GSAGAPGIAGAPGFP is a linear peptidic epitope (epitope ID 109247) tested in 3 T cell assays and 2 B cell assays.	IEDB	109247	351	365	GSAGAPGIAGAPGFP	ECO:0000213	PubMed	8608633
A0AAA9T7E0	PVGPAGGP is a linear peptidic epitope (epitope ID 109738) tested in 3 B cell assays.	IEDB	109738	289	296	PVGPAGGP	ECO:0000213	PubMed	7514515
A0AAA9T7E0	QGPKGEPG is a linear peptidic epitope (epitope ID 109750) tested in 3 B cell assays.	IEDB	109750	398	405	QGPKGEPG	ECO:0000213	PubMed	7514515
A0AAA9T7E0	GPAGTAGARGAPGER is a linear peptidic epitope (epitope ID 112137) tested in 1 T cell assay.	IEDB	112137	741	755	GPAGTAGARGAPGER	ECO:0000213	PubMed	7590869
A0JN51	DAEQQLQPYVMVVSNGF is a linear peptidic epitope (epitope ID 497797) tested in 1 MHC ligand assay.	IEDB	497797	582	598	DAEQQLQPYVMVVSNGF	ECO:0000213	PubMed	26495903
A0JN51	EDAEQQLQPYVMVVSNGF is a linear peptidic epitope (epitope ID 498342) tested in 1 MHC ligand assay.	IEDB	498342	581	598	EDAEQQLQPYVMVVSNGF	ECO:0000213	PubMed	26495903
A1L528	SSYYRGAHGIIVVYD is a linear peptidic epitope (epitope ID 526993) tested in 10 MHC ligand assays.	IEDB	526993	78	92	SSYYRGAHGIIVVYD	ECO:0000213	PubMed	30573663
A1L528	SSYYRGAHGIIVVY is a linear peptidic epitope (epitope ID 1282908) tested in 3 MHC ligand assays.	IEDB	1282908	78	91	SSYYRGAHGIIVVY	ECO:0000213	PubMed	30573663
A4IF77	RNYRYELMKAFIFK is a linear peptidic epitope (epitope ID 1873370) tested in 1 MHC ligand assay.	IEDB	1873370	320	333	RNYRYELMKAFIFK	ECO:0000213	PubMed	30573663
A4IFI0	ITRNVETTRASKQSNS is a linear peptidic epitope (epitope ID 143701) tested in 2 MHC ligand assays.	IEDB	143701	178	193	ITRNVETTRASKQSNS	ECO:0000213	PubMed	16393994
A5D7D1	KALDFIASKGVKLVS is a linear peptidic epitope (epitope ID 532338) tested in 50 MHC ligand assays.	IEDB	532338	114	128	KALDFIASKGVKLVS	ECO:0000213	PubMed	30573663
A5D7R6	LKKFYNQVSTPLLR is a linear peptidic epitope (epitope ID 762443) tested in 9 MHC ligand assays.	IEDB	762443	486	499	LKKFYNQVSTPLLR	ECO:0000213	PubMed	30573663
A5D7R6	LKKFYNQVSTPLLRN is a linear peptidic epitope (epitope ID 846809) tested in 10 MHC ligand assays.	IEDB	846809	486	500	LKKFYNQVSTPLLRN	ECO:0000213	PubMed	30573663
A5D7S6	EDFVTMTASRML is a linear peptidic epitope (epitope ID 641963) tested in 3 MHC ligand assays.	IEDB	641963	276	287	EDFVTMTASRML	ECO:0000213	PubMed	30573663
A5D7S6	FEDFVTMTASRML is a linear peptidic epitope (epitope ID 642574) tested in 2 MHC ligand assays.	IEDB	642574	275	287	FEDFVTMTASRML	ECO:0000213	PubMed	30573663
A5D984	IKIISKIENHEGVRR is a linear peptidic epitope (epitope ID 423356) tested in 3 B cell assays and 21 MHC ligand assays.	IEDB	423356	265	279	IKIISKIENHEGVRR	ECO:0000213	PubMed	30573663
A5D984	AVRMQHLIAREAEAA is a linear peptidic epitope (epitope ID 497749) tested in 3 MHC ligand assays.	IEDB	497749	374	388	AVRMQHLIAREAEAA	ECO:0000213	PubMed	30573663
A5PJB2	GIVEQCCASVCSLY is a linear peptidic epitope (epitope ID 103223) tested in 11 T cell assays and 2 MHC ligand assays.	IEDB	103223	85	98	GIVEQCCASVCSLY	ECO:0000213	PubMed	10395197
A5PJB2	GIVEQCCASVCSLY is a linear peptidic epitope (epitope ID 103223) tested in 11 T cell assays and 2 MHC ligand assays.	IEDB	103223	85	98	GIVEQCCASVCSLY	ECO:0000213	PubMed	15019281
A5PJL4	ITKTVEYLHAQGVVH is a linear peptidic epitope (epitope ID 1236592) tested in 7 MHC ligand assays.	IEDB	1236592	523	537	ITKTVEYLHAQGVVH	ECO:0000213	PubMed	30573663
A5PKA5	YREFAILHQNLKR is a linear peptidic epitope (epitope ID 1851017) tested in 3 MHC ligand assays.	IEDB	1851017	197	209	YREFAILHQNLKR	ECO:0000213	PubMed	30573663
A6H7I5	VDSYVAIINKSIRDL is a linear peptidic epitope (epitope ID 1292786) tested in 5 MHC ligand assays.	IEDB	1292786	656	670	VDSYVAIINKSIRDL	ECO:0000213	PubMed	30573663
A6QLL8	AAVYKALSDHHIY is a linear peptidic epitope (epitope ID 436064) tested in 18 MHC ligand assays.	IEDB	436064	211	223	AAVYKALSDHHIY	ECO:0000213	PubMed	30573663
A6QLL8	ALTFSYGRALQASAL is a linear peptidic epitope (epitope ID 511333) tested in 3 B cell assays and 8 MHC ligand assays.	IEDB	511333	297	311	ALTFSYGRALQASAL	ECO:0000213	PubMed	30573663
A6QLL8	AAVYKALSDHHIYLE is a linear peptidic epitope (epitope ID 841699) tested in 11 MHC ligand assays.	IEDB	841699	211	225	AAVYKALSDHHIYLE	ECO:0000213	PubMed	30573663
A6QLL8	AAVYKALSDHHIYL is a linear peptidic epitope (epitope ID 1182336) tested in 8 MHC ligand assays.	IEDB	1182336	211	224	AAVYKALSDHHIYL	ECO:0000213	PubMed	30573663
A6QLL8	LAAVYKALSDHHIY is a linear peptidic epitope (epitope ID 1246438) tested in 4 MHC ligand assays.	IEDB	1246438	210	223	LAAVYKALSDHHIY	ECO:0000213	PubMed	30573663
A6QLN5	KQIAVMRGQILNLT is a linear peptidic epitope (epitope ID 697254) tested in 5 MHC ligand assays.	IEDB	697254	418	431	KQIAVMRGQILNLT	ECO:0000213	PubMed	30573663
A6QLN5	KQIAVMRGQILN is a linear peptidic epitope (epitope ID 1872615) tested in 3 MHC ligand assays.	IEDB	1872615	418	429	KQIAVMRGQILN	ECO:0000213	PubMed	30573663
A6QLR4	SKRAFELQKSAFSEE is a linear peptidic epitope (epitope ID 440552) tested in 11 MHC ligand assays.	IEDB	440552	215	229	SKRAFELQKSAFSEE	ECO:0000213	PubMed	30573663
A6QLR4	LPASVHALTGVDLSK is a linear peptidic epitope (epitope ID 846932) tested in 10 MHC ligand assays.	IEDB	846932	402	416	LPASVHALTGVDLSK	ECO:0000213	PubMed	30573663
A6QLR4	VNRLLAELPASVHA is a linear peptidic epitope (epitope ID 1177997) tested in 6 MHC ligand assays.	IEDB	1177997	395	408	VNRLLAELPASVHA	ECO:0000213	PubMed	30573663
A6QLR4	EVNIKTAEAQLAYEL is a linear peptidic epitope (epitope ID 1745408) tested in 3 MHC ligand assays.	IEDB	1745408	229	243	EVNIKTAEAQLAYEL	ECO:0000213	PubMed	30573663
A6QLR4	EGHLRSILGTLTVEQ is a linear peptidic epitope (epitope ID 1871407) tested in 1 MHC ligand assay.	IEDB	1871407	108	122	EGHLRSILGTLTVEQ	ECO:0000213	PubMed	30573663
A6QLS9	KANINIEKAFLTLAE is a linear peptidic epitope (epitope ID 532342) tested in 5 MHC ligand assays.	IEDB	532342	154	168	KANINIEKAFLTLAE	ECO:0000213	PubMed	30573663
A6QNW9	AAGAVAAIVGL is a linear peptidic epitope (epitope ID 1870853) tested in 1 MHC ligand assay.	IEDB	1870853	62	72	AAGAVAAIVGL	ECO:0000213	PubMed	30573663
A6QPP2	DLYRALAARVGAADN is a linear peptidic epitope (epitope ID 842668) tested in 2 MHC ligand assays.	IEDB	842668	133	147	DLYRALAARVGAADN	ECO:0000213	PubMed	30573663
A6QPP2	FDLYRALAARVGAAD is a linear peptidic epitope (epitope ID 1871733) tested in 1 MHC ligand assay.	IEDB	1871733	132	146	FDLYRALAARVGAAD	ECO:0000213	PubMed	30573663
A6QPU5	IPELSSFV is a linear peptidic epitope (epitope ID 1872362) tested in 1 MHC ligand assay.	IEDB	1872362	38	45	IPELSSFV	ECO:0000213	PubMed	30573663
A7E320	KVEELRKKIQELFH is a linear peptidic epitope (epitope ID 500573) tested in 1 MHC ligand assay.	IEDB	500573	24	37	KVEELRKKIQELFH	ECO:0000213	PubMed	26495903
A7MB50	FGGTLLQVFEDNLLND is a linear peptidic epitope (epitope ID 435918) tested in 1 MHC ligand assay.	IEDB	435918	1003	1018	FGGTLLQVFEDNLLND	ECO:0000213	PubMed	11465105
A7YWH9	LPYRAEVGPAGSQFG is a linear peptidic epitope (epitope ID 647142) tested in 6 MHC ligand assays.	IEDB	647142	712	726	LPYRAEVGPAGSQFG	ECO:0000213	PubMed	30573663
A7YWH9	LPYRAEVGPAGSQ is a linear peptidic epitope (epitope ID 847038) tested in 6 MHC ligand assays.	IEDB	847038	712	724	LPYRAEVGPAGSQ	ECO:0000213	PubMed	30573663
A7YY48	QRFPLSFGF is a linear peptidic epitope (epitope ID 241356) tested in 73 MHC ligand assays.	IEDB	241356	35	43	QRFPLSFGF	ECO:0000213	PubMed	30573663
A7Z024	AGDYTIANARKLIDE is a linear peptidic epitope (epitope ID 841791) tested in 22 MHC ligand assays.	IEDB	841791	242	256	AGDYTIANARKLIDE	ECO:0000213	PubMed	30573663
B0JYN6	KHTLNQIDSVKVWP is a linear peptidic epitope (epitope ID 845919) tested in 4 MHC ligand assays.	IEDB	845919	57	70	KHTLNQIDSVKVWP	ECO:0000213	PubMed	30573663
B5B3R8	RPKHPIKHQGLPQ is a linear peptidic epitope (epitope ID 501936) tested in 13 MHC ligand assays.	IEDB	501936	16	28	RPKHPIKHQGLPQ	ECO:0000213	PubMed	26495903
B6VAP7	KPITPETAEKLARD is a linear peptidic epitope (epitope ID 645964) tested in 4 MHC ligand assays.	IEDB	645964	135	148	KPITPETAEKLARD	ECO:0000213	PubMed	30573663
B6VAP7	QKPITPETAEKLAR is a linear peptidic epitope (epitope ID 648516) tested in 6 MHC ligand assays.	IEDB	648516	134	147	QKPITPETAEKLAR	ECO:0000213	PubMed	30573663
B6VAP7	QKPITPETAEKLARD is a linear peptidic epitope (epitope ID 648517) tested in 9 MHC ligand assays.	IEDB	648517	134	148	QKPITPETAEKLARD	ECO:0000213	PubMed	30573663
B6VAP7	KQKPITPETAEKLAR is a linear peptidic epitope (epitope ID 697255) tested in 9 MHC ligand assays.	IEDB	697255	133	147	KQKPITPETAEKLAR	ECO:0000213	PubMed	30573663
E1BBH2	GEYDALLPWPFKQ is a linear peptidic epitope (epitope ID 643382) tested in 2 MHC ligand assays.	IEDB	643382	480	492	GEYDALLPWPFKQ	ECO:0000213	PubMed	30573663
E1BBH2	GEYDALLPWPFKQK is a linear peptidic epitope (epitope ID 643383) tested in 2 MHC ligand assays.	IEDB	643383	480	493	GEYDALLPWPFKQK	ECO:0000213	PubMed	30573663
E1BBH2	RGEYDALLPWPFKQK is a linear peptidic epitope (epitope ID 648943) tested in 2 MHC ligand assays.	IEDB	648943	479	493	RGEYDALLPWPFKQK	ECO:0000213	PubMed	30573663
E1BBH2	MRGEYDALLPWPFKQ is a linear peptidic epitope (epitope ID 1873032) tested in 1 MHC ligand assay.	IEDB	1873032	478	492	MRGEYDALLPWPFKQ	ECO:0000213	PubMed	30573663
E1BBH2	RGEYDALLPWPFKQ is a linear peptidic epitope (epitope ID 1873317) tested in 1 MHC ligand assay.	IEDB	1873317	479	492	RGEYDALLPWPFKQ	ECO:0000213	PubMed	30573663
E1BFR4	LLLILLLLLL is a linear peptidic epitope (epitope ID 1872836) tested in 1 MHC ligand assay.	IEDB	1872836	51	60	LLLILLLLLL	ECO:0000213	PubMed	30573663
E1BGJ4	GIFFTDLNGFQVQPR is a linear peptidic epitope (epitope ID 1341413) tested in 2 MHC ligand assays.	IEDB	1341413	956	970	GIFFTDLNGFQVQPR	ECO:0000213	PubMed	30573663
E1BLS1	AGALAGLVAGL is a linear peptidic epitope (epitope ID 1870930) tested in 1 MHC ligand assay.	IEDB	1870930	4	14	AGALAGLVAGL	ECO:0000213	PubMed	30573663
E1BNQ4	APYFAAISALKVGAD is a linear peptidic epitope (epitope ID 640594) tested in 12 MHC ligand assays.	IEDB	640594	70	84	APYFAAISALKVGAD	ECO:0000213	PubMed	30573663
E1BNR0	NLFLKSDGRIKYTLN is a linear peptidic epitope (epitope ID 419288) tested in 1 MHC ligand assay.	IEDB	419288	1273	1287	NLFLKSDGRIKYTLN	ECO:0000213	PubMed	8315383
E1BNR0	NLFLKSDGRIKYTLNK is a linear peptidic epitope (epitope ID 419289) tested in 2 MHC ligand assays.	IEDB	419289	1273	1288	NLFLKSDGRIKYTLNK	ECO:0000213	PubMed	8315383
E1BNR0	TPEFTILNTLHIPSFT is a linear peptidic epitope (epitope ID 419385) tested in 1 MHC ligand assay.	IEDB	419385	2638	2653	TPEFTILNTLHIPSFT	ECO:0000213	PubMed	8315383
E1BNR0	TPEFTILNTLHIPSFTID is a linear peptidic epitope (epitope ID 419386) tested in 1 MHC ligand assay.	IEDB	419386	2638	2655	TPEFTILNTLHIPSFTID	ECO:0000213	PubMed	8315383
E1BNR0	ISDYHQQFTYKLQE is a linear peptidic epitope (epitope ID 845514) tested in 2 MHC ligand assays.	IEDB	845514	4490	4503	ISDYHQQFTYKLQE	ECO:0000213	PubMed	30573663
E1BNR0	SRSYQFSKSISLPS is a linear peptidic epitope (epitope ID 849169) tested in 2 MHC ligand assays.	IEDB	849169	631	644	SRSYQFSKSISLPS	ECO:0000213	PubMed	30573663
E1BNR0	ANLFHKLVTELRG is a linear peptidic epitope (epitope ID 1871010) tested in 1 MHC ligand assay.	IEDB	1871010	342	354	ANLFHKLVTELRG	ECO:0000213	PubMed	30573663
E1BNR0	ELQRYLFLVGQVYNT is a linear peptidic epitope (epitope ID 1871526) tested in 1 MHC ligand assay.	IEDB	1871526	2522	2536	ELQRYLFLVGQVYNT	ECO:0000213	PubMed	30573663
E1BNR0	ISDWWALAAKNLTD is a linear peptidic epitope (epitope ID 1872410) tested in 1 MHC ligand assay.	IEDB	1872410	2541	2554	ISDWWALAAKNLTD	ECO:0000213	PubMed	30573663
E1BNR0	LRFFTLLSGSLNSHG is a linear peptidic epitope (epitope ID 1872926) tested in 1 MHC ligand assay.	IEDB	1872926	1606	1620	LRFFTLLSGSLNSHG	ECO:0000213	PubMed	30573663
E1BNR0	NRKQYLRAATALIYT is a linear peptidic epitope (epitope ID 1873114) tested in 1 MHC ligand assay.	IEDB	1873114	3689	3703	NRKQYLRAATALIYT	ECO:0000213	PubMed	30573663
E1BNR0	RFFTLLSGSLNSHGL is a linear peptidic epitope (epitope ID 1873307) tested in 1 MHC ligand assay.	IEDB	1873307	1607	1621	RFFTLLSGSLNSHGL	ECO:0000213	PubMed	30573663
E1BNW6	RLGQFLTKRGVSLRK is a linear peptidic epitope (epitope ID 1873351) tested in 1 MHC ligand assay.	IEDB	1873351	143	157	RLGQFLTKRGVSLRK	ECO:0000213	PubMed	30573663
E1BP91	NDLFSLARAGIIST is a linear peptidic epitope (epitope ID 1873055) tested in 4 MHC ligand assays.	IEDB	1873055	622	635	NDLFSLARAGIIST	ECO:0000213	PubMed	30573663
E1BP91	VKAFFESHPAPSAER is a linear peptidic epitope (epitope ID 1873840) tested in 1 MHC ligand assay.	IEDB	1873840	870	884	VKAFFESHPAPSAER	ECO:0000213	PubMed	30573663
E1BPI1	GGGGGGAVSARDK is a linear peptidic epitope (epitope ID 499109) tested in 1 MHC ligand assay.	IEDB	499109	28	40	GGGGGGAVSARDK	ECO:0000213	PubMed	26495903
E1BPI1	GGGGGGGAVSARDK is a linear peptidic epitope (epitope ID 499110) tested in 1 MHC ligand assay.	IEDB	499110	27	40	GGGGGGGAVSARDK	ECO:0000213	PubMed	26495903
F1MAW1	KKTFVLAPSSVLR is a linear peptidic epitope (epitope ID 846012) tested in 3 MHC ligand assays.	IEDB	846012	395	407	KKTFVLAPSSVLR	ECO:0000213	PubMed	30573663
F1MDH3	TTMVRTAKAIAVTVQ is a linear peptidic epitope (epitope ID 1873721) tested in 3 MHC ligand assays.	IEDB	1873721	1841	1855	TTMVRTAKAIAVTVQ	ECO:0000213	PubMed	30573663
F1MDU7	QIGLPGKGGKAKGKK is a linear peptidic epitope (epitope ID 1873238) tested in 1 MHC ligand assay.	IEDB	1873238	1190	1204	QIGLPGKGGKAKGKK	ECO:0000213	PubMed	30573663
F1MEL0	LKFYKELQAHGADE is a linear peptidic epitope (epitope ID 532731) tested in 20 MHC ligand assays.	IEDB	532731	66	79	LKFYKELQAHGADE	ECO:0000213	PubMed	30573663
F1MM32	AGHFEQMASGSMHR is a linear peptidic epitope (epitope ID 1870939) tested in 1 MHC ligand assay.	IEDB	1870939	495	508	AGHFEQMASGSMHR	ECO:0000213	PubMed	30573663
F1MQH8	AEDKIKELEASKVKE is a linear peptidic epitope (epitope ID 1598187) tested in 4 MHC ligand assays.	IEDB	1598187	205	219	AEDKIKELEASKVKE	ECO:0000213	PubMed	30573663
F1MRZ8	EENLFEIITADEVH is a linear peptidic epitope (epitope ID 514466) tested in 3 MHC ligand assays.	IEDB	514466	311	324	EENLFEIITADEVH	ECO:0000213	PubMed	30573663
F1MSB5	EDLFSLIETHEAKPL is a linear peptidic epitope (epitope ID 1871333) tested in 1 MHC ligand assay.	IEDB	1871333	147	161	EDLFSLIETHEAKPL	ECO:0000213	PubMed	30573663
F1MUS6	YIALEIPLKARSAST is a linear peptidic epitope (epitope ID 503826) tested in 1 MHC ligand assay.	IEDB	503826	2275	2289	YIALEIPLKARSAST	ECO:0000213	PubMed	26495903
F1MVC0	KEEILLIKAAKARG is a linear peptidic epitope (epitope ID 543145) tested in 11 MHC ligand assays.	IEDB	543145	1618	1631	KEEILLIKAAKARG	ECO:0000213	PubMed	30573663
F1MVC0	RKEEILLIKAAKARG is a linear peptidic epitope (epitope ID 544732) tested in 15 MHC ligand assays.	IEDB	544732	1617	1631	RKEEILLIKAAKARG	ECO:0000213	PubMed	30573663
F1MVC0	KEEILLIKAAKAR is a linear peptidic epitope (epitope ID 691039) tested in 4 MHC ligand assays.	IEDB	691039	1618	1630	KEEILLIKAAKAR	ECO:0000213	PubMed	30573663
F1MVC0	RKEEILLIKAAKAR is a linear peptidic epitope (epitope ID 1166090) tested in 4 MHC ligand assays.	IEDB	1166090	1617	1630	RKEEILLIKAAKAR	ECO:0000213	PubMed	30573663
F1MVK1	KQQLIPGVPFLLQA is a linear peptidic epitope (epitope ID 1872620) tested in 1 MHC ligand assay.	IEDB	1872620	375	388	KQQLIPGVPFLLQA	ECO:0000213	PubMed	30573663
F1MVK1	RPVLYNYLDSDLTVS is a linear peptidic epitope (epitope ID 1873382) tested in 1 MHC ligand assay.	IEDB	1873382	844	858	RPVLYNYLDSDLTVS	ECO:0000213	PubMed	30573663
F1N7J2	EQKFTVIRGGQVIQ is a linear peptidic epitope (epitope ID 642299) tested in 2 MHC ligand assays.	IEDB	642299	191	204	EQKFTVIRGGQVIQ	ECO:0000213	PubMed	30573663
F1N7J2	QEQKFTVIRGGQVIQ is a linear peptidic epitope (epitope ID 648399) tested in 6 MHC ligand assays.	IEDB	648399	190	204	QEQKFTVIRGGQVIQ	ECO:0000213	PubMed	30573663
F1N7J2	VKTVIEPMASEGLRT is a linear peptidic epitope (epitope ID 1873853) tested in 2 MHC ligand assays.	IEDB	1873853	633	647	VKTVIEPMASEGLRT	ECO:0000213	PubMed	30573663
G3MZE2	LQALEFLHANQVIHR is a linear peptidic epitope (epitope ID 532834) tested in 6 MHC ligand assays.	IEDB	532834	308	322	LQALEFLHANQVIHR	ECO:0000213	PubMed	30573663
I7CT57	VLDQYIFELSRKTR is a linear peptidic epitope (epitope ID 1873855) tested in 1 MHC ligand assay.	IEDB	1873855	341	354	VLDQYIFELSRKTR	ECO:0000213	PubMed	30573663
O18756	APYKFLSEQHGVK is a linear peptidic epitope (epitope ID 1871037) tested in 1 MHC ligand assay.	IEDB	1871037	475	487	APYKFLSEQHGVK	ECO:0000213	PubMed	30573663
O97681	TNRLTFLNSFKMK is a linear peptidic epitope (epitope ID 1834192) tested in 2 MHC ligand assays.	IEDB	1834192	541	553	TNRLTFLNSFKMK	ECO:0000213	PubMed	30573663
O97681	ISFWGEQIGHKVKK is a linear peptidic epitope (epitope ID 1872413) tested in 1 MHC ligand assay.	IEDB	1872413	227	240	ISFWGEQIGHKVKK	ECO:0000213	PubMed	30573663
P00415	EYYEAPFTIS is a linear peptidic epitope (epitope ID 858622) tested in 3 B cell assays.	IEDB	858622	180	189	EYYEAPFTIS	ECO:0000213	PubMed	12859984
P00415	HHSLMEGDRKHM is a linear peptidic epitope (epitope ID 858639) tested in 3 B cell assays.	IEDB	858639	148	159	HHSLMEGDRKHM	ECO:0000213	PubMed	12859984
P00415	TGIHPLNPLE is a linear peptidic epitope (epitope ID 858695) tested in 3 B cell assays.	IEDB	858695	119	128	TGIHPLNPLE	ECO:0000213	PubMed	12859984
P00415	WWRDVIREST is a linear peptidic epitope (epitope ID 858711) tested in 3 B cell assays.	IEDB	858711	57	66	WWRDVIREST	ECO:0000213	PubMed	12859984
P00432	VWDFWSLRPESLHQ is a linear peptidic epitope (epitope ID 534464) tested in 37 MHC ligand assays.	IEDB	534464	182	195	VWDFWSLRPESLHQ	ECO:0000213	PubMed	30573663
P00432	IPERVVHAKGAGAFG is a linear peptidic epitope (epitope ID 697220) tested in 3 MHC ligand assays.	IEDB	697220	69	83	IPERVVHAKGAGAFG	ECO:0000213	PubMed	30573663
P00432	WDFWSLRPESLHQ is a linear peptidic epitope (epitope ID 1301469) tested in 8 MHC ligand assays.	IEDB	1301469	183	195	WDFWSLRPESLHQ	ECO:0000213	PubMed	30573663
P00711	KCEVFRELKDLKGY is a linear peptidic epitope (epitope ID 30052) tested in 1 B cell assay.	IEDB	30052	24	37	KCEVFRELKDLKGY	ECO:0000213	PubMed	1720415
P00711	KDLKGYGGVS is a linear peptidic epitope (epitope ID 30198) tested in 4 B cell assays.	IEDB	30198	32	41	KDLKGYGGVS	ECO:0000213	PubMed	12170271
P00711	VGINYWLAHK is a linear peptidic epitope (epitope ID 97035) tested in 5 B cell assays.	IEDB	97035	118	127	VGINYWLAHK	ECO:0000213	PubMed	9250594
P00711	EWVCTTFHTSGY is a linear peptidic epitope (epitope ID 227760) tested in 2 T cell assays.	IEDB	227760	44	55	EWVCTTFHTSGY	ECO:0000213	PubMed	24777233
P00711	DDIMCVKKILDKVGI is a linear peptidic epitope (epitope ID 2244220) tested in 6 T cell assays.	IEDB	2244220	106	120	DDIMCVKKILDKVGI	ECO:0000213	PubMed	37604312
P00711	DKVGINYWLAHKALC is a linear peptidic epitope (epitope ID 2244330) tested in 6 T cell assays.	IEDB	2244330	116	130	DKVGINYWLAHKALC	ECO:0000213	PubMed	37604312
P00711	NYWLAHKALCSEKLD is a linear peptidic epitope (epitope ID 2246888) tested in 6 T cell assays.	IEDB	2246888	121	135	NYWLAHKALCSEKLD	ECO:0000213	PubMed	37604312
P00711	STEYGLFQINNKIWC is a linear peptidic epitope (epitope ID 2247757) tested in 6 T cell assays.	IEDB	2247757	66	80	STEYGLFQINNKIWC	ECO:0000213	PubMed	37604312
P01030	ADITLLSGFHALRA is a linear peptidic epitope (epitope ID 1598115) tested in 2 MHC ligand assays.	IEDB	1598115	662	675	ADITLLSGFHALRA	ECO:0000213	PubMed	30573663
P01030	IADITLLSGFHA is a linear peptidic epitope (epitope ID 1607478) tested in 2 MHC ligand assays.	IEDB	1607478	661	672	IADITLLSGFHA	ECO:0000213	PubMed	30573663
P01223	CKCGKCNT is a linear peptidic epitope (epitope ID 133533) tested in 1 B cell assay.	IEDB	133533	103	110	CKCGKCNT	ECO:0000213	PubMed	10078873
P01223	CLTINTTVCA is a linear peptidic epitope (epitope ID 133537) tested in 1 B cell assay.	IEDB	133537	39	48	CLTINTTVCA	ECO:0000213	PubMed	10078873
P01223	DVNGKLFL is a linear peptidic epitope (epitope ID 133549) tested in 1 B cell assay.	IEDB	133549	55	62	DVNGKLFL	ECO:0000213	PubMed	10078873
P01223	ECAYCLTI is a linear peptidic epitope (epitope ID 133552) tested in 1 B cell assay.	IEDB	133552	35	42	ECAYCLTI	ECO:0000213	PubMed	10078873
P01223	FLPKYALS is a linear peptidic epitope (epitope ID 133570) tested in 1 B cell assay.	IEDB	133570	61	68	FLPKYALS	ECO:0000213	PubMed	10078873
P01223	GKCNTDYSD is a linear peptidic epitope (epitope ID 133584) tested in 1 B cell assay.	IEDB	133584	106	114	GKCNTDYSD	ECO:0000213	PubMed	10078873
P01223	HEAIKTNYC is a linear peptidic epitope (epitope ID 133596) tested in 1 B cell assay.	IEDB	133596	117	125	HEAIKTNYC	ECO:0000213	PubMed	10078873
P01223	INTTVCAGY is a linear peptidic epitope (epitope ID 133608) tested in 1 B cell assay.	IEDB	133608	42	50	INTTVCAGY	ECO:0000213	PubMed	10078873
P01223	LSQDVCTY is a linear peptidic epitope (epitope ID 133634) tested in 1 B cell assay.	IEDB	133634	67	74	LSQDVCTY	ECO:0000213	PubMed	10078873
P01223	MMHVERKEC is a linear peptidic epitope (epitope ID 133647) tested in 1 B cell assay.	IEDB	133647	28	36	MMHVERKEC	ECO:0000213	PubMed	10078873
P01223	TRDVNGKLFLP is a linear peptidic epitope (epitope ID 133718) tested in 1 B cell assay.	IEDB	133718	53	63	TRDVNGKLFLP	ECO:0000213	PubMed	10078873
P01223	VERKECAY is a linear peptidic epitope (epitope ID 133727) tested in 1 B cell assay.	IEDB	133727	31	38	VERKECAY	ECO:0000213	PubMed	10078873
P01223	VTPYFSYPVA is a linear peptidic epitope (epitope ID 133737) tested in 1 B cell assay.	IEDB	133737	91	100	VTPYFSYPVA	ECO:0000213	PubMed	10078873
P01267	ARCWQPGIR is a linear peptidic epitope (epitope ID 688823) tested in 1 B cell assay.	IEDB	688823	2263	2271	ARCWQPGIR	ECO:0000213	PubMed	28701697
P01267	CLWECSR is a linear peptidic epitope (epitope ID 688829) tested in 1 B cell assay.	IEDB	688829	2131	2137	CLWECSR	ECO:0000213	PubMed	28701697
P01267	DRCLWECSR is a linear peptidic epitope (epitope ID 688859) tested in 1 B cell assay.	IEDB	688859	2129	2137	DRCLWECSR	ECO:0000213	PubMed	28701697
P01267	FLAVQLVISGR is a linear peptidic epitope (epitope ID 688921) tested in 1 B cell assay.	IEDB	688921	284	294	FLAVQLVISGR	ECO:0000213	PubMed	28701697
P01267	FPDAFVTFSSFR is a linear peptidic epitope (epitope ID 688922) tested in 1 B cell assay.	IEDB	688922	214	225	FPDAFVTFSSFR	ECO:0000213	PubMed	28701697
P01267	GFCQIQVK is a linear peptidic epitope (epitope ID 688933) tested in 1 B cell assay.	IEDB	688933	1329	1336	GFCQIQVK	ECO:0000213	PubMed	28701697
P01267	LAAQSTFDFYQR is a linear peptidic epitope (epitope ID 689012) tested in 1 B cell assay.	IEDB	689012	996	1007	LAAQSTFDFYQR	ECO:0000213	PubMed	28701697
P01267	SISSGFFECER is a linear peptidic epitope (epitope ID 689108) tested in 1 B cell assay.	IEDB	689108	1989	1999	SISSGFFECER	ECO:0000213	PubMed	28701697
P01267	VIFSADVAVMVR is a linear peptidic epitope (epitope ID 689163) tested in 1 B cell assay.	IEDB	689163	1581	1592	VIFSADVAVMVR	ECO:0000213	PubMed	28701697
P01966	HLPSDFTPAV is a linear peptidic epitope (epitope ID 78993) tested in 3 MHC ligand assays.	IEDB	78993	113	122	HLPSDFTPAV	ECO:0000213	PubMed	7500030
P01966	SLDKFLANV is a linear peptidic epitope (epitope ID 156757) tested in 20 MHC ligand assays.	IEDB	156757	125	133	SLDKFLANV	ECO:0000213	PubMed	21209280
P01966	AEALERMFLSFPTTKT is a linear peptidic epitope (epitope ID 419083) tested in 3 MHC ligand assays.	IEDB	419083	27	42	AEALERMFLSFPTTKT	ECO:0000213	PubMed	8315383
P01966	LDKFLANVSTVLTS is a linear peptidic epitope (epitope ID 804797) tested in 4 MHC ligand assays.	IEDB	804797	126	139	LDKFLANVSTVLTS	ECO:0000213	PubMed	30573663
P01966	DKFLANVSTVLTSKY is a linear peptidic epitope (epitope ID 1871180) tested in 1 MHC ligand assay.	IEDB	1871180	127	141	DKFLANVSTVLTSKY	ECO:0000213	PubMed	30573663
P01966	DPVNFKLLSHSLL is a linear peptidic epitope (epitope ID 1871235) tested in 1 MHC ligand assay.	IEDB	1871235	95	107	DPVNFKLLSHSLL	ECO:0000213	PubMed	30573663
P02081	VVTGVANALAHRY is a linear peptidic epitope (epitope ID 196971) tested in 2 MHC ligand assays.	IEDB	196971	132	144	VVTGVANALAHRY	ECO:0000213	PubMed	10958351
P02081	FGDLSSADAILGNPK is a linear peptidic epitope (epitope ID 790887) tested in 7 MHC ligand assays.	IEDB	790887	44	58	FGDLSSADAILGNPK	ECO:0000213	PubMed	30573663
P02081	DPENFRLLGNVLVV is a linear peptidic epitope (epitope ID 1871223) tested in 1 MHC ligand assay.	IEDB	1871223	98	111	DPENFRLLGNVLVV	ECO:0000213	PubMed	30573663
P02081	DPENFRLLGNVLVVV is a linear peptidic epitope (epitope ID 1871224) tested in 1 MHC ligand assay.	IEDB	1871224	98	112	DPENFRLLGNVLVVV	ECO:0000213	PubMed	30573663
P02453	GAPGTPGPQG is a linear peptidic epitope (epitope ID 107126) tested in 1 B cell assay.	IEDB	107126	943	952	GAPGTPGPQG	ECO:0000213	PubMed	10517180
P02453	GPPGPAGPAGERGEQ is a linear peptidic epitope (epitope ID 108397) tested in 6 T cell assays and 2 MHC ligand assays.	IEDB	108397	619	633	GPPGPAGPAGERGEQ	ECO:0000213	PubMed	10605045
P02453	APGFPGAR is a linear peptidic epitope (epitope ID 108782) tested in 3 B cell assays.	IEDB	108782	407	414	APGFPGAR	ECO:0000213	PubMed	1721846
P02453	GAPGFPGA is a linear peptidic epitope (epitope ID 109021) tested in 3 B cell assays.	IEDB	109021	406	413	GAPGFPGA	ECO:0000213	PubMed	1721846
P02453	GFPGARGP is a linear peptidic epitope (epitope ID 109091) tested in 3 B cell assays.	IEDB	109091	409	416	GFPGARGP	ECO:0000213	PubMed	1721846
P02453	PGFPGARG is a linear peptidic epitope (epitope ID 109672) tested in 3 B cell assays.	IEDB	109672	408	415	PGFPGARG	ECO:0000213	PubMed	1721846
P02453	AGNPGADG is a linear peptidic epitope (epitope ID 110182) tested in 2 B cell assays.	IEDB	110182	384	391	AGNPGADG	ECO:0000213	PubMed	7514515
P02453	GEGGPQGPRGSEGPQG is a linear peptidic epitope (epitope ID 499072) tested in 1 MHC ligand assay.	IEDB	499072	352	367	GEGGPQGPRGSEGPQG	ECO:0000213	PubMed	26495903
P02453	GKSGDRGETGPAGPAGPIGPV is a linear peptidic epitope (epitope ID 499214) tested in 1 MHC ligand assay.	IEDB	499214	1060	1080	GKSGDRGETGPAGPAGPIGPV	ECO:0000213	PubMed	26495903
P02459	AGFKGEQGPKGEP is a linear peptidic epitope (epitope ID 1509) tested in 33 T cell assays and 6 MHC ligand assays.	IEDB	1509	461	473	AGFKGEQGPKGEP	ECO:0000213	PubMed	32738771
P02465	IPGEFGLPGP is a linear peptidic epitope (epitope ID 27850) tested in 1 B cell assay.	IEDB	27850	573	582	IPGEFGLPGP	ECO:0000213	PubMed	12373276
P02465	GAPGPAGA is a linear peptidic epitope (epitope ID 109026) tested in 3 B cell assays.	IEDB	109026	224	231	GAPGPAGA	ECO:0000213	PubMed	1721846
P02465	GARGPPGP is a linear peptidic epitope (epitope ID 109043) tested in 3 B cell assays.	IEDB	109043	128	135	GARGPPGP	ECO:0000213	PubMed	1721846
P02465	PGARGPPG is a linear peptidic epitope (epitope ID 109662) tested in 3 B cell assays.	IEDB	109662	901	908	PGARGPPG	ECO:0000213	PubMed	1721846
P02584	VPGKTFVNITPAEVG is a linear peptidic epitope (epitope ID 429145) tested in 72 MHC ligand assays.	IEDB	429145	35	49	VPGKTFVNITPAEVG	ECO:0000213	PubMed	30573663
P02584	KTLVLLMGKEGVHG is a linear peptidic epitope (epitope ID 532593) tested in 2 MHC ligand assays.	IEDB	532593	108	121	KTLVLLMGKEGVHG	ECO:0000213	PubMed	30573663
P02584	KTLVLLMGKEGVHGG is a linear peptidic epitope (epitope ID 646176) tested in 2 MHC ligand assays.	IEDB	646176	108	122	KTLVLLMGKEGVHGG	ECO:0000213	PubMed	30573663
P02662	AMEDIKQMEA is a linear peptidic epitope (epitope ID 3080) tested in 2 B cell assays.	IEDB	3080	68	77	AMEDIKQMEA	ECO:0000213	PubMed	11174208
P02662	AWYYVPLGTQ is a linear peptidic epitope (epitope ID 5709) tested in 2 B cell assays.	IEDB	5709	178	187	AWYYVPLGTQ	ECO:0000213	PubMed	11174208
P02662	AWYYVPLGTQYT is a linear peptidic epitope (epitope ID 5710) tested in 1 T cell assay.	IEDB	5710	178	189	AWYYVPLGTQYT	ECO:0000213	PubMed	17228168
P02662	AYFYPELFRQ is a linear peptidic epitope (epitope ID 5780) tested in 2 B cell assays.	IEDB	5780	158	167	AYFYPELFRQ	ECO:0000213	PubMed	11174208
P02662	DAPSFSDIPN is a linear peptidic epitope (epitope ID 7616) tested in 2 B cell assays.	IEDB	7616	190	199	DAPSFSDIPN	ECO:0000213	PubMed	11174208
P02662	DAYPSGAWYY is a linear peptidic epitope (epitope ID 7689) tested in 2 B cell assays.	IEDB	7689	172	181	DAYPSGAWYY	ECO:0000213	PubMed	11174208
P02662	DIPNPIGSEN is a linear peptidic epitope (epitope ID 8754) tested in 2 B cell assays.	IEDB	8754	196	205	DIPNPIGSEN	ECO:0000213	PubMed	11174208
P02662	DIPNPIGSENSEKTTMPLW is a linear peptidic epitope (epitope ID 8756) tested in 4 T cell assays, 10 B cell assays and 1 MHC ligand assay.	IEDB	8756	196	214	DIPNPIGSENSEKTTMPLW	ECO:0000213	PubMed	15541041
P02662	DQAMEDIKQM is a linear peptidic epitope (epitope ID 9822) tested in 2 B cell assays and 1 MHC ligand assay.	IEDB	9822	66	75	DQAMEDIKQM	ECO:0000213	PubMed	11174208
P02662	DVPSERYLGY is a linear peptidic epitope (epitope ID 10695) tested in 2 B cell assays and 1 MHC ligand assay.	IEDB	10695	100	109	DVPSERYLGY	ECO:0000213	PubMed	11174208
P02662	EAESISSSEEIVPNSVE is a linear peptidic epitope (epitope ID 11033) tested in 1 T cell assay and 2 B cell assays.	IEDB	11033	76	92	EAESISSSEEIVPNSVE	ECO:0000213	PubMed	15541041
P02662	EDIKQMEAES is a linear peptidic epitope (epitope ID 11348) tested in 2 B cell assays.	IEDB	11348	70	79	EDIKQMEAES	ECO:0000213	PubMed	11174208
P02662	EDIKQMEAESIS is a linear peptidic epitope (epitope ID 11349) tested in 1 T cell assay.	IEDB	11349	70	81	EDIKQMEAESIS	ECO:0000213	PubMed	17228168
P02662	EEIVPNSVEQ is a linear peptidic epitope (epitope ID 11704) tested in 4 B cell assays.	IEDB	11704	84	93	EEIVPNSVEQ	ECO:0000213	PubMed	11174208
P02662	EEIVPNSVEQ is a linear peptidic epitope (epitope ID 11704) tested in 4 B cell assays.	IEDB	11704	84	93	EEIVPNSVEQ	ECO:0000213	PubMed	11678861
P02662	EERLHSMKEG is a linear peptidic epitope (epitope ID 11860) tested in 2 B cell assays.	IEDB	11860	132	141	EERLHSMKEG	ECO:0000213	PubMed	11174208
P02662	EGIHAQQKEP is a linear peptidic epitope (epitope ID 12187) tested in 4 B cell assays.	IEDB	12187	140	149	EGIHAQQKEP	ECO:0000213	PubMed	11174208
P02662	EGIHAQQKEP is a linear peptidic epitope (epitope ID 12187) tested in 4 B cell assays.	IEDB	12187	140	149	EGIHAQQKEP	ECO:0000213	PubMed	8836334
P02662	EKVNELSKDI is a linear peptidic epitope (epitope ID 12896) tested in 2 B cell assays.	IEDB	12896	50	59	EKVNELSKDI	ECO:0000213	PubMed	11174208
P02662	ELAYFYPELF is a linear peptidic epitope (epitope ID 12961) tested in 5 B cell assays.	IEDB	12961	156	165	ELAYFYPELF	ECO:0000213	PubMed	11174208
P02662	ELAYFYPELF is a linear peptidic epitope (epitope ID 12961) tested in 5 B cell assays.	IEDB	12961	156	165	ELAYFYPELF	ECO:0000213	PubMed	8836334
P02662	ELSKDIGSES is a linear peptidic epitope (epitope ID 13272) tested in 4 B cell assays.	IEDB	13272	54	63	ELSKDIGSES	ECO:0000213	PubMed	11174208
P02662	ELSKDIGSES is a linear peptidic epitope (epitope ID 13272) tested in 4 B cell assays.	IEDB	13272	54	63	ELSKDIGSES	ECO:0000213	PubMed	12170271
P02662	ENSEKTTMPL is a linear peptidic epitope (epitope ID 13587) tested in 2 B cell assays.	IEDB	13587	204	213	ENSEKTTMPL	ECO:0000213	PubMed	11174208
P02662	EPMIGVNQEL is a linear peptidic epitope (epitope ID 13714) tested in 2 B cell assays.	IEDB	13714	148	157	EPMIGVNQEL	ECO:0000213	PubMed	11174208
P02662	EPMIGVNQELAY is a linear peptidic epitope (epitope ID 13715) tested in 3 T cell assays.	IEDB	13715	148	159	EPMIGVNQELAY	ECO:0000213	PubMed	17228168
P02662	ERYLGYLEQL is a linear peptidic epitope (epitope ID 14099) tested in 2 B cell assays and 2 MHC ligand assays.	IEDB	14099	104	113	ERYLGYLEQL	ECO:0000213	PubMed	11174208
P02662	FFVAPFPEVF is a linear peptidic epitope (epitope ID 15930) tested in 2 B cell assays and 3 MHC ligand assays.	IEDB	15930	38	47	FFVAPFPEVF	ECO:0000213	PubMed	11174208
P02662	FSDIPNPIGS is a linear peptidic epitope (epitope ID 17689) tested in 2 B cell assays.	IEDB	17689	194	203	FSDIPNPIGS	ECO:0000213	PubMed	11174208
P02662	FYPELFRQFY is a linear peptidic epitope (epitope ID 18442) tested in 2 B cell assays.	IEDB	18442	160	169	FYPELFRQFY	ECO:0000213	PubMed	11174208
P02662	FYQLDAYPSG is a linear peptidic epitope (epitope ID 18452) tested in 2 B cell assays.	IEDB	18452	168	177	FYQLDAYPSG	ECO:0000213	PubMed	11174208
P02662	GKEKVNELSK is a linear peptidic epitope (epitope ID 20548) tested in 2 B cell assays and 1 MHC ligand assay.	IEDB	20548	48	57	GKEKVNELSK	ECO:0000213	PubMed	11174208
P02662	GVNQELAYFY is a linear peptidic epitope (epitope ID 23078) tested in 2 B cell assays.	IEDB	23078	152	161	GVNQELAYFY	ECO:0000213	PubMed	11174208
P02662	GYLEQLLRLK is a linear peptidic epitope (epitope ID 23397) tested in 2 B cell assays.	IEDB	23397	108	117	GYLEQLLRLK	ECO:0000213	PubMed	11174208
P02662	HSMKEGIHAQ is a linear peptidic epitope (epitope ID 24812) tested in 2 B cell assays.	IEDB	24812	136	145	HSMKEGIHAQ	ECO:0000213	PubMed	11174208
P02662	HSMKEGIHAQQKEPMIGVNQ is a linear peptidic epitope (epitope ID 24814) tested in 4 T cell assays and 9 B cell assays.	IEDB	24814	136	155	HSMKEGIHAQQKEPMIGVNQ	ECO:0000213	PubMed	15541041
P02662	IGVNQELAYFYPELFRQFYQ is a linear peptidic epitope (epitope ID 26341) tested in 5 T cell assays and 9 B cell assays.	IEDB	26341	151	170	IGVNQELAYFYPELFRQFYQ	ECO:0000213	PubMed	15541041
P02662	IHAQQKEPMI is a linear peptidic epitope (epitope ID 26363) tested in 2 B cell assays.	IEDB	26363	142	151	IHAQQKEPMI	ECO:0000213	PubMed	11174208
P02662	IQKEDVPSER is a linear peptidic epitope (epitope ID 28169) tested in 2 B cell assays.	IEDB	28169	96	105	IQKEDVPSER	ECO:0000213	PubMed	11174208
P02662	ISSSEEIVPN is a linear peptidic epitope (epitope ID 28732) tested in 2 B cell assays and 1 MHC ligand assay.	IEDB	28732	80	89	ISSSEEIVPN	ECO:0000213	PubMed	11174208
P02662	IVPNSAEERL is a linear peptidic epitope (epitope ID 29402) tested in 2 B cell assays and 1 MHC ligand assay.	IEDB	29402	126	135	IVPNSAEERL	ECO:0000213	PubMed	11174208
P02662	IVPNSVEQKH is a linear peptidic epitope (epitope ID 29403) tested in 2 B cell assays.	IEDB	29403	86	95	IVPNSVEQKH	ECO:0000213	PubMed	11174208
P02662	KEDVPSERYL is a linear peptidic epitope (epitope ID 30333) tested in 2 B cell assays and 1 MHC ligand assay.	IEDB	30333	98	107	KEDVPSERYL	ECO:0000213	PubMed	11174208
P02662	KEGIHAQQKEPM is a linear peptidic epitope (epitope ID 30400) tested in 2 T cell assays and 1 B cell assay.	IEDB	30400	139	150	KEGIHAQQKEPM	ECO:0000213	PubMed	9600504
P02662	KHIQKEDVPSER is a linear peptidic epitope (epitope ID 31120) tested in 1 T cell assay.	IEDB	31120	94	105	KHIQKEDVPSER	ECO:0000213	PubMed	17228168
P02662	KHPIKHQGLP is a linear peptidic epitope (epitope ID 31141) tested in 2 B cell assays.	IEDB	31141	18	27	KHPIKHQGLP	ECO:0000213	PubMed	11174208
P02662	KYKVPQLEIV is a linear peptidic epitope (epitope ID 34490) tested in 2 B cell assays.	IEDB	34490	118	127	KYKVPQLEIV	ECO:0000213	PubMed	11174208
P02662	LEIVPNSAE is a linear peptidic epitope (epitope ID 35528) tested in 2 B cell assays.	IEDB	35528	124	132	LEIVPNSAE	ECO:0000213	PubMed	12170271
P02662	LEIVPNSAEE is a linear peptidic epitope (epitope ID 35529) tested in 2 B cell assays.	IEDB	35529	124	133	LEIVPNSAEE	ECO:0000213	PubMed	11174208
P02662	LEIVPNSAEERL is a linear peptidic epitope (epitope ID 35530) tested in 1 T cell assay and 2 B cell assays.	IEDB	35530	124	135	LEIVPNSAEERL	ECO:0000213	PubMed	17228168
P02662	LEQLLRLKKY is a linear peptidic epitope (epitope ID 35659) tested in 2 B cell assays.	IEDB	35659	110	119	LEQLLRLKKY	ECO:0000213	PubMed	11174208
P02662	LFRQFYQLDA is a linear peptidic epitope (epitope ID 35962) tested in 2 B cell assays.	IEDB	35962	164	173	LFRQFYQLDA	ECO:0000213	PubMed	11174208
P02662	LGTQYTDAPS is a linear peptidic epitope (epitope ID 36333) tested in 2 B cell assays.	IEDB	36333	184	193	LGTQYTDAPS	ECO:0000213	PubMed	11174208
P02662	LGTQYTDAPSFS is a linear peptidic epitope (epitope ID 36334) tested in 1 T cell assay.	IEDB	36334	184	195	LGTQYTDAPSFS	ECO:0000213	PubMed	17228168
P02662	LKKYKVPQLE is a linear peptidic epitope (epitope ID 36929) tested in 3 T cell assays and 5 B cell assays.	IEDB	36929	116	125	LKKYKVPQLE	ECO:0000213	PubMed	11174208
P02662	LKKYKVPQLE is a linear peptidic epitope (epitope ID 36929) tested in 3 T cell assays and 5 B cell assays.	IEDB	36929	116	125	LKKYKVPQLE	ECO:0000213	PubMed	1710568
P02662	LNENLLRFFVAPFPEVFGKE is a linear peptidic epitope (epitope ID 38207) tested in 4 T cell assays and 8 B cell assays.	IEDB	38207	31	50	LNENLLRFFVAPFPEVFGKE	ECO:0000213	PubMed	15541041
P02662	LRFFVAPFPE is a linear peptidic epitope (epitope ID 39083) tested in 2 B cell assays.	IEDB	39083	36	45	LRFFVAPFPE	ECO:0000213	PubMed	11174208
P02662	LRLKKYKVPQ is a linear peptidic epitope (epitope ID 39136) tested in 2 B cell assays and 1 MHC ligand assay.	IEDB	39136	114	123	LRLKKYKVPQ	ECO:0000213	PubMed	11174208
P02662	MKEGIHAQQK is a linear peptidic epitope (epitope ID 41811) tested in 4 B cell assays.	IEDB	41811	138	147	MKEGIHAQQK	ECO:0000213	PubMed	11174208
P02662	MKEGIHAQQK is a linear peptidic epitope (epitope ID 41811) tested in 4 B cell assays.	IEDB	41811	138	147	MKEGIHAQQK	ECO:0000213	PubMed	12170271
P02662	NENLLRFFVA is a linear peptidic epitope (epitope ID 43703) tested in 2 B cell assays.	IEDB	43703	32	41	NENLLRFFVA	ECO:0000213	PubMed	11174208
P02662	NLLRFFVAPF is a linear peptidic epitope (epitope ID 44793) tested in 2 B cell assays.	IEDB	44793	34	43	NLLRFFVAPF	ECO:0000213	PubMed	11174208
P02662	NQELAYFYPE is a linear peptidic epitope (epitope ID 45538) tested in 2 B cell assays.	IEDB	45538	154	163	NQELAYFYPE	ECO:0000213	PubMed	11174208
P02662	NQELAYFYPELF is a linear peptidic epitope (epitope ID 45539) tested in 2 T cell assays.	IEDB	45539	154	165	NQELAYFYPELF	ECO:0000213	PubMed	17228168
P02662	PELFRQFYQL is a linear peptidic epitope (epitope ID 47345) tested in 2 B cell assays.	IEDB	47345	162	171	PELFRQFYQL	ECO:0000213	PubMed	11174208
P02662	PEVFGKEKVN is a linear peptidic epitope (epitope ID 47450) tested in 2 B cell assays.	IEDB	47450	44	53	PEVFGKEKVN	ECO:0000213	PubMed	11174208
P02662	PFPEVFGKEK is a linear peptidic epitope (epitope ID 47537) tested in 2 B cell assays.	IEDB	47537	42	51	PFPEVFGKEK	ECO:0000213	PubMed	11174208
P02662	PIGSENSEKT is a linear peptidic epitope (epitope ID 47907) tested in 2 B cell assays.	IEDB	47907	200	209	PIGSENSEKT	ECO:0000213	PubMed	11174208
P02662	PNPIGSENSE is a linear peptidic epitope (epitope ID 48684) tested in 2 B cell assays.	IEDB	48684	198	207	PNPIGSENSE	ECO:0000213	PubMed	11174208
P02662	PQLEIVPNSA is a linear peptidic epitope (epitope ID 49022) tested in 2 B cell assays.	IEDB	49022	122	131	PQLEIVPNSA	ECO:0000213	PubMed	11174208
P02662	PSERYLGYLE is a linear peptidic epitope (epitope ID 49356) tested in 2 B cell assays.	IEDB	49356	102	111	PSERYLGYLE	ECO:0000213	PubMed	11174208
P02662	PSFSDIPNPI is a linear peptidic epitope (epitope ID 49368) tested in 4 B cell assays.	IEDB	49368	192	201	PSFSDIPNPI	ECO:0000213	PubMed	11174208
P02662	PSFSDIPNPI is a linear peptidic epitope (epitope ID 49368) tested in 4 B cell assays.	IEDB	49368	192	201	PSFSDIPNPI	ECO:0000213	PubMed	11678861
P02662	QEVLNENLLR is a linear peptidic epitope (epitope ID 50721) tested in 2 B cell assays.	IEDB	50721	28	37	QEVLNENLLR	ECO:0000213	PubMed	11174208
P02662	QFYQLDAYPSGAWYYVPL is a linear peptidic epitope (epitope ID 50824) tested in 1 T cell assay and 2 B cell assays.	IEDB	50824	167	184	QFYQLDAYPSGAWYYVPL	ECO:0000213	PubMed	15541041
P02662	QGLPQEVLNE is a linear peptidic epitope (epitope ID 50900) tested in 2 B cell assays.	IEDB	50900	24	33	QGLPQEVLNE	ECO:0000213	PubMed	11174208
P02662	QKEPMIGVNQ is a linear peptidic epitope (epitope ID 51181) tested in 2 B cell assays.	IEDB	51181	146	155	QKEPMIGVNQ	ECO:0000213	PubMed	11174208
P02662	QLLRLKKYKV is a linear peptidic epitope (epitope ID 51431) tested in 2 B cell assays.	IEDB	51431	112	121	QLLRLKKYKV	ECO:0000213	PubMed	11174208
P02662	RPKHPIKHQG is a linear peptidic epitope (epitope ID 55185) tested in 3 B cell assays.	IEDB	55185	16	25	RPKHPIKHQG	ECO:0000213	PubMed	11174208
P02662	RPKHPIKHQG is a linear peptidic epitope (epitope ID 55185) tested in 3 B cell assays.	IEDB	55185	16	25	RPKHPIKHQG	ECO:0000213	PubMed	8836334
P02662	RPKHPIKHQGLPQEVLNE is a linear peptidic epitope (epitope ID 55186) tested in 3 T cell assays, 2 B cell assays and 3 MHC ligand assays.	IEDB	55186	16	33	RPKHPIKHQGLPQEVLNE	ECO:0000213	PubMed	15541041
P02662	RQFYQLDAYP is a linear peptidic epitope (epitope ID 55416) tested in 2 B cell assays.	IEDB	55416	166	175	RQFYQLDAYP	ECO:0000213	PubMed	11174208
P02662	RQFYQLDAYPSG is a linear peptidic epitope (epitope ID 55417) tested in 2 T cell assays.	IEDB	55417	166	177	RQFYQLDAYPSG	ECO:0000213	PubMed	17228168
P02662	SAEERLHSMK is a linear peptidic epitope (epitope ID 56749) tested in 2 B cell assays.	IEDB	56749	130	139	SAEERLHSMK	ECO:0000213	PubMed	11174208
P02662	SEKTTMPLW is a linear peptidic epitope (epitope ID 57509) tested in 2 B cell assays and 1 MHC ligand assay.	IEDB	57509	206	214	SEKTTMPLW	ECO:0000213	PubMed	11174208
P02662	SESTEDQAMEDIKQMEAE is a linear peptidic epitope (epitope ID 57630) tested in 1 T cell assay and 2 B cell assays.	IEDB	57630	61	78	SESTEDQAMEDIKQMEAE	ECO:0000213	PubMed	15541041
P02662	SGAWYYVPLG is a linear peptidic epitope (epitope ID 57990) tested in 2 B cell assays.	IEDB	57990	176	185	SGAWYYVPLG	ECO:0000213	PubMed	11174208
P02662	SSEEIVPNSV is a linear peptidic epitope (epitope ID 60966) tested in 2 B cell assays.	IEDB	60966	82	91	SSEEIVPNSV	ECO:0000213	PubMed	11174208
P02662	TEDQAMEDIK is a linear peptidic epitope (epitope ID 63325) tested in 2 B cell assays.	IEDB	63325	64	73	TEDQAMEDIK	ECO:0000213	PubMed	11174208
P02662	TQYTDAPSFS is a linear peptidic epitope (epitope ID 65983) tested in 2 B cell assays.	IEDB	65983	186	195	TQYTDAPSFS	ECO:0000213	PubMed	11174208
P02662	VAPFPEVFGK is a linear peptidic epitope (epitope ID 67707) tested in 2 B cell assays and 3 MHC ligand assays.	IEDB	67707	40	49	VAPFPEVFGK	ECO:0000213	PubMed	11174208
P02662	VAPFPEVFGKEK is a linear peptidic epitope (epitope ID 67708) tested in 1 T cell assay and 2 MHC ligand assays.	IEDB	67708	40	51	VAPFPEVFGKEK	ECO:0000213	PubMed	17228168
P02662	VEQKHIQKEDVPSERYLGYL is a linear peptidic epitope (epitope ID 68322) tested in 7 T cell assays and 13 B cell assays.	IEDB	68322	91	110	VEQKHIQKEDVPSERYLGYL	ECO:0000213	PubMed	15541041
P02662	VFGKEKVNEL is a linear peptidic epitope (epitope ID 68471) tested in 2 B cell assays and 2 MHC ligand assays.	IEDB	68471	46	55	VFGKEKVNEL	ECO:0000213	PubMed	11174208
P02662	VFGKEKVNELSKDIGSESTE is a linear peptidic epitope (epitope ID 68473) tested in 5 T cell assays and 10 B cell assays.	IEDB	68473	46	65	VFGKEKVNELSKDIGSESTE	ECO:0000213	PubMed	15541041
P02662	VLNENLLRFF is a linear peptidic epitope (epitope ID 69659) tested in 2 B cell assays.	IEDB	69659	30	39	VLNENLLRFF	ECO:0000213	PubMed	11174208
P02662	VNELSKDIGS is a linear peptidic epitope (epitope ID 70058) tested in 2 B cell assays.	IEDB	70058	52	61	VNELSKDIGS	ECO:0000213	PubMed	11174208
P02662	VPLGTQYTDA is a linear peptidic epitope (epitope ID 70355) tested in 2 B cell assays.	IEDB	70355	182	191	VPLGTQYTDA	ECO:0000213	PubMed	11174208
P02662	VPQLEIVPNSAEERLHSMKE is a linear peptidic epitope (epitope ID 70444) tested in 5 T cell assays and 11 B cell assays.	IEDB	70444	121	140	VPQLEIVPNSAEERLHSMKE	ECO:0000213	PubMed	15541041
P02662	YLGYLEQLLR is a linear peptidic epitope (epitope ID 74687) tested in 3 T cell assays, 7 B cell assays and 10 MHC ligand assays.	IEDB	74687	106	115	YLGYLEQLLR	ECO:0000213	PubMed	11174208
P02662	YLGYLEQLLR is a linear peptidic epitope (epitope ID 74687) tested in 3 T cell assays, 7 B cell assays and 10 MHC ligand assays.	IEDB	74687	106	115	YLGYLEQLLR	ECO:0000213	PubMed	12170271
P02662	YLGYLEQLLR is a linear peptidic epitope (epitope ID 74687) tested in 3 T cell assays, 7 B cell assays and 10 MHC ligand assays.	IEDB	74687	106	115	YLGYLEQLLR	ECO:0000213	PubMed	1710568
P02662	YLGYLEQLLRLKKYKVPQLE is a linear peptidic epitope (epitope ID 74689) tested in 14 T cell assays and 16 B cell assays.	IEDB	74689	106	125	YLGYLEQLLRLKKYKVPQLE	ECO:0000213	PubMed	15541041
P02662	YPSGAWYYVP is a linear peptidic epitope (epitope ID 75409) tested in 4 B cell assays.	IEDB	75409	174	183	YPSGAWYYVP	ECO:0000213	PubMed	11174208
P02662	YPSGAWYYVP is a linear peptidic epitope (epitope ID 75409) tested in 4 B cell assays.	IEDB	75409	174	183	YPSGAWYYVP	ECO:0000213	PubMed	12170271
P02662	YTDAPSFSDI is a linear peptidic epitope (epitope ID 75990) tested in 2 B cell assays.	IEDB	75990	188	197	YTDAPSFSDI	ECO:0000213	PubMed	11174208
P02662	YVPLGTQYTDAPSFSDIPN is a linear peptidic epitope (epitope ID 76384) tested in 1 T cell assay and 2 B cell assays.	IEDB	76384	181	199	YVPLGTQYTDAPSFSDIPN	ECO:0000213	PubMed	15541041
P02662	YYVPLGTQYT is a linear peptidic epitope (epitope ID 76634) tested in 2 B cell assays.	IEDB	76634	180	189	YYVPLGTQYT	ECO:0000213	PubMed	11174208
P02662	ELAYFYPELFRQFYQ is a linear peptidic epitope (epitope ID 190407) tested in 3 T cell assays and 2 B cell assays.	IEDB	190407	156	170	ELAYFYPELFRQFYQ	ECO:0000213	PubMed	37604312
P02662	EQLLRLKKYKVPQLE is a linear peptidic epitope (epitope ID 190408) tested in 7 T cell assays and 2 B cell assays.	IEDB	190408	111	125	EQLLRLKKYKVPQLE	ECO:0000213	PubMed	37604312
P02662	IGVNQELAYFYPELF is a linear peptidic epitope (epitope ID 190447) tested in 3 T cell assays and 2 B cell assays.	IEDB	190447	151	165	IGVNQELAYFYPELF	ECO:0000213	PubMed	37604312
P02662	LPQEVLNENLLRFFV is a linear peptidic epitope (epitope ID 190475) tested in 3 T cell assays and 2 B cell assays.	IEDB	190475	26	40	LPQEVLNENLLRFFV	ECO:0000213	PubMed	37604312
P02662	RQFYQLDAYPSGAWY is a linear peptidic epitope (epitope ID 190531) tested in 7 T cell assays and 2 B cell assays.	IEDB	190531	166	180	RQFYQLDAYPSGAWY	ECO:0000213	PubMed	37604312
P02662	VPSERYLGYLEQLLR is a linear peptidic epitope (epitope ID 190580) tested in 7 T cell assays and 2 B cell assays.	IEDB	190580	101	115	VPSERYLGYLEQLLR	ECO:0000213	PubMed	37604312
P02662	YLGYLEQLLRLKKYK is a linear peptidic epitope (epitope ID 190595) tested in 3 T cell assays and 2 B cell assays.	IEDB	190595	106	120	YLGYLEQLLRLKKYK	ECO:0000213	PubMed	37604312
P02662	EGIHAQQK is a linear peptidic epitope (epitope ID 606414) tested in 3 B cell assays.	IEDB	606414	140	147	EGIHAQQK	ECO:0000213	PubMed	36307246
P02662	EGIHAQQK is a linear peptidic epitope (epitope ID 606414) tested in 3 B cell assays.	IEDB	606414	140	147	EGIHAQQK	ECO:0000213	PubMed	18992943
P02662	LAYFYPEL is a linear peptidic epitope (epitope ID 858198) tested in 4 T cell assays.	IEDB	858198	157	164	LAYFYPEL	ECO:0000213	PubMed	9512346
P02662	QLLRLKKYKVPQLE is a linear peptidic epitope (epitope ID 858429) tested in 3 T cell assays and 3 B cell assays.	IEDB	858429	112	125	QLLRLKKYKVPQLE	ECO:0000213	PubMed	1710568
P02662	EDVPSER is a linear peptidic epitope (epitope ID 1007427) tested in 1 B cell assay and 7 MHC ligand assays.	IEDB	1007427	99	105	EDVPSER	ECO:0000213	PubMed	36307246
P02663	ENLCSTFCKE is a linear peptidic epitope (epitope ID 13509) tested in 3 B cell assays.	IEDB	13509	48	57	ENLCSTFCKE	ECO:0000213	PubMed	12170271
P02663	ENLCSTFCKE is a linear peptidic epitope (epitope ID 13509) tested in 3 B cell assays.	IEDB	13509	48	57	ENLCSTFCKE	ECO:0000213	PubMed	12373003
P02663	EVFTKKTKLT is a linear peptidic epitope (epitope ID 14697) tested in 3 B cell assays.	IEDB	14697	160	169	EVFTKKTKLT	ECO:0000213	PubMed	12170271
P02663	EVFTKKTKLT is a linear peptidic epitope (epitope ID 14697) tested in 3 B cell assays.	IEDB	14697	160	169	EVFTKKTKLT	ECO:0000213	PubMed	12373003
P02663	NRLNFLKKIS is a linear peptidic epitope (epitope ID 45706) tested in 3 B cell assays.	IEDB	45706	174	183	NRLNFLKKIS	ECO:0000213	PubMed	12170271
P02663	NRLNFLKKIS is a linear peptidic epitope (epitope ID 45706) tested in 3 B cell assays.	IEDB	45706	174	183	NRLNFLKKIS	ECO:0000213	PubMed	12373003
P02663	QFYQKFPQYL is a linear peptidic epitope (epitope ID 50823) tested in 3 B cell assays.	IEDB	50823	102	111	QFYQKFPQYL	ECO:0000213	PubMed	12170271
P02663	QFYQKFPQYL is a linear peptidic epitope (epitope ID 50823) tested in 3 B cell assays.	IEDB	50823	102	111	QFYQKFPQYL	ECO:0000213	PubMed	12373003
P02663	YQKFALPQYL is a linear peptidic epitope (epitope ID 75506) tested in 3 B cell assays.	IEDB	75506	186	195	YQKFALPQYL	ECO:0000213	PubMed	12170271
P02663	YQKFALPQYL is a linear peptidic epitope (epitope ID 75506) tested in 3 B cell assays.	IEDB	75506	186	195	YQKFALPQYL	ECO:0000213	PubMed	12373003
P02663	ALPQYLKTVY is a linear peptidic epitope (epitope ID 95237) tested in 1 B cell assay and 1 MHC ligand assay.	IEDB	95237	190	199	ALPQYLKTVY	ECO:0000213	PubMed	12373003
P02663	ANEEEYSIGS is a linear peptidic epitope (epitope ID 95244) tested in 1 B cell assay.	IEDB	95244	62	71	ANEEEYSIGS	ECO:0000213	PubMed	12373003
P02663	EKNRLNFLKK is a linear peptidic epitope (epitope ID 95351) tested in 1 B cell assay.	IEDB	95351	172	181	EKNRLNFLKK	ECO:0000213	PubMed	12373003
P02663	FLKKISQRYQ is a linear peptidic epitope (epitope ID 95387) tested in 1 B cell assay.	IEDB	95387	178	187	FLKKISQRYQ	ECO:0000213	PubMed	12373003
P02663	FTKKTKLTEE is a linear peptidic epitope (epitope ID 95395) tested in 1 B cell assay.	IEDB	95395	162	171	FTKKTKLTEE	ECO:0000213	PubMed	12373003
P02663	INQFYQKFPQ is a linear peptidic epitope (epitope ID 95467) tested in 1 B cell assay.	IEDB	95467	100	109	INQFYQKFPQ	ECO:0000213	PubMed	12373003
P02663	ISQRYQKFAL is a linear peptidic epitope (epitope ID 95478) tested in 1 B cell assay.	IEDB	95478	182	191	ISQRYQKFAL	ECO:0000213	PubMed	12373003
P02663	ITPTLNREQL is a linear peptidic epitope (epitope ID 95481) tested in 1 B cell assay.	IEDB	95481	134	143	ITPTLNREQL	ECO:0000213	PubMed	12373003
P02663	KFALPQYLKT is a linear peptidic epitope (epitope ID 95491) tested in 1 B cell assay.	IEDB	95491	188	197	KFALPQYLKT	ECO:0000213	PubMed	12373003
P02663	KFPQYLQYLY is a linear peptidic epitope (epitope ID 95493) tested in 1 B cell assay.	IEDB	95493	106	115	KFPQYLQYLY	ECO:0000213	PubMed	12373003
P02663	KKISQRYQKF is a linear peptidic epitope (epitope ID 95501) tested in 1 B cell assay.	IEDB	95501	180	189	KKISQRYQKF	ECO:0000213	PubMed	12373003
P02663	KKTKLTEEEK is a linear peptidic epitope (epitope ID 95503) tested in 1 B cell assay.	IEDB	95503	164	173	KKTKLTEEEK	ECO:0000213	PubMed	12373003
P02663	KPWIQPKTKV is a linear peptidic epitope (epitope ID 95514) tested in 1 B cell assay.	IEDB	95514	206	215	KPWIQPKTKV	ECO:0000213	PubMed	12373003
P02663	LCSTFCKEVV is a linear peptidic epitope (epitope ID 95544) tested in 1 B cell assay.	IEDB	95544	50	59	LCSTFCKEVV	ECO:0000213	PubMed	12373003
P02663	LNFLKKISQR is a linear peptidic epitope (epitope ID 95560) tested in 1 B cell assay.	IEDB	95560	176	185	LNFLKKISQR	ECO:0000213	PubMed	12373003
P02663	NEINQFYQKF is a linear peptidic epitope (epitope ID 95614) tested in 1 B cell assay.	IEDB	95614	98	107	NEINQFYQKF	ECO:0000213	PubMed	12373003
P02663	PQYLKTVYQH is a linear peptidic epitope (epitope ID 95681) tested in 1 B cell assay.	IEDB	95681	192	201	PQYLKTVYQH	ECO:0000213	PubMed	12373003
P02663	PQYLQYLYQG is a linear peptidic epitope (epitope ID 95682) tested in 1 B cell assay.	IEDB	95682	108	117	PQYLQYLYQG	ECO:0000213	PubMed	12373003
P02663	QRYQKFALPQ is a linear peptidic epitope (epitope ID 95739) tested in 1 B cell assay.	IEDB	95739	184	193	QRYQKFALPQ	ECO:0000213	PubMed	12373003
P02663	QYLYQGPIVL is a linear peptidic epitope (epitope ID 95750) tested in 1 B cell assay.	IEDB	95750	112	121	QYLYQGPIVL	ECO:0000213	PubMed	12373003
P02663	RNANEEEYSI is a linear peptidic epitope (epitope ID 95766) tested in 1 B cell assay.	IEDB	95766	60	69	RNANEEEYSI	ECO:0000213	PubMed	12373003
P02663	SKENLCSTFC is a linear peptidic epitope (epitope ID 95856) tested in 1 B cell assay.	IEDB	95856	46	55	SKENLCSTFC	ECO:0000213	PubMed	12373003
P02663	STEVFTKKTK is a linear peptidic epitope (epitope ID 95881) tested in 1 B cell assay.	IEDB	95881	158	167	STEVFTKKTK	ECO:0000213	PubMed	12373003
P02663	VLNPWDQVKR is a linear peptidic epitope (epitope ID 95970) tested in 1 B cell assay.	IEDB	95970	120	129	VLNPWDQVKR	ECO:0000213	PubMed	12373003
P02663	VPITPTLNRE is a linear peptidic epitope (epitope ID 95976) tested in 1 B cell assay.	IEDB	95976	132	141	VPITPTLNRE	ECO:0000213	PubMed	12373003
P02663	VVRNANEEEY is a linear peptidic epitope (epitope ID 95992) tested in 1 B cell assay.	IEDB	95992	58	67	VVRNANEEEY	ECO:0000213	PubMed	12373003
P02663	YLKTVYQHQK is a linear peptidic epitope (epitope ID 96020) tested in 1 B cell assay.	IEDB	96020	194	203	YLKTVYQHQK	ECO:0000213	PubMed	12373003
P02663	YLQYLYQGPI is a linear peptidic epitope (epitope ID 96021) tested in 1 B cell assay.	IEDB	96021	110	119	YLQYLYQGPI	ECO:0000213	PubMed	12373003
P02663	YQKFPQYLQY is a linear peptidic epitope (epitope ID 96023) tested in 1 B cell assay and 5 MHC ligand assays.	IEDB	96023	104	113	YQKFPQYLQY	ECO:0000213	PubMed	12373003
P02663	NMAINPSK is a linear peptidic epitope (epitope ID 2150188) tested in 1 B cell assay.	IEDB	2150188	40	47	NMAINPSK	ECO:0000213	PubMed	36307246
P02663	EEKNRLNFLKKISQR is a linear peptidic epitope (epitope ID 2244620) tested in 3 T cell assays.	IEDB	2244620	171	185	EEKNRLNFLKKISQR	ECO:0000213	PubMed	37604312
P02663	KHYQKALNEINQFYQ is a linear peptidic epitope (epitope ID 2246077) tested in 3 T cell assays.	IEDB	2246077	91	105	KHYQKALNEINQFYQ	ECO:0000213	PubMed	37604312
P02663	KISQRYQKFALPQYL is a linear peptidic epitope (epitope ID 2246090) tested in 3 T cell assays.	IEDB	2246090	181	195	KISQRYQKFALPQYL	ECO:0000213	PubMed	37604312
P02663	KTVYQHQKAMKPWIQ is a linear peptidic epitope (epitope ID 2246188) tested in 3 T cell assays.	IEDB	2246188	196	210	KTVYQHQKAMKPWIQ	ECO:0000213	PubMed	37604312
P02663	YQKFALPQYLKTVYQ is a linear peptidic epitope (epitope ID 2248466) tested in 3 T cell assays.	IEDB	2248466	186	200	YQKFALPQYLKTVYQ	ECO:0000213	PubMed	37604312
P02666	LPPTVMFPPQ is a linear peptidic epitope (epitope ID 38630) tested in 4 B cell assays.	IEDB	38630	166	175	LPPTVMFPPQ	ECO:0000213	PubMed	11678861
P02666	QKAVPYPQRD is a linear peptidic epitope (epitope ID 51169) tested in 4 B cell assays.	IEDB	51169	190	199	QKAVPYPQRD	ECO:0000213	PubMed	11678861
P02666	QSKVLPVPQK is a linear peptidic epitope (epitope ID 52358) tested in 4 B cell assays.	IEDB	52358	182	191	QSKVLPVPQK	ECO:0000213	PubMed	11678861
P02666	VVPPFLQPEV is a linear peptidic epitope (epitope ID 71789) tested in 3 B cell assays and 45 MHC ligand assays.	IEDB	71789	98	107	VVPPFLQPEV	ECO:0000213	PubMed	17517096
P02666	YQEPVLGPVR is a linear peptidic epitope (epitope ID 75481) tested in 4 B cell assays and 3 MHC ligand assays.	IEDB	75481	208	217	YQEPVLGPVR	ECO:0000213	PubMed	11678861
P02666	KEMPFPKYPV is a linear peptidic epitope (epitope ID 115807) tested in 2 B cell assays.	IEDB	115807	122	131	KEMPFPKYPV	ECO:0000213	PubMed	11529896
P02666	KHKEMPFPKY is a linear peptidic epitope (epitope ID 115823) tested in 2 B cell assays.	IEDB	115823	120	129	KHKEMPFPKY	ECO:0000213	PubMed	11529896
P02666	MPFPKYPVEP is a linear peptidic epitope (epitope ID 115865) tested in 2 B cell assays.	IEDB	115865	124	133	MPFPKYPVEP	ECO:0000213	PubMed	11529896
P02668	DKTEIPTINT is a linear peptidic epitope (epitope ID 8994) tested in 4 B cell assays and 2 MHC ligand assays.	IEDB	8994	136	145	DKTEIPTINT	ECO:0000213	PubMed	11529896
P02668	DKTEIPTINT is a linear peptidic epitope (epitope ID 8994) tested in 4 B cell assays and 2 MHC ligand assays.	IEDB	8994	136	145	DKTEIPTINT	ECO:0000213	PubMed	12170271
P02668	EAVESTVATLED is a linear peptidic epitope (epitope ID 11210) tested in 1 B cell assay.	IEDB	11210	158	169	EAVESTVATLED	ECO:0000213	PubMed	18186809
P02668	FFSDKIAKYI is a linear peptidic epitope (epitope ID 15893) tested in 5 B cell assays.	IEDB	15893	38	47	FFSDKIAKYI	ECO:0000213	PubMed	11529896
P02668	FFSDKIAKYI is a linear peptidic epitope (epitope ID 15893) tested in 5 B cell assays.	IEDB	15893	38	47	FFSDKIAKYI	ECO:0000213	PubMed	12170271
P02668	FFSDKIAKYI is a linear peptidic epitope (epitope ID 15893) tested in 5 B cell assays.	IEDB	15893	38	47	FFSDKIAKYI	ECO:0000213	PubMed	18186809
P02668	FLPYPYYAKP is a linear peptidic epitope (epitope ID 16863) tested in 4 B cell assays.	IEDB	16863	76	85	FLPYPYYAKP	ECO:0000213	PubMed	11529896
P02668	FLPYPYYAKP is a linear peptidic epitope (epitope ID 16863) tested in 4 B cell assays.	IEDB	16863	76	85	FLPYPYYAKP	ECO:0000213	PubMed	12170271
P02668	KDERFFSDKI is a linear peptidic epitope (epitope ID 30141) tested in 4 B cell assays.	IEDB	30141	34	43	KDERFFSDKI	ECO:0000213	PubMed	11529896
P02668	KDERFFSDKI is a linear peptidic epitope (epitope ID 30141) tested in 4 B cell assays.	IEDB	30141	34	43	KDERFFSDKI	ECO:0000213	PubMed	12170271
P02668	RHPHPHLSFM is a linear peptidic epitope (epitope ID 54078) tested in 4 B cell assays.	IEDB	54078	118	127	RHPHPHLSFM	ECO:0000213	PubMed	11529896
P02668	RHPHPHLSFM is a linear peptidic epitope (epitope ID 54078) tested in 4 B cell assays.	IEDB	54078	118	127	RHPHPHLSFM	ECO:0000213	PubMed	12170271
P02668	RHPHPHLSFMAI is a linear peptidic epitope (epitope ID 54079) tested in 1 B cell assay.	IEDB	54079	118	129	RHPHPHLSFMAI	ECO:0000213	PubMed	18186809
P02668	SPPEINTVQV is a linear peptidic epitope (epitope ID 60178) tested in 4 B cell assays.	IEDB	60178	176	185	SPPEINTVQV	ECO:0000213	PubMed	11529896
P02668	SPPEINTVQV is a linear peptidic epitope (epitope ID 60178) tested in 4 B cell assays.	IEDB	60178	176	185	SPPEINTVQV	ECO:0000213	PubMed	12170271
P02668	VESTVATLED is a linear peptidic epitope (epitope ID 68358) tested in 4 B cell assays.	IEDB	68358	160	169	VESTVATLED	ECO:0000213	PubMed	11529896
P02668	VESTVATLED is a linear peptidic epitope (epitope ID 68358) tested in 4 B cell assays.	IEDB	68358	160	169	VESTVATLED	ECO:0000213	PubMed	12170271
P02668	VLSRYPSYGL is a linear peptidic epitope (epitope ID 69782) tested in 4 B cell assays.	IEDB	69782	52	61	VLSRYPSYGL	ECO:0000213	PubMed	11529896
P02668	VLSRYPSYGL is a linear peptidic epitope (epitope ID 69782) tested in 4 B cell assays.	IEDB	69782	52	61	VLSRYPSYGL	ECO:0000213	PubMed	12170271
P02668	VRSPAQILQW is a linear peptidic epitope (epitope ID 70823) tested in 4 B cell assays and 1 MHC ligand assay.	IEDB	70823	88	97	VRSPAQILQW	ECO:0000213	PubMed	11529896
P02668	VRSPAQILQW is a linear peptidic epitope (epitope ID 70823) tested in 4 B cell assays and 1 MHC ligand assay.	IEDB	70823	88	97	VRSPAQILQW	ECO:0000213	PubMed	12170271
P02668	AKSCQAQPTTMARHPHPHLS is a linear peptidic epitope (epitope ID 115175) tested in 3 B cell assays.	IEDB	115175	106	125	AKSCQAQPTTMARHPHPHLS	ECO:0000213	PubMed	21211944
P02668	CQAQPTTMARHPHPHLSFMA is a linear peptidic epitope (epitope ID 115195) tested in 3 B cell assays.	IEDB	115195	109	128	CQAQPTTMARHPHPHLSFMA	ECO:0000213	PubMed	21211944
P02668	ILQWQVLSNTVPAKSCQAQP is a linear peptidic epitope (epitope ID 115292) tested in 3 B cell assays.	IEDB	115292	94	113	ILQWQVLSNTVPAKSCQAQP	ECO:0000213	PubMed	21211944
P02668	PAAVRSPAQILQWQVLSNTV is a linear peptidic epitope (epitope ID 115409) tested in 3 B cell assays.	IEDB	115409	85	104	PAAVRSPAQILQWQVLSNTV	ECO:0000213	PubMed	21211944
P02668	PAQILQWQVLSNTVPAKSCQ is a linear peptidic epitope (epitope ID 115410) tested in 3 B cell assays.	IEDB	115410	91	110	PAQILQWQVLSNTVPAKSCQ	ECO:0000213	PubMed	21211944
P02668	PPKKNQDKTEIPTINTIASG is a linear peptidic epitope (epitope ID 115423) tested in 3 B cell assays.	IEDB	115423	130	149	PPKKNQDKTEIPTINTIASG	ECO:0000213	PubMed	21211944
P02668	PTSTPTTEAVESTVATLEDS is a linear peptidic epitope (epitope ID 115428) tested in 3 B cell assays.	IEDB	115428	151	170	PTSTPTTEAVESTVATLEDS	ECO:0000213	PubMed	21211944
P02668	RHPHPHLSFMAIPPKKNQDK is a linear peptidic epitope (epitope ID 115468) tested in 3 B cell assays.	IEDB	115468	118	137	RHPHPHLSFMAIPPKKNQDK	ECO:0000213	PubMed	21211944
P02668	SGEPTSTPTTEAVESTVATL is a linear peptidic epitope (epitope ID 115485) tested in 3 B cell assays.	IEDB	115485	148	167	SGEPTSTPTTEAVESTVATL	ECO:0000213	PubMed	21211944
P02668	TIASGEPTSTPTTEAVESTV is a linear peptidic epitope (epitope ID 115509) tested in 3 B cell assays.	IEDB	115509	145	164	TIASGEPTSTPTTEAVESTV	ECO:0000213	PubMed	21211944
P02668	TINTIASGEPTSTPTTEAVE is a linear peptidic epitope (epitope ID 115510) tested in 3 B cell assays.	IEDB	115510	142	161	TINTIASGEPTSTPTTEAVE	ECO:0000213	PubMed	21211944
P02668	VRSPAQILQWQVLSNTVPAK is a linear peptidic epitope (epitope ID 115548) tested in 3 B cell assays.	IEDB	115548	88	107	VRSPAQILQWQVLSNTVPAK	ECO:0000213	PubMed	21211944
P02668	YAKPAAVRSPAQILQWQVLS is a linear peptidic epitope (epitope ID 115564) tested in 3 B cell assays.	IEDB	115564	82	101	YAKPAAVRSPAQILQWQVLS	ECO:0000213	PubMed	21211944
P02668	YPYYAKPAAVRSPAQILQWQ is a linear peptidic epitope (epitope ID 115568) tested in 3 B cell assays.	IEDB	115568	79	98	YPYYAKPAAVRSPAQILQWQ	ECO:0000213	PubMed	21211944
P02668	AAVRSPAQIL is a linear peptidic epitope (epitope ID 115672) tested in 2 B cell assays.	IEDB	115672	86	95	AAVRSPAQIL	ECO:0000213	PubMed	11529896
P02668	AIPPKKNQDK is a linear peptidic epitope (epitope ID 115678) tested in 2 B cell assays.	IEDB	115678	128	137	AIPPKKNQDK	ECO:0000213	PubMed	11529896
P02668	AKYIPIQYVL is a linear peptidic epitope (epitope ID 115680) tested in 2 B cell assays.	IEDB	115680	44	53	AKYIPIQYVL	ECO:0000213	PubMed	11529896
P02668	ALINNQFLPY is a linear peptidic epitope (epitope ID 115684) tested in 2 B cell assays.	IEDB	115684	70	79	ALINNQFLPY	ECO:0000213	PubMed	11529896
P02668	AQILQWQVLS is a linear peptidic epitope (epitope ID 115689) tested in 2 B cell assays.	IEDB	115689	92	101	AQILQWQVLS	ECO:0000213	PubMed	11529896
P02668	CEKDERFFSD is a linear peptidic epitope (epitope ID 115700) tested in 2 B cell assays.	IEDB	115700	32	41	CEKDERFFSD	ECO:0000213	PubMed	11529896
P02668	EAVESTVATL is a linear peptidic epitope (epitope ID 115718) tested in 2 B cell assays.	IEDB	115718	158	167	EAVESTVATL	ECO:0000213	PubMed	11529896
P02668	EDSPEVIESP is a linear peptidic epitope (epitope ID 115719) tested in 2 B cell assays.	IEDB	115719	168	177	EDSPEVIESP	ECO:0000213	PubMed	11529896
P02668	EPTSTPTTEA is a linear peptidic epitope (epitope ID 115730) tested in 2 B cell assays.	IEDB	115730	150	159	EPTSTPTTEA	ECO:0000213	PubMed	11529896
P02668	ERFFSDKIAK is a linear peptidic epitope (epitope ID 115733) tested in 2 B cell assays.	IEDB	115733	36	45	ERFFSDKIAK	ECO:0000213	PubMed	11529896
P02668	EVIESPPEIN is a linear peptidic epitope (epitope ID 115736) tested in 2 B cell assays.	IEDB	115736	172	181	EVIESPPEIN	ECO:0000213	PubMed	11529896
P02668	FMAIPPKKNQ is a linear peptidic epitope (epitope ID 115741) tested in 2 B cell assays.	IEDB	115741	126	135	FMAIPPKKNQ	ECO:0000213	PubMed	11529896
P02668	GLNYYQQKPV is a linear peptidic epitope (epitope ID 115760) tested in 2 B cell assays.	IEDB	115760	60	69	GLNYYQQKPV	ECO:0000213	PubMed	11529896
P02668	IASGEPTSTP is a linear peptidic epitope (epitope ID 115787) tested in 2 B cell assays.	IEDB	115787	146	155	IASGEPTSTP	ECO:0000213	PubMed	11529896
P02668	IESPPEINTV is a linear peptidic epitope (epitope ID 115788) tested in 2 B cell assays.	IEDB	115788	174	183	IESPPEINTV	ECO:0000213	PubMed	11529896
P02668	ILQWQVLSNT is a linear peptidic epitope (epitope ID 115791) tested in 2 B cell assays.	IEDB	115791	94	103	ILQWQVLSNT	ECO:0000213	PubMed	11529896
P02668	INNQFLPYPY is a linear peptidic epitope (epitope ID 115793) tested in 2 B cell assays and 2 MHC ligand assays.	IEDB	115793	72	81	INNQFLPYPY	ECO:0000213	PubMed	11529896
P02668	IPTINTIASG is a linear peptidic epitope (epitope ID 115795) tested in 2 B cell assays.	IEDB	115795	140	149	IPTINTIASG	ECO:0000213	PubMed	11529896
P02668	IRCEKDERFF is a linear peptidic epitope (epitope ID 115799) tested in 2 B cell assays.	IEDB	115799	30	39	IRCEKDERFF	ECO:0000213	PubMed	11529896
P02668	KIAKYIPIQY is a linear peptidic epitope (epitope ID 115824) tested in 2 B cell assays.	IEDB	115824	42	51	KIAKYIPIQY	ECO:0000213	PubMed	11529896
P02668	KKNQDKTEIP is a linear peptidic epitope (epitope ID 115827) tested in 2 B cell assays.	IEDB	115827	132	141	KKNQDKTEIP	ECO:0000213	PubMed	11529896
P02668	KPAAVRSPAQ is a linear peptidic epitope (epitope ID 115828) tested in 2 B cell assays.	IEDB	115828	84	93	KPAAVRSPAQ	ECO:0000213	PubMed	11529896
P02668	LSFMAIPPKK is a linear peptidic epitope (epitope ID 115853) tested in 2 B cell assays.	IEDB	115853	124	133	LSFMAIPPKK	ECO:0000213	PubMed	11529896
P02668	MARHPHPHLS is a linear peptidic epitope (epitope ID 115863) tested in 2 B cell assays.	IEDB	115863	116	125	MARHPHPHLS	ECO:0000213	PubMed	11529896
P02668	NQDKTEIPTI is a linear peptidic epitope (epitope ID 115873) tested in 2 B cell assays.	IEDB	115873	134	143	NQDKTEIPTI	ECO:0000213	PubMed	11529896
P02668	NQFLPYPYYA is a linear peptidic epitope (epitope ID 115874) tested in 2 B cell assays.	IEDB	115874	74	83	NQFLPYPYYA	ECO:0000213	PubMed	11529896
P02668	NTIASGEPTS is a linear peptidic epitope (epitope ID 115875) tested in 2 B cell assays.	IEDB	115875	144	153	NTIASGEPTS	ECO:0000213	PubMed	11529896
P02668	NYYQQKPVAL is a linear peptidic epitope (epitope ID 115879) tested in 2 B cell assays.	IEDB	115879	62	71	NYYQQKPVAL	ECO:0000213	PubMed	11529896
P02668	PEINTVQVTS is a linear peptidic epitope (epitope ID 115881) tested in 2 B cell assays.	IEDB	115881	178	187	PEINTVQVTS	ECO:0000213	PubMed	11529896
P02668	PHLSFMAIPP is a linear peptidic epitope (epitope ID 115886) tested in 2 B cell assays.	IEDB	115886	122	131	PHLSFMAIPP	ECO:0000213	PubMed	11529896
P02668	PHPHLSFMAI is a linear peptidic epitope (epitope ID 115887) tested in 2 B cell assays.	IEDB	115887	120	129	PHPHLSFMAI	ECO:0000213	PubMed	11529896
P02668	PIQYVLSRYP is a linear peptidic epitope (epitope ID 115890) tested in 2 B cell assays.	IEDB	115890	48	57	PIQYVLSRYP	ECO:0000213	PubMed	11529896
P02668	PPKKNQDKTE is a linear peptidic epitope (epitope ID 115896) tested in 2 B cell assays.	IEDB	115896	130	139	PPKKNQDKTE	ECO:0000213	PubMed	11529896
P02668	PVALINNQFL is a linear peptidic epitope (epitope ID 115905) tested in 2 B cell assays.	IEDB	115905	68	77	PVALINNQFL	ECO:0000213	PubMed	11529896
P02668	PYPYYAKPAA is a linear peptidic epitope (epitope ID 115910) tested in 2 B cell assays.	IEDB	115910	78	87	PYPYYAKPAA	ECO:0000213	PubMed	11529896
P02668	PYYAKPAAVR is a linear peptidic epitope (epitope ID 115911) tested in 2 B cell assays.	IEDB	115911	80	89	PYYAKPAAVR	ECO:0000213	PubMed	11529896
P02668	QAQPTTMARH is a linear peptidic epitope (epitope ID 115913) tested in 2 B cell assays.	IEDB	115913	110	119	QAQPTTMARH	ECO:0000213	PubMed	11529896
P02668	QEQNQEQPIR is a linear peptidic epitope (epitope ID 115915) tested in 2 B cell assays.	IEDB	115915	22	31	QEQNQEQPIR	ECO:0000213	PubMed	11529896
P02668	QEQPIRCEKD is a linear peptidic epitope (epitope ID 115916) tested in 2 B cell assays.	IEDB	115916	26	35	QEQPIRCEKD	ECO:0000213	PubMed	11529896
P02668	QKPVALINNQ is a linear peptidic epitope (epitope ID 115917) tested in 2 B cell assays.	IEDB	115917	66	75	QKPVALINNQ	ECO:0000213	PubMed	11529896
P02668	QNQEQPIRCE is a linear peptidic epitope (epitope ID 115920) tested in 2 B cell assays.	IEDB	115920	24	33	QNQEQPIRCE	ECO:0000213	PubMed	11529896
P02668	QPIRCEKDER is a linear peptidic epitope (epitope ID 115922) tested in 2 B cell assays.	IEDB	115922	28	37	QPIRCEKDER	ECO:0000213	PubMed	11529896
P02668	QPTTMARHPH is a linear peptidic epitope (epitope ID 115924) tested in 2 B cell assays.	IEDB	115924	112	121	QPTTMARHPH	ECO:0000213	PubMed	11529896
P02668	QVLSNTVPAK is a linear peptidic epitope (epitope ID 115932) tested in 2 B cell assays.	IEDB	115932	98	107	QVLSNTVPAK	ECO:0000213	PubMed	11529896
P02668	QWQVLSNTVP is a linear peptidic epitope (epitope ID 115933) tested in 2 B cell assays.	IEDB	115933	96	105	QWQVLSNTVP	ECO:0000213	PubMed	11529896
P02668	QYVLSRYPSY is a linear peptidic epitope (epitope ID 115935) tested in 2 B cell assays.	IEDB	115935	50	59	QYVLSRYPSY	ECO:0000213	PubMed	11529896
P02668	SGEPTSTPTT is a linear peptidic epitope (epitope ID 115955) tested in 2 B cell assays.	IEDB	115955	148	157	SGEPTSTPTT	ECO:0000213	PubMed	11529896
P02668	SPAQILQWQV is a linear peptidic epitope (epitope ID 115979) tested in 2 B cell assays.	IEDB	115979	90	99	SPAQILQWQV	ECO:0000213	PubMed	11529896
P02668	SPEVIESPPE is a linear peptidic epitope (epitope ID 115980) tested in 2 B cell assays.	IEDB	115980	170	179	SPEVIESPPE	ECO:0000213	PubMed	11529896
P02668	SRYPSYGLNY is a linear peptidic epitope (epitope ID 115982) tested in 2 B cell assays and 3 MHC ligand assays.	IEDB	115982	54	63	SRYPSYGLNY	ECO:0000213	PubMed	11529896
P02668	STVATLEDSP is a linear peptidic epitope (epitope ID 115985) tested in 2 B cell assays.	IEDB	115985	162	171	STVATLEDSP	ECO:0000213	PubMed	11529896
P02668	SYGLNYYQQK is a linear peptidic epitope (epitope ID 115990) tested in 5 B cell assays.	IEDB	115990	58	67	SYGLNYYQQK	ECO:0000213	PubMed	21211944
P02668	SYGLNYYQQK is a linear peptidic epitope (epitope ID 115990) tested in 5 B cell assays.	IEDB	115990	58	67	SYGLNYYQQK	ECO:0000213	PubMed	11529896
P02668	TEIPTINTIA is a linear peptidic epitope (epitope ID 115993) tested in 2 B cell assays.	IEDB	115993	138	147	TEIPTINTIA	ECO:0000213	PubMed	11529896
P02668	TINTIASGEP is a linear peptidic epitope (epitope ID 115995) tested in 2 B cell assays.	IEDB	115995	142	151	TINTIASGEP	ECO:0000213	PubMed	11529896
P02668	TLEDSPEVIE is a linear peptidic epitope (epitope ID 115998) tested in 2 B cell assays.	IEDB	115998	166	175	TLEDSPEVIE	ECO:0000213	PubMed	11529896
P02668	TPTTEAVEST is a linear peptidic epitope (epitope ID 116000) tested in 2 B cell assays.	IEDB	116000	154	163	TPTTEAVEST	ECO:0000213	PubMed	11529896
P02668	TSTPTTEAVE is a linear peptidic epitope (epitope ID 116004) tested in 2 B cell assays.	IEDB	116004	152	161	TSTPTTEAVE	ECO:0000213	PubMed	11529896
P02668	TTEAVESTVA is a linear peptidic epitope (epitope ID 116005) tested in 2 B cell assays.	IEDB	116005	156	165	TTEAVESTVA	ECO:0000213	PubMed	11529896
P02668	TTMARHPHPH is a linear peptidic epitope (epitope ID 116008) tested in 2 B cell assays.	IEDB	116008	114	123	TTMARHPHPH	ECO:0000213	PubMed	11529896
P02668	VATLEDSPEV is a linear peptidic epitope (epitope ID 116010) tested in 2 B cell assays.	IEDB	116010	164	173	VATLEDSPEV	ECO:0000213	PubMed	11529896
P02668	YAKPAAVRSP is a linear peptidic epitope (epitope ID 116029) tested in 2 B cell assays.	IEDB	116029	82	91	YAKPAAVRSP	ECO:0000213	PubMed	11529896
P02668	YIPIQYVLSR is a linear peptidic epitope (epitope ID 116037) tested in 2 B cell assays.	IEDB	116037	46	55	YIPIQYVLSR	ECO:0000213	PubMed	11529896
P02668	YPSYGLNYYQ is a linear peptidic epitope (epitope ID 116039) tested in 2 B cell assays.	IEDB	116039	56	65	YPSYGLNYYQ	ECO:0000213	PubMed	11529896
P02668	YQQKPVALIN is a linear peptidic epitope (epitope ID 116040) tested in 2 B cell assays.	IEDB	116040	64	73	YQQKPVALIN	ECO:0000213	PubMed	11529896
P02668	HLSFMAIPPK is a linear peptidic epitope (epitope ID 161638) tested in 1 B cell assay.	IEDB	161638	123	132	HLSFMAIPPK	ECO:0000213	PubMed	22092935
P02668	QDKTEIPTIN is a linear peptidic epitope (epitope ID 161669) tested in 1 B cell assay and 2 MHC ligand assays.	IEDB	161669	135	144	QDKTEIPTIN	ECO:0000213	PubMed	22092935
P02668	PAQILQWQVLSNTVP is a linear peptidic epitope (epitope ID 763580) tested in 7 T cell assays.	IEDB	763580	91	105	PAQILQWQVLSNTVP	ECO:0000213	PubMed	37604312
P02668	FLPYPYYAKPAAVRS is a linear peptidic epitope (epitope ID 2245376) tested in 3 T cell assays.	IEDB	2245376	76	90	FLPYPYYAKPAAVRS	ECO:0000213	PubMed	37604312
P02668	HPHLSFMAIPPKKNQ is a linear peptidic epitope (epitope ID 2245825) tested in 3 T cell assays.	IEDB	2245825	121	135	HPHLSFMAIPPKKNQ	ECO:0000213	PubMed	37604312
P02672	PPSGDFLTEGGGVR is a linear peptidic epitope (epitope ID 234186) tested in 1 MHC ligand assay.	IEDB	234186	25	38	PPSGDFLTEGGGVR	ECO:0000213	PubMed	12648094
P02687	TTHYGSLPQK is a linear peptidic epitope (epitope ID 111856) tested in 1 T cell assay and 33 B cell assays.	IEDB	111856	64	73	TTHYGSLPQK	ECO:0000213	PubMed	2430996
P02687	TTHYGSLPQK is a linear peptidic epitope (epitope ID 111856) tested in 1 T cell assay and 33 B cell assays.	IEDB	111856	64	73	TTHYGSLPQK	ECO:0000213	PubMed	2582288
P02687	FGSDRGAPKRGSGKDGHHAARTTHYGSLPQKAQGHRPQDENPVVHF is a linear peptidic epitope (epitope ID 113396) tested in 1 T cell assay and 5 B cell assays.	IEDB	113396	43	88	FGSDRGAPKRGSGKDGHHAARTTHYGSLPQKAQGHRPQDENPVVHF	ECO:0000213	PubMed	6183342
P02687	FSWGAEGQK is a linear peptidic epitope (epitope ID 113414) tested in 4 T cell assays and 1 B cell assay.	IEDB	113414	113	121	FSWGAEGQK	ECO:0000213	PubMed	5033419
P02687	SGKDGHHAA is a linear peptidic epitope (epitope ID 113848) tested in 3 B cell assays.	IEDB	113848	54	62	SGKDGHHAA	ECO:0000213	PubMed	1281825
P02687	PQDENPVVHF is a linear peptidic epitope (epitope ID 114224) tested in 8 B cell assays.	IEDB	114224	79	88	PQDENPVVHF	ECO:0000213	PubMed	2419434
P02687	PQDENPVVHF is a linear peptidic epitope (epitope ID 114224) tested in 8 B cell assays.	IEDB	114224	79	88	PQDENPVVHF	ECO:0000213	PubMed	2466871
P02687	PQDENPVVHF is a linear peptidic epitope (epitope ID 114224) tested in 8 B cell assays.	IEDB	114224	79	88	PQDENPVVHF	ECO:0000213	PubMed	7515900
P02687	AQGHRPQDE is a linear peptidic epitope (epitope ID 114740) tested in 5 B cell assays.	IEDB	114740	74	82	AQGHRPQDE	ECO:0000213	PubMed	6083471
P02687	AQGHRPQDE is a linear peptidic epitope (epitope ID 114740) tested in 5 B cell assays.	IEDB	114740	74	82	AQGHRPQDE	ECO:0000213	PubMed	6174544
P02687	AQGHRPQDE is a linear peptidic epitope (epitope ID 114740) tested in 5 B cell assays.	IEDB	114740	74	82	AQGHRPQDE	ECO:0000213	PubMed	6209588
P02687	AQGHRPQDEN is a linear peptidic epitope (epitope ID 115593) tested in 4 B cell assays.	IEDB	115593	74	83	AQGHRPQDEN	ECO:0000213	PubMed	2418380
P02687	AQGHRPQDEN is a linear peptidic epitope (epitope ID 115593) tested in 4 B cell assays.	IEDB	115593	74	83	AQGHRPQDEN	ECO:0000213	PubMed	6209588
P02687	GSLPQKAQGHRPQDEN is a linear peptidic epitope (epitope ID 115610) tested in 5 B cell assays.	IEDB	115610	68	83	GSLPQKAQGHRPQDEN	ECO:0000213	PubMed	2418380
P02687	TPRTPPPSQGKG is a linear peptidic epitope (epitope ID 116169) tested in 2 B cell assays.	IEDB	116169	94	105	TPRTPPPSQGKG	ECO:0000213	PubMed	2416809
P02687	RPQDENPVVH is a linear peptidic epitope (epitope ID 116468) tested in 2 B cell assays.	IEDB	116468	78	87	RPQDENPVVH	ECO:0000213	PubMed	6177712
P02687	RPQDENPVVH is a linear peptidic epitope (epitope ID 116468) tested in 2 B cell assays.	IEDB	116468	78	87	RPQDENPVVH	ECO:0000213	PubMed	68996
P02687	SRFSWGAEGQ is a linear peptidic epitope (epitope ID 136000) tested in 3 T cell assays and 1 B cell assay.	IEDB	136000	111	120	SRFSWGAEGQ	ECO:0000213	PubMed	5033419
P02690	EISFKLGQEF is a linear peptidic epitope (epitope ID 114114) tested in 14 T cell assays and 1 MHC ligand assay.	IEDB	114114	62	71	EISFKLGQEF	ECO:0000213	PubMed	1692033
P02690	EISFKLGQEFEE is a linear peptidic epitope (epitope ID 114202) tested in 5 T cell assays.	IEDB	114202	62	73	EISFKLGQEFEE	ECO:0000213	PubMed	2463999
P02690	TEISFKLGQEF is a linear peptidic epitope (epitope ID 131102) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	131102	61	71	TEISFKLGQEF	ECO:0000213	PubMed	12161025
P02690	TEISFKLGQEF is a linear peptidic epitope (epitope ID 131102) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	131102	61	71	TEISFKLGQEF	ECO:0000213	PubMed	1692033
P02690	ISFKLGQE is a linear peptidic epitope (epitope ID 131922) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	131922	63	70	ISFKLGQE	ECO:0000213	PubMed	12161025
P02699	FTHQGSDFGPI is a linear peptidic epitope (epitope ID 122355) tested in 3 T cell assays and 1 B cell assay.	IEDB	122355	276	286	FTHQGSDFGPI	ECO:0000213	PubMed	1521467
P02699	VTVQHKKLRTPLNYI is a linear peptidic epitope (epitope ID 122642) tested in 4 T cell assays and 2 B cell assays.	IEDB	122642	61	75	VTVQHKKLRTPLNYI	ECO:0000213	PubMed	1913836
P02699	DEASTTVSKTE is a linear peptidic epitope (epitope ID 2267335) tested in 4 B cell assays.	IEDB	2267335	331	341	DEASTTVSKTE	ECO:0000213	PubMed	2457026
P02699	TETSQVAPA is a linear peptidic epitope (epitope ID 2267563) tested in 14 B cell assays.	IEDB	2267563	340	348	TETSQVAPA	ECO:0000213	PubMed	2006550
P02699	TETSQVAPA is a linear peptidic epitope (epitope ID 2267563) tested in 14 B cell assays.	IEDB	2267563	340	348	TETSQVAPA	ECO:0000213	PubMed	2457026
P02699	DEASTTVSKT is a linear peptidic epitope (epitope ID 2267660) tested in 13 B cell assays.	IEDB	2267660	331	340	DEASTTVSKT	ECO:0000213	PubMed	2006550
P02699	DEASTTVSKT is a linear peptidic epitope (epitope ID 2267660) tested in 13 B cell assays.	IEDB	2267660	331	340	DEASTTVSKT	ECO:0000213	PubMed	6529569
P02699	ETSQVAPA is a linear peptidic epitope (epitope ID 2267669) tested in 7 B cell assays.	IEDB	2267669	341	348	ETSQVAPA	ECO:0000213	PubMed	6529569
P02699	TTVSKTE is a linear peptidic epitope (epitope ID 2267760) tested in 4 B cell assays.	IEDB	2267760	335	341	TTVSKTE	ECO:0000213	PubMed	6529569
P02699	EGPNFYVPFS is a linear peptidic epitope (epitope ID 2268469) tested in 2 B cell assays.	IEDB	2268469	5	14	EGPNFYVPFS	ECO:0000213	PubMed	2006550
P02699	FYVPFSNK is a linear peptidic epitope (epitope ID 2268484) tested in 1 B cell assay.	IEDB	2268484	9	16	FYVPFSNK	ECO:0000213	PubMed	2006550
P02699	FYVPFSNKTG is a linear peptidic epitope (epitope ID 2268485) tested in 1 B cell assay.	IEDB	2268485	9	18	FYVPFSNKTG	ECO:0000213	PubMed	2006550
P02699	FYVPFSNKTGVV is a linear peptidic epitope (epitope ID 2268486) tested in 1 B cell assay.	IEDB	2268486	9	20	FYVPFSNKTGVV	ECO:0000213	PubMed	2006550
P02699	NFYVPFS is a linear peptidic epitope (epitope ID 2268543) tested in 4 B cell assays.	IEDB	2268543	8	14	NFYVPFS	ECO:0000213	PubMed	2006550
P02699	PNFYVPFSNKTG is a linear peptidic epitope (epitope ID 2268549) tested in 4 B cell assays.	IEDB	2268549	7	18	PNFYVPFSNKTG	ECO:0000213	PubMed	2006550
P02699	TTVSKTET is a linear peptidic epitope (epitope ID 2268597) tested in 6 B cell assays.	IEDB	2268597	335	342	TTVSKTET	ECO:0000213	PubMed	2006550
P02699	TTVSKTETSQV is a linear peptidic epitope (epitope ID 2268598) tested in 4 B cell assays.	IEDB	2268598	335	345	TTVSKTETSQV	ECO:0000213	PubMed	2006550
P02754	AQKKIIAEKT is a linear peptidic epitope (epitope ID 3985) tested in 6 B cell assays.	IEDB	3985	83	92	AQKKIIAEKT	ECO:0000213	PubMed	11729348
P02754	AQKKIIAEKT is a linear peptidic epitope (epitope ID 3985) tested in 6 B cell assays.	IEDB	3985	83	92	AQKKIIAEKT	ECO:0000213	PubMed	12170271
P02754	EVDDEALEKF is a linear peptidic epitope (epitope ID 14638) tested in 5 B cell assays.	IEDB	14638	143	152	EVDDEALEKF	ECO:0000213	PubMed	11729348
P02754	EVDDEALEKF is a linear peptidic epitope (epitope ID 14638) tested in 5 B cell assays.	IEDB	14638	143	152	EVDDEALEKF	ECO:0000213	PubMed	12170271
P02754	IDALNENK is a linear peptidic epitope (epitope ID 25535) tested in 3 B cell assays and 4 MHC ligand assays.	IEDB	25535	100	107	IDALNENK	ECO:0000213	PubMed	10457108
P02754	KALKALPMHI is a linear peptidic epitope (epitope ID 29861) tested in 3 B cell assays.	IEDB	29861	154	163	KALKALPMHI	ECO:0000213	PubMed	12170271
P02754	KPTPEGDLEI is a linear peptidic epitope (epitope ID 32907) tested in 5 B cell assays and 2 MHC ligand assays.	IEDB	32907	63	72	KPTPEGDLEI	ECO:0000213	PubMed	11729348
P02754	KPTPEGDLEI is a linear peptidic epitope (epitope ID 32907) tested in 5 B cell assays and 2 MHC ligand assays.	IEDB	32907	63	72	KPTPEGDLEI	ECO:0000213	PubMed	12170271
P02754	KTKIPAVFKI is a linear peptidic epitope (epitope ID 33732) tested in 6 B cell assays.	IEDB	33732	91	100	KTKIPAVFKI	ECO:0000213	PubMed	11729348
P02754	KTKIPAVFKI is a linear peptidic epitope (epitope ID 33732) tested in 6 B cell assays.	IEDB	33732	91	100	KTKIPAVFKI	ECO:0000213	PubMed	12170271
P02754	LIVTQTMK is a linear peptidic epitope (epitope ID 36760) tested in 2 B cell assays and 2 MHC ligand assays.	IEDB	36760	17	24	LIVTQTMK	ECO:0000213	PubMed	10457108
P02754	LIVTQTMK is a linear peptidic epitope (epitope ID 36760) tested in 2 B cell assays and 2 MHC ligand assays.	IEDB	36760	17	24	LIVTQTMK	ECO:0000213	PubMed	16220005
P02754	LSFNPTQLEEQCHI is a linear peptidic epitope (epitope ID 39349) tested in 8 B cell assays.	IEDB	39349	165	178	LSFNPTQLEEQCHI	ECO:0000213	PubMed	12133623
P02754	RTPEVDDEALE is a linear peptidic epitope (epitope ID 56145) tested in 1 B cell assay.	IEDB	56145	140	150	RTPEVDDEALE	ECO:0000213	PubMed	1720415
P02754	TPEVDDEALEK is a linear peptidic epitope (epitope ID 65565) tested in 9 B cell assays and 12 MHC ligand assays.	IEDB	65565	141	151	TPEVDDEALEK	ECO:0000213	PubMed	36307246
P02754	TPEVDDEALEK is a linear peptidic epitope (epitope ID 65565) tested in 9 B cell assays and 12 MHC ligand assays.	IEDB	65565	141	151	TPEVDDEALEK	ECO:0000213	PubMed	10457108
P02754	TPEVDDEALEK is a linear peptidic epitope (epitope ID 65565) tested in 9 B cell assays and 12 MHC ligand assays.	IEDB	65565	141	151	TPEVDDEALEK	ECO:0000213	PubMed	10640911
P02754	TPEVDDEALEK is a linear peptidic epitope (epitope ID 65565) tested in 9 B cell assays and 12 MHC ligand assays.	IEDB	65565	141	151	TPEVDDEALEK	ECO:0000213	PubMed	12133623
P02754	TPEVDDEALEK is a linear peptidic epitope (epitope ID 65565) tested in 9 B cell assays and 12 MHC ligand assays.	IEDB	65565	141	151	TPEVDDEALEK	ECO:0000213	PubMed	2477067
P02754	TPEVDDEALEK is a linear peptidic epitope (epitope ID 65565) tested in 9 B cell assays and 12 MHC ligand assays.	IEDB	65565	141	151	TPEVDDEALEK	ECO:0000213	PubMed	7693669
P02754	VLVLDTDYK is a linear peptidic epitope (epitope ID 69827) tested in 3 B cell assays and 4 MHC ligand assays.	IEDB	69827	108	116	VLVLDTDYK	ECO:0000213	PubMed	36307246
P02754	VLVLDTDYK is a linear peptidic epitope (epitope ID 69827) tested in 3 B cell assays and 4 MHC ligand assays.	IEDB	69827	108	116	VLVLDTDYK	ECO:0000213	PubMed	10457108
P02754	VYVEELKPTP is a linear peptidic epitope (epitope ID 72177) tested in 4 B cell assays.	IEDB	72177	57	66	VYVEELKPTP	ECO:0000213	PubMed	11729348
P02754	VYVEELKPTPEGDLEILLQK is a linear peptidic epitope (epitope ID 72178) tested in 16 B cell assays and 9 MHC ligand assays.	IEDB	72178	57	76	VYVEELKPTPEGDLEILLQK	ECO:0000213	PubMed	12133623
P02754	YLLFCMENSAE is a linear peptidic epitope (epitope ID 74777) tested in 12 T cell assays.	IEDB	74777	118	128	YLLFCMENSAE	ECO:0000213	PubMed	18331418
P02754	VAGTWYSLAMAASDI is a linear peptidic epitope (epitope ID 89851) tested in 13 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	89851	31	45	VAGTWYSLAMAASDI	ECO:0000213	PubMed	37604312
P02754	WENGECAQK is a linear peptidic epitope (epitope ID 96002) tested in 2 B cell assays.	IEDB	96002	77	85	WENGECAQK	ECO:0000213	PubMed	36307246
P02754	WENGECAQK is a linear peptidic epitope (epitope ID 96002) tested in 2 B cell assays.	IEDB	96002	77	85	WENGECAQK	ECO:0000213	PubMed	9313138
P02754	AVFKIDALNENKVLV is a linear peptidic epitope (epitope ID 96124) tested in 9 T cell assays.	IEDB	96124	96	110	AVFKIDALNENKVLV	ECO:0000213	PubMed	37604312
P02754	KFDKALKALPMHIRL is a linear peptidic epitope (epitope ID 96452) tested in 9 T cell assays.	IEDB	96452	151	165	KFDKALKALPMHIRL	ECO:0000213	PubMed	37604312
P02754	KIIAEKTKIPAVFKI is a linear peptidic epitope (epitope ID 96462) tested in 9 T cell assays.	IEDB	96462	86	100	KIIAEKTKIPAVFKI	ECO:0000213	PubMed	37604312
P02754	LKALPMHIRLSFNPT is a linear peptidic epitope (epitope ID 96564) tested in 9 T cell assays.	IEDB	96564	156	170	LKALPMHIRLSFNPT	ECO:0000213	PubMed	37604312
P02754	MHIRLSFNPTQLEEQ is a linear peptidic epitope (epitope ID 96642) tested in 9 T cell assays.	IEDB	96642	161	175	MHIRLSFNPTQLEEQ	ECO:0000213	PubMed	37604312
P02754	YSLAMAASDISLLDA is a linear peptidic epitope (epitope ID 97126) tested in 9 T cell assays.	IEDB	97126	36	50	YSLAMAASDISLLDA	ECO:0000213	PubMed	37604312
P02754	AASDISLLDA is a linear peptidic epitope (epitope ID 98677) tested in 3 B cell assays.	IEDB	98677	41	50	AASDISLLDA	ECO:0000213	PubMed	11729348
P02754	AEKTKIPAVF is a linear peptidic epitope (epitope ID 98681) tested in 4 B cell assays.	IEDB	98681	89	98	AEKTKIPAVF	ECO:0000213	PubMed	11729348
P02754	AEPEQSLACQ is a linear peptidic epitope (epitope ID 98682) tested in 3 B cell assays.	IEDB	98682	127	136	AEPEQSLACQ	ECO:0000213	PubMed	11729348
P02754	ALKALPMHIR is a linear peptidic epitope (epitope ID 98691) tested in 4 B cell assays.	IEDB	98691	155	164	ALKALPMHIR	ECO:0000213	PubMed	11729348
P02754	AMAASDISLL is a linear peptidic epitope (epitope ID 98696) tested in 3 B cell assays.	IEDB	98696	39	48	AMAASDISLL	ECO:0000213	PubMed	11729348
P02754	APLRVYVEEL is a linear peptidic epitope (epitope ID 98700) tested in 4 B cell assays.	IEDB	98700	53	62	APLRVYVEEL	ECO:0000213	PubMed	11729348
P02754	CLVRTPEVDD is a linear peptidic epitope (epitope ID 98710) tested in 3 B cell assays.	IEDB	98710	137	146	CLVRTPEVDD	ECO:0000213	PubMed	11729348
P02754	CQCLVRTPEV is a linear peptidic epitope (epitope ID 98713) tested in 3 B cell assays.	IEDB	98713	135	144	CQCLVRTPEV	ECO:0000213	PubMed	11729348
P02754	DALNENKVLV is a linear peptidic epitope (epitope ID 98723) tested in 4 B cell assays.	IEDB	98723	101	110	DALNENKVLV	ECO:0000213	PubMed	11729348
P02754	DAQSAPLRVY is a linear peptidic epitope (epitope ID 98724) tested in 3 B cell assays and 2 MHC ligand assays.	IEDB	98724	49	58	DAQSAPLRVY	ECO:0000213	PubMed	11729348
P02754	DDEALEKFDK is a linear peptidic epitope (epitope ID 98725) tested in 4 B cell assays.	IEDB	98725	145	154	DDEALEKFDK	ECO:0000213	PubMed	11729348
P02754	DIQKVAGTWY is a linear peptidic epitope (epitope ID 98729) tested in 3 B cell assays.	IEDB	98729	27	36	DIQKVAGTWY	ECO:0000213	PubMed	11729348
P02754	DKALKALPMH is a linear peptidic epitope (epitope ID 98733) tested in 3 B cell assays.	IEDB	98733	153	162	DKALKALPMH	ECO:0000213	PubMed	11729348
P02754	DLEILLQKWE is a linear peptidic epitope (epitope ID 98734) tested in 4 B cell assays.	IEDB	98734	69	78	DLEILLQKWE	ECO:0000213	PubMed	11729348
P02754	EALEKFDKAL is a linear peptidic epitope (epitope ID 98740) tested in 4 B cell assays.	IEDB	98740	147	156	EALEKFDKAL	ECO:0000213	PubMed	11729348
P02754	EGDLEILLQK is a linear peptidic epitope (epitope ID 98752) tested in 4 B cell assays.	IEDB	98752	67	76	EGDLEILLQK	ECO:0000213	PubMed	11729348
P02754	ELKPTPEGDL is a linear peptidic epitope (epitope ID 98760) tested in 3 B cell assays and 2 MHC ligand assays.	IEDB	98760	61	70	ELKPTPEGDL	ECO:0000213	PubMed	11729348
P02754	ENKVLVLDTD is a linear peptidic epitope (epitope ID 98763) tested in 3 B cell assays.	IEDB	98763	105	114	ENKVLVLDTD	ECO:0000213	PubMed	11729348
P02754	FCMENSAEPE is a linear peptidic epitope (epitope ID 98772) tested in 3 B cell assays.	IEDB	98772	121	130	FCMENSAEPE	ECO:0000213	PubMed	11729348
P02754	FNPTQLEEQC is a linear peptidic epitope (epitope ID 98777) tested in 3 B cell assays.	IEDB	98777	167	176	FNPTQLEEQC	ECO:0000213	PubMed	11729348
P02754	GLDIQKVAGT is a linear peptidic epitope (epitope ID 98803) tested in 3 B cell assays.	IEDB	98803	25	34	GLDIQKVAGT	ECO:0000213	PubMed	11729348
P02754	IIAEKTKIPA is a linear peptidic epitope (epitope ID 98824) tested in 4 B cell assays.	IEDB	98824	87	96	IIAEKTKIPA	ECO:0000213	PubMed	11729348
P02754	IRLSFNPTQL is a linear peptidic epitope (epitope ID 98834) tested in 4 B cell assays.	IEDB	98834	163	172	IRLSFNPTQL	ECO:0000213	PubMed	11729348
P02754	ISLLDAQSAP is a linear peptidic epitope (epitope ID 98836) tested in 3 B cell assays.	IEDB	98836	45	54	ISLLDAQSAP	ECO:0000213	PubMed	11729348
P02754	KALPMHIRLS is a linear peptidic epitope (epitope ID 98840) tested in 4 B cell assays.	IEDB	98840	157	166	KALPMHIRLS	ECO:0000213	PubMed	11729348
P02754	KFDKALKALP is a linear peptidic epitope (epitope ID 98845) tested in 4 B cell assays.	IEDB	98845	151	160	KFDKALKALP	ECO:0000213	PubMed	11729348
P02754	KIDALNENKV is a linear peptidic epitope (epitope ID 98847) tested in 3 B cell assays and 2 MHC ligand assays.	IEDB	98847	99	108	KIDALNENKV	ECO:0000213	PubMed	11729348
P02754	KIPAVFKIDA is a linear peptidic epitope (epitope ID 98849) tested in 4 B cell assays.	IEDB	98849	93	102	KIPAVFKIDA	ECO:0000213	PubMed	11729348
P02754	KKIIAEKTKI is a linear peptidic epitope (epitope ID 98851) tested in 4 B cell assays.	IEDB	98851	85	94	KKIIAEKTKI	ECO:0000213	PubMed	11729348
P02754	LACQCLVRTP is a linear peptidic epitope (epitope ID 98858) tested in 4 B cell assays.	IEDB	98858	133	142	LACQCLVRTP	ECO:0000213	PubMed	11729348
P02754	LEKFDKALKA is a linear peptidic epitope (epitope ID 98869) tested in 4 B cell assays.	IEDB	98869	149	158	LEKFDKALKA	ECO:0000213	PubMed	11729348
P02754	LLDAQSAPLR is a linear peptidic epitope (epitope ID 98881) tested in 3 B cell assays.	IEDB	98881	47	56	LLDAQSAPLR	ECO:0000213	PubMed	11729348
P02754	LNENKVLVLD is a linear peptidic epitope (epitope ID 98883) tested in 4 B cell assays.	IEDB	98883	103	112	LNENKVLVLD	ECO:0000213	PubMed	11729348
P02754	LPMHIRLSFN is a linear peptidic epitope (epitope ID 98885) tested in 4 B cell assays.	IEDB	98885	159	168	LPMHIRLSFN	ECO:0000213	PubMed	11729348
P02754	LRVYVEELKP is a linear peptidic epitope (epitope ID 98892) tested in 3 B cell assays.	IEDB	98892	55	64	LRVYVEELKP	ECO:0000213	PubMed	11729348
P02754	LSFNPTQLEE is a linear peptidic epitope (epitope ID 98893) tested in 3 B cell assays.	IEDB	98893	165	174	LSFNPTQLEE	ECO:0000213	PubMed	11729348
P02754	LVLDTDYKKY is a linear peptidic epitope (epitope ID 98896) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	98896	109	118	LVLDTDYKKY	ECO:0000213	PubMed	11729348
P02754	MENSAEPEQS is a linear peptidic epitope (epitope ID 98902) tested in 3 B cell assays.	IEDB	98902	123	132	MENSAEPEQS	ECO:0000213	PubMed	11729348
P02754	MHIRLSFNPT is a linear peptidic epitope (epitope ID 98903) tested in 4 B cell assays.	IEDB	98903	161	170	MHIRLSFNPT	ECO:0000213	PubMed	11729348
P02754	MKGLDIQKVA is a linear peptidic epitope (epitope ID 98904) tested in 4 B cell assays.	IEDB	98904	23	32	MKGLDIQKVA	ECO:0000213	PubMed	11729348
P02754	NSAEPEQSLA is a linear peptidic epitope (epitope ID 98919) tested in 3 B cell assays.	IEDB	98919	125	134	NSAEPEQSLA	ECO:0000213	PubMed	11729348
P02754	PAVFKIDALN is a linear peptidic epitope (epitope ID 98923) tested in 4 B cell assays.	IEDB	98923	95	104	PAVFKIDALN	ECO:0000213	PubMed	11729348
P02754	PEQSLACQCL is a linear peptidic epitope (epitope ID 98928) tested in 3 B cell assays.	IEDB	98928	129	138	PEQSLACQCL	ECO:0000213	PubMed	11729348
P02754	QSAPLRVYVE is a linear peptidic epitope (epitope ID 98972) tested in 4 B cell assays.	IEDB	98972	51	60	QSAPLRVYVE	ECO:0000213	PubMed	11729348
P02754	QSLACQCLVR is a linear peptidic epitope (epitope ID 98973) tested in 4 B cell assays.	IEDB	98973	131	140	QSLACQCLVR	ECO:0000213	PubMed	11729348
P02754	QTMKGLDIQK is a linear peptidic epitope (epitope ID 98974) tested in 4 B cell assays.	IEDB	98974	21	30	QTMKGLDIQK	ECO:0000213	PubMed	11729348
P02754	SDISLLDAQS is a linear peptidic epitope (epitope ID 98997) tested in 3 B cell assays.	IEDB	98997	43	52	SDISLLDAQS	ECO:0000213	PubMed	11729348
P02754	SLAMAASDIS is a linear peptidic epitope (epitope ID 99005) tested in 3 B cell assays.	IEDB	99005	37	46	SLAMAASDIS	ECO:0000213	PubMed	11729348
P02754	TPEGDLEILL is a linear peptidic epitope (epitope ID 99028) tested in 3 B cell assays.	IEDB	99028	65	74	TPEGDLEILL	ECO:0000213	PubMed	11729348
P02754	VEELKPTPEG is a linear peptidic epitope (epitope ID 99036) tested in 3 B cell assays.	IEDB	99036	59	68	VEELKPTPEG	ECO:0000213	PubMed	11729348
P02754	VFKIDALNEN is a linear peptidic epitope (epitope ID 99037) tested in 3 B cell assays.	IEDB	99037	97	106	VFKIDALNEN	ECO:0000213	PubMed	11729348
P02754	VRTPEVDDEA is a linear peptidic epitope (epitope ID 99049) tested in 3 B cell assays and 2 MHC ligand assays.	IEDB	99049	139	148	VRTPEVDDEA	ECO:0000213	PubMed	11729348
P02754	VTQTMKGLDI is a linear peptidic epitope (epitope ID 99052) tested in 4 B cell assays.	IEDB	99052	19	28	VTQTMKGLDI	ECO:0000213	PubMed	11729348
P02754	WYSLAMAASD is a linear peptidic epitope (epitope ID 99061) tested in 3 B cell assays.	IEDB	99061	35	44	WYSLAMAASD	ECO:0000213	PubMed	11729348
P02754	EILLQKWENG is a linear peptidic epitope (epitope ID 115220) tested in 3 B cell assays.	IEDB	115220	71	80	EILLQKWENG	ECO:0000213	PubMed	11729348
P02754	GTWYSLAMAA is a linear peptidic epitope (epitope ID 115275) tested in 2 B cell assays.	IEDB	115275	33	42	GTWYSLAMAA	ECO:0000213	PubMed	11729348
P02754	KYLLFCMENS is a linear peptidic epitope (epitope ID 115335) tested in 2 B cell assays.	IEDB	115335	117	126	KYLLFCMENS	ECO:0000213	PubMed	11729348
P02754	LDTDYKKYLL is a linear peptidic epitope (epitope ID 115342) tested in 2 B cell assays and 1 MHC ligand assay.	IEDB	115342	111	120	LDTDYKKYLL	ECO:0000213	PubMed	11729348
P02754	LIVTQTMKGL is a linear peptidic epitope (epitope ID 115347) tested in 3 B cell assays.	IEDB	115347	17	26	LIVTQTMKGL	ECO:0000213	PubMed	11729348
P02754	LLFCMENSAE is a linear peptidic epitope (epitope ID 115354) tested in 2 B cell assays.	IEDB	115354	119	128	LLFCMENSAE	ECO:0000213	PubMed	11729348
P02754	LLQKWENGEC is a linear peptidic epitope (epitope ID 115357) tested in 2 B cell assays.	IEDB	115357	73	82	LLQKWENGEC	ECO:0000213	PubMed	11729348
P02754	PTQLEEQCHI is a linear peptidic epitope (epitope ID 115427) tested in 2 B cell assays.	IEDB	115427	169	178	PTQLEEQCHI	ECO:0000213	PubMed	11729348
P02754	QKVAGTWYSL is a linear peptidic epitope (epitope ID 115442) tested in 2 B cell assays.	IEDB	115442	29	38	QKVAGTWYSL	ECO:0000213	PubMed	11729348
P02754	QKWENGECAQ is a linear peptidic epitope (epitope ID 115444) tested in 2 B cell assays.	IEDB	115444	75	84	QKWENGECAQ	ECO:0000213	PubMed	11729348
P02754	TPEVDDEALE is a linear peptidic epitope (epitope ID 115519) tested in 2 B cell assays and 2 MHC ligand assays.	IEDB	115519	141	150	TPEVDDEALE	ECO:0000213	PubMed	11729348
P02754	VAGTWYSLAM is a linear peptidic epitope (epitope ID 115530) tested in 2 B cell assays.	IEDB	115530	31	40	VAGTWYSLAM	ECO:0000213	PubMed	11729348
P02754	YKKYLLFCME is a linear peptidic epitope (epitope ID 115566) tested in 2 B cell assays.	IEDB	115566	115	124	YKKYLLFCME	ECO:0000213	PubMed	11729348
P02754	FKIDALNENKV is a linear peptidic epitope (epitope ID 146244) tested in 1 B cell assay and 2 MHC ligand assays.	IEDB	146244	98	108	FKIDALNENKV	ECO:0000213	PubMed	9671121
P02754	ALPMHIR is a linear peptidic epitope (epitope ID 2150136) tested in 1 B cell assay.	IEDB	2150136	158	164	ALPMHIR	ECO:0000213	PubMed	36307246
P02754	ALIVTQTMKGLDIQK is a linear peptidic epitope (epitope ID 2243964) tested in 6 T cell assays.	IEDB	2243964	16	30	ALIVTQTMKGLDIQK	ECO:0000213	PubMed	37604312
P02769	ESHAGCEKS is a linear peptidic epitope (epitope ID 14159) tested in 1 T cell assay and 1 B cell assay.	IEDB	14159	81	89	ESHAGCEKS	ECO:0000213	PubMed	12054661
P02769	HPEYAVSVLL is a linear peptidic epitope (epitope ID 24445) tested in 4 T cell assays, 2 B cell assays and 2 MHC ligand assays.	IEDB	24445	361	370	HPEYAVSVLL	ECO:0000213	PubMed	12054661
P02769	LSLILNRLC is a linear peptidic epitope (epitope ID 39480) tested in 1 T cell assay and 1 B cell assay.	IEDB	39480	476	484	LSLILNRLC	ECO:0000213	PubMed	12054661
P02769	PKAFDEKLFT is a linear peptidic epitope (epitope ID 48026) tested in 1 T cell assay and 1 B cell assay.	IEDB	48026	522	531	PKAFDEKLFT	ECO:0000213	PubMed	12054661
P02769	TLPDTEKQI is a linear peptidic epitope (epitope ID 64998) tested in 1 T cell assay and 1 B cell assay.	IEDB	64998	538	546	TLPDTEKQI	ECO:0000213	PubMed	12054661
P02769	VMENFVAF is a linear peptidic epitope (epitope ID 69942) tested in 4 T cell assays and 2 B cell assays.	IEDB	69942	570	577	VMENFVAF	ECO:0000213	PubMed	12054661
P02769	FKADEKKFWGKYLYE is a linear peptidic epitope (epitope ID 104488) tested in 14 T cell assays and 1 MHC ligand assay.	IEDB	104488	150	164	FKADEKKFWGKYLYE	ECO:0000213	PubMed	11034420
P02769	FKADEKKFWGKYL is a linear peptidic epitope (epitope ID 107118) tested in 3 T cell assays.	IEDB	107118	150	162	FKADEKKFWGKYL	ECO:0000213	PubMed	10586096
P02769	FKADEKKFWGKYL is a linear peptidic epitope (epitope ID 107118) tested in 3 T cell assays.	IEDB	107118	150	162	FKADEKKFWGKYL	ECO:0000213	PubMed	12645954
P02769	DTHKSEIAHRFKDLGE is a linear peptidic epitope (epitope ID 131399) tested in 1 MHC ligand assay.	IEDB	131399	25	40	DTHKSEIAHRFKDLGE	ECO:0000213	PubMed	10233671
P02769	GEEHFKGLVL is a linear peptidic epitope (epitope ID 146269) tested in 4 MHC ligand assays.	IEDB	146269	39	48	GEEHFKGLVL	ECO:0000213	PubMed	20934997
P02769	TPTLVEVSRSLGKVG is a linear peptidic epitope (epitope ID 234295) tested in 3 MHC ligand assays.	IEDB	234295	443	457	TPTLVEVSRSLGKVG	ECO:0000213	PubMed	12648094
P02769	TPTLVEVSRSLGKVGTR is a linear peptidic epitope (epitope ID 234296) tested in 2 MHC ligand assays.	IEDB	234296	443	459	TPTLVEVSRSLGKVGTR	ECO:0000213	PubMed	12648094
P02769	DEKKFWGKYLYEIAR is a linear peptidic epitope (epitope ID 234565) tested in 1 MHC ligand assay.	IEDB	234565	153	167	DEKKFWGKYLYEIAR	ECO:0000213	PubMed	15565337
P02769	LGEYGFQNALIVR is a linear peptidic epitope (epitope ID 235209) tested in 22 MHC ligand assays.	IEDB	235209	421	433	LGEYGFQNALIVR	ECO:0000213	PubMed	15565337
P02769	LGEYGFQNALIVR is a linear peptidic epitope (epitope ID 235209) tested in 22 MHC ligand assays.	IEDB	235209	421	433	LGEYGFQNALIVR	ECO:0000213	PubMed	30573663
P02769	KPLLEKSHCIAEVEKD is a linear peptidic epitope (epitope ID 237799) tested in 4 MHC ligand assays.	IEDB	237799	304	319	KPLLEKSHCIAEVEKD	ECO:0000213	PubMed	11801660
P02769	GKYLYEIARRHPYF is a linear peptidic epitope (epitope ID 300219) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	300219	159	172	GKYLYEIARRHPYF	ECO:0000213	PubMed	1656276
P02769	KVPQVSTPTLVEVSR is a linear peptidic epitope (epitope ID 489922) tested in 57 MHC ligand assays.	IEDB	489922	437	451	KVPQVSTPTLVEVSR	ECO:0000213	PubMed	26495903
P02769	DAFLGSFLYEYSR is a linear peptidic epitope (epitope ID 497800) tested in 5 MHC ligand assays.	IEDB	497800	347	359	DAFLGSFLYEYSR	ECO:0000213	PubMed	26495903
P02769	DAIPENLPPLTADFAEDK is a linear peptidic epitope (epitope ID 497806) tested in 5 MHC ligand assays.	IEDB	497806	319	336	DAIPENLPPLTADFAEDK	ECO:0000213	PubMed	26495903
P02769	ELTEFAKTCVADESHAG is a linear peptidic epitope (epitope ID 498625) tested in 1 MHC ligand assay.	IEDB	498625	69	85	ELTEFAKTCVADESHAG	ECO:0000213	PubMed	26495903
P02769	FSALTPDETYVPK is a linear peptidic epitope (epitope ID 498982) tested in 5 MHC ligand assays.	IEDB	498982	511	523	FSALTPDETYVPK	ECO:0000213	PubMed	26495903
P02769	FYAPELLYYANK is a linear peptidic epitope (epitope ID 498993) tested in 3 MHC ligand assays.	IEDB	498993	172	183	FYAPELLYYANK	ECO:0000213	PubMed	26495903
P02769	HKPKATEEQLKTVME is a linear peptidic epitope (epitope ID 499619) tested in 1 MHC ligand assay.	IEDB	499619	558	572	HKPKATEEQLKTVME	ECO:0000213	PubMed	26495903
P02769	HLVDEPQNLIK is a linear peptidic epitope (epitope ID 499632) tested in 22 MHC ligand assays.	IEDB	499632	402	412	HLVDEPQNLIK	ECO:0000213	PubMed	26495903
P02769	HPEYAVSVLLR is a linear peptidic epitope (epitope ID 499663) tested in 5 MHC ligand assays.	IEDB	499663	361	371	HPEYAVSVLLR	ECO:0000213	PubMed	26495903
P02769	IQKFGERALKAWSVAR is a linear peptidic epitope (epitope ID 499944) tested in 1 MHC ligand assay.	IEDB	499944	226	241	IQKFGERALKAWSVAR	ECO:0000213	PubMed	26495903
P02769	KVPQVSTPTLVEVSRS is a linear peptidic epitope (epitope ID 500598) tested in 1 MHC ligand assay.	IEDB	500598	437	452	KVPQVSTPTLVEVSRS	ECO:0000213	PubMed	26495903
P02769	KVPQVSTPTLVEVSRSLG is a linear peptidic epitope (epitope ID 500599) tested in 1 MHC ligand assay.	IEDB	500599	437	454	KVPQVSTPTLVEVSRSLG	ECO:0000213	PubMed	26495903
P02769	LTEFAKTCVADESHAG is a linear peptidic epitope (epitope ID 501065) tested in 1 MHC ligand assay.	IEDB	501065	70	85	LTEFAKTCVADESHAG	ECO:0000213	PubMed	26495903
P02769	LVNELTEFAK is a linear peptidic epitope (epitope ID 501102) tested in 19 MHC ligand assays.	IEDB	501102	66	75	LVNELTEFAK	ECO:0000213	PubMed	26495903
P02769	QTALVELLK is a linear peptidic epitope (epitope ID 501714) tested in 5 MHC ligand assays.	IEDB	501714	549	557	QTALVELLK	ECO:0000213	PubMed	26495903
P02769	RHPEYAVSVLLR is a linear peptidic epitope (epitope ID 501826) tested in 12 MHC ligand assays.	IEDB	501826	360	371	RHPEYAVSVLLR	ECO:0000213	PubMed	26495903
P02769	RKVPQVSTPTLVEVSR is a linear peptidic epitope (epitope ID 501866) tested in 2 MHC ligand assays.	IEDB	501866	436	451	RKVPQVSTPTLVEVSR	ECO:0000213	PubMed	26495903
P02769	RKVPQVSTPTLVEVSRS is a linear peptidic epitope (epitope ID 501867) tested in 1 MHC ligand assay.	IEDB	501867	436	452	RKVPQVSTPTLVEVSRS	ECO:0000213	PubMed	26495903
P02769	RKVPQVSTPTLVEVSRSLG is a linear peptidic epitope (epitope ID 501868) tested in 1 MHC ligand assay.	IEDB	501868	436	454	RKVPQVSTPTLVEVSRSLG	ECO:0000213	PubMed	26495903
P02769	TVMENFVAFVDK is a linear peptidic epitope (epitope ID 503215) tested in 7 MHC ligand assays.	IEDB	503215	569	580	TVMENFVAFVDK	ECO:0000213	PubMed	26495903
P02769	VADESHAGCEKSLH is a linear peptidic epitope (epitope ID 503244) tested in 1 MHC ligand assay.	IEDB	503244	78	91	VADESHAGCEKSLH	ECO:0000213	PubMed	26495903
P02769	VADESHAGCEKSLHT is a linear peptidic epitope (epitope ID 503245) tested in 1 MHC ligand assay.	IEDB	503245	78	92	VADESHAGCEKSLHT	ECO:0000213	PubMed	26495903
P02769	VADESHAGCEKSLHTL is a linear peptidic epitope (epitope ID 503246) tested in 1 MHC ligand assay.	IEDB	503246	78	93	VADESHAGCEKSLHTL	ECO:0000213	PubMed	26495903
P02769	VPQVSTPTLVEVSR is a linear peptidic epitope (epitope ID 503548) tested in 32 MHC ligand assays.	IEDB	503548	438	451	VPQVSTPTLVEVSR	ECO:0000213	PubMed	26495903
P02769	VPQVSTPTLVEVSRS is a linear peptidic epitope (epitope ID 503549) tested in 2 MHC ligand assays.	IEDB	503549	438	452	VPQVSTPTLVEVSRS	ECO:0000213	PubMed	26495903
P02769	VPQVSTPTLVEVSRSL is a linear peptidic epitope (epitope ID 503550) tested in 1 MHC ligand assay.	IEDB	503550	438	453	VPQVSTPTLVEVSRSL	ECO:0000213	PubMed	26495903
P02769	VPQVSTPTLVEVSRSLG is a linear peptidic epitope (epitope ID 503551) tested in 2 MHC ligand assays.	IEDB	503551	438	454	VPQVSTPTLVEVSRSLG	ECO:0000213	PubMed	26495903
P02769	EKLGEYGFQNALIVR is a linear peptidic epitope (epitope ID 843404) tested in 2 MHC ligand assays.	IEDB	843404	419	433	EKLGEYGFQNALIVR	ECO:0000213	PubMed	30573663
P02769	FWGKYLYEIARRHP is a linear peptidic epitope (epitope ID 844005) tested in 3 MHC ligand assays.	IEDB	844005	157	170	FWGKYLYEIARRHP	ECO:0000213	PubMed	30573663
P02769	KLGEYGFQNALIVR is a linear peptidic epitope (epitope ID 846031) tested in 2 MHC ligand assays.	IEDB	846031	420	433	KLGEYGFQNALIVR	ECO:0000213	PubMed	30573663
P02769	LGEYGFQNALIVRYT is a linear peptidic epitope (epitope ID 846704) tested in 3 T cell assays and 2 MHC ligand assays.	IEDB	846704	421	435	LGEYGFQNALIVRYT	ECO:0000213	PubMed	30573663
P02769	IVRYTRKVPQVSTPT is a linear peptidic epitope (epitope ID 1608980) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1608980	431	445	IVRYTRKVPQVSTPT	ECO:0000213	PubMed	37604312
P02769	KFWGKYLYEIARRHP is a linear peptidic epitope (epitope ID 1609842) tested in 5 T cell assays and 2 MHC ligand assays.	IEDB	1609842	156	170	KFWGKYLYEIARRHP	ECO:0000213	PubMed	37604312
P02769	LGEYGFQNALIVRY is a linear peptidic epitope (epitope ID 1872763) tested in 1 MHC ligand assay.	IEDB	1872763	421	434	LGEYGFQNALIVRY	ECO:0000213	PubMed	30573663
P02769	CTEDYLSLILNRLCV is a linear peptidic epitope (epitope ID 2244197) tested in 3 T cell assays.	IEDB	2244197	471	485	CTEDYLSLILNRLCV	ECO:0000213	PubMed	37604312
P02769	DTEKQIKKQTALVEL is a linear peptidic epitope (epitope ID 2244414) tested in 3 T cell assays.	IEDB	2244414	541	555	DTEKQIKKQTALVEL	ECO:0000213	PubMed	37604312
P02769	ERALKAWSVARLSQK is a linear peptidic epitope (epitope ID 2244889) tested in 3 T cell assays.	IEDB	2244889	231	245	ERALKAWSVARLSQK	ECO:0000213	PubMed	37604312
P02769	FQNALIVRYTRKVPQ is a linear peptidic epitope (epitope ID 2245410) tested in 3 T cell assays.	IEDB	2245410	426	440	FQNALIVRYTRKVPQ	ECO:0000213	PubMed	37604312
P02769	LSLILNRLCVLHEKT is a linear peptidic epitope (epitope ID 2246470) tested in 3 T cell assays.	IEDB	2246470	476	490	LSLILNRLCVLHEKT	ECO:0000213	PubMed	37604312
P02769	QLKTVMENFVAFVDK is a linear peptidic epitope (epitope ID 2247128) tested in 3 T cell assays.	IEDB	2247128	566	580	QLKTVMENFVAFVDK	ECO:0000213	PubMed	37604312
P04116	GKWLGHPDK is a linear peptidic epitope (epitope ID 107155) tested in 1 T cell assay and 3 B cell assays.	IEDB	107155	143	151	GKWLGHPDK	ECO:0000213	PubMed	2450106
P04116	NTWTTCQSIAAPSK is a linear peptidic epitope (epitope ID 112245) tested in 35 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	112245	179	192	NTWTTCQSIAAPSK	ECO:0000213	PubMed	7540658
P04116	NTWTTCQSIAAPSK is a linear peptidic epitope (epitope ID 112245) tested in 35 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	112245	179	192	NTWTTCQSIAAPSK	ECO:0000213	PubMed	9130268
P04116	AVLKLMGRGTKF is a linear peptidic epitope (epitope ID 112461) tested in 2 B cell assays.	IEDB	112461	266	277	AVLKLMGRGTKF	ECO:0000213	PubMed	1692031
P04116	FAVLKLMGRGTK is a linear peptidic epitope (epitope ID 112507) tested in 2 B cell assays.	IEDB	112507	265	276	FAVLKLMGRGTK	ECO:0000213	PubMed	1692031
P04116	LPWNAFPGK is a linear peptidic epitope (epitope ID 112584) tested in 12 B cell assays.	IEDB	112584	210	218	LPWNAFPGK	ECO:0000213	PubMed	1717653
P04116	LPWNAFPGK is a linear peptidic epitope (epitope ID 112584) tested in 12 B cell assays.	IEDB	112584	210	218	LPWNAFPGK	ECO:0000213	PubMed	2450106
P04116	NFAVLKLMGRGT is a linear peptidic epitope (epitope ID 112608) tested in 2 B cell assays.	IEDB	112608	264	275	NFAVLKLMGRGT	ECO:0000213	PubMed	1692031
P04116	SICKTAEFQMTF is a linear peptidic epitope (epitope ID 112662) tested in 5 B cell assays.	IEDB	112662	226	237	SICKTAEFQMTF	ECO:0000213	PubMed	2450106
P04116	TAEFQMTFHLFI is a linear peptidic epitope (epitope ID 112672) tested in 1 T cell assay and 5 B cell assays.	IEDB	112672	230	241	TAEFQMTFHLFI	ECO:0000213	PubMed	2450106
P04116	YNFAVLKLMGRG is a linear peptidic epitope (epitope ID 112732) tested in 2 B cell assays.	IEDB	112732	263	274	YNFAVLKLMGRG	ECO:0000213	PubMed	1692031
P04116	FAVLKLMGRGTKF is a linear peptidic epitope (epitope ID 116971) tested in 1 T cell assay and 15 B cell assays.	IEDB	116971	265	277	FAVLKLMGRGTKF	ECO:0000213	PubMed	2450106
P04116	TYFSKNYQDYEY is a linear peptidic epitope (epitope ID 117173) tested in 1 T cell assay and 3 B cell assays.	IEDB	117173	49	60	TYFSKNYQDYEY	ECO:0000213	PubMed	2450106
P04116	CQSIAAPSKTS is a linear peptidic epitope (epitope ID 134021) tested in 2 B cell assays.	IEDB	134021	184	194	CQSIAAPSKTS	ECO:0000213	PubMed	2450106
P04116	GLLECCARC is a linear peptidic epitope (epitope ID 134065) tested in 2 B cell assays.	IEDB	134065	2	10	GLLECCARC	ECO:0000213	PubMed	2450106
P04116	IGTLCADAR is a linear peptidic epitope (epitope ID 134087) tested in 2 B cell assays.	IEDB	134087	197	205	IGTLCADAR	ECO:0000213	PubMed	2450106
P04116	RQIFGDYKT is a linear peptidic epitope (epitope ID 134221) tested in 3 B cell assays.	IEDB	134221	98	106	RQIFGDYKT	ECO:0000213	PubMed	2450106
P04116	TSASIGTLC is a linear peptidic epitope (epitope ID 134242) tested in 2 B cell assays.	IEDB	134242	193	201	TSASIGTLC	ECO:0000213	PubMed	2450106
P04972	ITVICPWEAFNHL is a linear peptidic epitope (epitope ID 122806) tested in 2 T cell assays and 1 B cell assay.	IEDB	122806	64	76	ITVICPWEAFNHL	ECO:0000213	PubMed	11754897
P06394	FNEKSKEL is a linear peptidic epitope (epitope ID 498949) tested in 64 MHC ligand assays.	IEDB	498949	321	328	FNEKSKEL	ECO:0000213	PubMed	26495903
P06624	SRPSESNG is a linear peptidic epitope (epitope ID 122906) tested in 3 B cell assays.	IEDB	122906	240	247	SRPSESNG	ECO:0000213	PubMed	2415383
P06624	TGEPVELK is a linear peptidic epitope (epitope ID 122913) tested in 3 B cell assays.	IEDB	122913	252	259	TGEPVELK	ECO:0000213	PubMed	2415383
P07224	VEELEQSISVKIAKE is a linear peptidic epitope (epitope ID 503336) tested in 1 MHC ligand assay.	IEDB	503336	388	402	VEELEQSISVKIAKE	ECO:0000213	PubMed	26495903
P07224	VEELEQSISVKIAKEA is a linear peptidic epitope (epitope ID 503337) tested in 1 MHC ligand assay.	IEDB	503337	388	403	VEELEQSISVKIAKEA	ECO:0000213	PubMed	26495903
P07224	YDSEGVILYAESSDH is a linear peptidic epitope (epitope ID 503791) tested in 1 MHC ligand assay.	IEDB	503791	332	346	YDSEGVILYAESSDH	ECO:0000213	PubMed	26495903
P08168	NNRERRGIALDG is a linear peptidic epitope (epitope ID 114222) tested in 9 T cell assays.	IEDB	114222	286	297	NNRERRGIALDG	ECO:0000213	PubMed	15969447
P08168	PFRLMHPQPED is a linear peptidic epitope (epitope ID 117160) tested in 3 T cell assays.	IEDB	117160	352	362	PFRLMHPQPED	ECO:0000213	PubMed	1696531
P08168	PFRLMHPQPED is a linear peptidic epitope (epitope ID 117160) tested in 3 T cell assays.	IEDB	117160	352	362	PFRLMHPQPED	ECO:0000213	PubMed	1701801
P08168	PFRLMHPQPEDPD is a linear peptidic epitope (epitope ID 117162) tested in 16 T cell assays.	IEDB	117162	352	364	PFRLMHPQPEDPD	ECO:0000213	PubMed	1343765
P08168	PFRLMHPQPEDPD is a linear peptidic epitope (epitope ID 117162) tested in 16 T cell assays.	IEDB	117162	352	364	PFRLMHPQPEDPD	ECO:0000213	PubMed	1701801
P08168	PFRLMHPQPEDPD is a linear peptidic epitope (epitope ID 117162) tested in 16 T cell assays.	IEDB	117162	352	364	PFRLMHPQPEDPD	ECO:0000213	PubMed	2344622
P08168	ARQNLKDAGE is a linear peptidic epitope (epitope ID 122269) tested in 1 T cell assay and 4 B cell assays.	IEDB	122269	381	390	ARQNLKDAGE	ECO:0000213	PubMed	1723632
P08168	ARQNLKDAGE is a linear peptidic epitope (epitope ID 122269) tested in 1 T cell assay and 4 B cell assays.	IEDB	122269	381	390	ARQNLKDAGE	ECO:0000213	PubMed	2468451
P08168	SFQDENFVFEEF is a linear peptidic epitope (epitope ID 122569) tested in 1 T cell assay and 6 B cell assays.	IEDB	122569	369	380	SFQDENFVFEEF	ECO:0000213	PubMed	2478582
P08168	EVATEVPFRLM is a linear peptidic epitope (epitope ID 122759) tested in 2 T cell assays.	IEDB	122759	346	356	EVATEVPFRLM	ECO:0000213	PubMed	7693817
P08168	PVTVAVTNST is a linear peptidic epitope (epitope ID 122877) tested in 1 B cell assay.	IEDB	122877	221	230	PVTVAVTNST	ECO:0000213	PubMed	2444731
P08168	VATEVPFRL is a linear peptidic epitope (epitope ID 122931) tested in 1 T cell assay and 1 B cell assay.	IEDB	122931	347	355	VATEVPFRL	ECO:0000213	PubMed	7693817
P08168	EVATEVP is a linear peptidic epitope (epitope ID 123155) tested in 1 T cell assay.	IEDB	123155	346	352	EVATEVP	ECO:0000213	PubMed	8495487
P08168	HEDTNLA is a linear peptidic epitope (epitope ID 123288) tested in 1 T cell assay.	IEDB	123288	301	307	HEDTNLA	ECO:0000213	PubMed	8495487
P08168	DGVVLVD is a linear peptidic epitope (epitope ID 124008) tested in 11 B cell assays.	IEDB	124008	42	48	DGVVLVD	ECO:0000213	PubMed	1379981
P08168	DGVVLVD is a linear peptidic epitope (epitope ID 124008) tested in 11 B cell assays.	IEDB	124008	42	48	DGVVLVD	ECO:0000213	PubMed	1723632
P08168	DGVVLVD is a linear peptidic epitope (epitope ID 124008) tested in 11 B cell assays.	IEDB	124008	42	48	DGVVLVD	ECO:0000213	PubMed	2478582
P08168	DKTVMGILVSYQ is a linear peptidic epitope (epitope ID 124017) tested in 4 T cell assays.	IEDB	124017	317	328	DKTVMGILVSYQ	ECO:0000213	PubMed	1696531
P08168	DKTVMGILVSYQ is a linear peptidic epitope (epitope ID 124017) tested in 4 T cell assays.	IEDB	124017	317	328	DKTVMGILVSYQ	ECO:0000213	PubMed	1712808
P08168	DKTVMGILVSYQ is a linear peptidic epitope (epitope ID 124017) tested in 4 T cell assays.	IEDB	124017	317	328	DKTVMGILVSYQ	ECO:0000213	PubMed	2790968
P08168	PEDPDTAKESF is a linear peptidic epitope (epitope ID 125189) tested in 4 B cell assays.	IEDB	125189	360	370	PEDPDTAKESF	ECO:0000213	PubMed	2468451
P08168	RERRGIAL is a linear peptidic epitope (epitope ID 125230) tested in 3 B cell assays.	IEDB	125230	288	295	RERRGIAL	ECO:0000213	PubMed	2468451
P08168	FVFEEFARQNLK is a linear peptidic epitope (epitope ID 126069) tested in 1 B cell assay.	IEDB	126069	375	386	FVFEEFARQNLK	ECO:0000213	PubMed	1723632
P08168	NLASSTIIKE is a linear peptidic epitope (epitope ID 126761) tested in 2 B cell assays.	IEDB	126761	305	314	NLASSTIIKE	ECO:0000213	PubMed	1723632
P08168	NLASSTIIKE is a linear peptidic epitope (epitope ID 126761) tested in 2 B cell assays.	IEDB	126761	305	314	NLASSTIIKE	ECO:0000213	PubMed	1692780
P08168	RERRGIALD is a linear peptidic epitope (epitope ID 126921) tested in 1 B cell assay.	IEDB	126921	288	296	RERRGIALD	ECO:0000213	PubMed	1723632
P08168	TEVPFRLM is a linear peptidic epitope (epitope ID 127196) tested in 1 B cell assay.	IEDB	127196	349	356	TEVPFRLM	ECO:0000213	PubMed	1723632
P08168	TEVPFRLMHPQPEDPDTAKESFQ is a linear peptidic epitope (epitope ID 127197) tested in 1 B cell assay.	IEDB	127197	349	371	TEVPFRLMHPQPEDPDTAKESFQ	ECO:0000213	PubMed	1723632
P08168	LASSTIIKE is a linear peptidic epitope (epitope ID 129208) tested in 2 B cell assays.	IEDB	129208	306	314	LASSTIIKE	ECO:0000213	PubMed	1692780
P08168	PVDGVVLVD is a linear peptidic epitope (epitope ID 129661) tested in 2 B cell assays and 1 MHC ligand assay.	IEDB	129661	40	48	PVDGVVLVD	ECO:0000213	PubMed	1692780
P08168	STIIKEGI is a linear peptidic epitope (epitope ID 130019) tested in 6 B cell assays.	IEDB	130019	309	316	STIIKEGI	ECO:0000213	PubMed	2478582
P08168	TEVPFRL is a linear peptidic epitope (epitope ID 130063) tested in 6 B cell assays.	IEDB	130063	349	355	TEVPFRL	ECO:0000213	PubMed	2478582
P08239	ERSKAIEKNL is a linear peptidic epitope (epitope ID 840829) tested in 3 B cell assays.	IEDB	840829	14	23	ERSKAIEKNL	ECO:0000213	PubMed	8654559
P0CB32	TPSYVAFTDTERLIG is a linear peptidic epitope (epitope ID 147341) tested in 7 T cell assays and 87 MHC ligand assays.	IEDB	147341	40	54	TPSYVAFTDTERLIG	ECO:0000213	PubMed	30573663
P10123	QLERLTTKDHG is a linear peptidic epitope (epitope ID 2268045) tested in 1 B cell assay.	IEDB	2268045	21	31	QLERLTTKDHG	ECO:0000213	PubMed	1715867
P10279	DYEDRYYRE is a linear peptidic epitope (epitope ID 10868) tested in 39 B cell assays.	IEDB	10868	155	163	DYEDRYYRE	ECO:0000213	PubMed	17270205
P10279	DYEDRYYRE is a linear peptidic epitope (epitope ID 10868) tested in 39 B cell assays.	IEDB	10868	155	163	DYEDRYYRE	ECO:0000213	PubMed	17896076
P10279	DYEDRYYRE is a linear peptidic epitope (epitope ID 10868) tested in 39 B cell assays.	IEDB	10868	155	163	DYEDRYYRE	ECO:0000213	PubMed	9363892
P10279	QVYYRPVDQ is a linear peptidic epitope (epitope ID 52825) tested in 4 B cell assays.	IEDB	52825	171	179	QVYYRPVDQ	ECO:0000213	PubMed	14687883
P10279	THGQWNKPSK is a linear peptidic epitope (epitope ID 64031) tested in 14 B cell assays and has 3D structure(s) 2hh0.	IEDB	64031	106	115	THGQWNKPSK	ECO:0000213	PubMed	16962610
P10279	NQVYYRPVDQYS is a linear peptidic epitope (epitope ID 175625) tested in 12 B cell assays.	IEDB	175625	170	181	NQVYYRPVDQYS	ECO:0000213	PubMed	23098297
P10522	GLGESRK is a linear peptidic epitope (epitope ID 116731) tested in 8 B cell assays.	IEDB	116731	239	245	GLGESRK	ECO:0000213	PubMed	8808799
P10575	DYLQQLTGARTVP is a linear peptidic epitope (epitope ID 531374) tested in 10 MHC ligand assays.	IEDB	531374	59	71	DYLQQLTGARTVP	ECO:0000213	PubMed	30573663
P10575	DYLQQLTGARTVPR is a linear peptidic epitope (epitope ID 531375) tested in 16 MHC ligand assays.	IEDB	531375	59	72	DYLQQLTGARTVPR	ECO:0000213	PubMed	30573663
P10575	IQDYLQQLTGARTVP is a linear peptidic epitope (epitope ID 532290) tested in 16 MHC ligand assays.	IEDB	532290	57	71	IQDYLQQLTGARTVP	ECO:0000213	PubMed	30573663
P10575	QDYLQQLTGARTVPR is a linear peptidic epitope (epitope ID 533336) tested in 13 MHC ligand assays.	IEDB	533336	58	72	QDYLQQLTGARTVPR	ECO:0000213	PubMed	30573663
P11179	IETDKTSVQV is a linear peptidic epitope (epitope ID 136066) tested in 7 B cell assays.	IEDB	136066	107	116	IETDKTSVQV	ECO:0000213	PubMed	1282029
P12661	GECWLGGGVVPDA is a linear peptidic epitope (epitope ID 121318) tested in 13 T cell assays, 2 B cell assays and 2 MHC ligand assays.	IEDB	121318	601	613	GECWLGGGVVPDA	ECO:0000213	PubMed	7514128
P12661	GECWLGGGVVPDA is a linear peptidic epitope (epitope ID 121318) tested in 13 T cell assays, 2 B cell assays and 2 MHC ligand assays.	IEDB	121318	601	613	GECWLGGGVVPDA	ECO:0000213	PubMed	8050169
P12661	ADGSSWEGVGVVPDV is a linear peptidic epitope (epitope ID 122072) tested in 55 T cell assays.	IEDB	122072	1199	1213	ADGSSWEGVGVVPDV	ECO:0000213	PubMed	14568955
P12661	ADGSSWEGVGVVPDV is a linear peptidic epitope (epitope ID 122072) tested in 55 T cell assays.	IEDB	122072	1199	1213	ADGSSWEGVGVVPDV	ECO:0000213	PubMed	14607971
P12661	ADGSSWEGVGVVPDV is a linear peptidic epitope (epitope ID 122072) tested in 55 T cell assays.	IEDB	122072	1199	1213	ADGSSWEGVGVVPDV	ECO:0000213	PubMed	19234216
P12661	ADGSSWEGVGVVPDV is a linear peptidic epitope (epitope ID 122072) tested in 55 T cell assays.	IEDB	122072	1199	1213	ADGSSWEGVGVVPDV	ECO:0000213	PubMed	8242769
P12661	AALTRAQEMLQHT is a linear peptidic epitope (epitope ID 122251) tested in 7 T cell assays and 1 B cell assay.	IEDB	122251	1219	1231	AALTRAQEMLQHT	ECO:0000213	PubMed	2477180
P12661	SHRTATAAEELA is a linear peptidic epitope (epitope ID 122577) tested in 19 T cell assays and 2 B cell assays.	IEDB	122577	540	551	SHRTATAAEELA	ECO:0000213	PubMed	11359436
P12661	SHRTATAAEELA is a linear peptidic epitope (epitope ID 122577) tested in 19 T cell assays and 2 B cell assays.	IEDB	122577	540	551	SHRTATAAEELA	ECO:0000213	PubMed	9603463
P12661	SQTWEGSGVLPCV is a linear peptidic epitope (epitope ID 122585) tested in 14 T cell assays and 2 B cell assays.	IEDB	122585	293	305	SQTWEGSGVLPCV	ECO:0000213	PubMed	1690082
P12661	SQTWEGSGVLPCV is a linear peptidic epitope (epitope ID 122585) tested in 14 T cell assays and 2 B cell assays.	IEDB	122585	293	305	SQTWEGSGVLPCV	ECO:0000213	PubMed	1694880
P12661	SQTWEGSGVLPCV is a linear peptidic epitope (epitope ID 122585) tested in 14 T cell assays and 2 B cell assays.	IEDB	122585	293	305	SQTWEGSGVLPCV	ECO:0000213	PubMed	8050169
P12661	GVGVVPDV is a linear peptidic epitope (epitope ID 122784) tested in 4 T cell assays.	IEDB	122784	1206	1213	GVGVVPDV	ECO:0000213	PubMed	1371240
P12661	SWEGVGVVPDV is a linear peptidic epitope (epitope ID 122909) tested in 21 T cell assays and 3 MHC ligand assays.	IEDB	122909	1203	1213	SWEGVGVVPDV	ECO:0000213	PubMed	7516403
P12661	SWEGVGVVPDV is a linear peptidic epitope (epitope ID 122909) tested in 21 T cell assays and 3 MHC ligand assays.	IEDB	122909	1203	1213	SWEGVGVVPDV	ECO:0000213	PubMed	14568955
P12661	SWEGVGVVPDV is a linear peptidic epitope (epitope ID 122909) tested in 21 T cell assays and 3 MHC ligand assays.	IEDB	122909	1203	1213	SWEGVGVVPDV	ECO:0000213	PubMed	1707928
P12661	SWEGVGVVPDV is a linear peptidic epitope (epitope ID 122909) tested in 21 T cell assays and 3 MHC ligand assays.	IEDB	122909	1203	1213	SWEGVGVVPDV	ECO:0000213	PubMed	2471769
P12661	SWEGVGVVPDV is a linear peptidic epitope (epitope ID 122909) tested in 21 T cell assays and 3 MHC ligand assays.	IEDB	122909	1203	1213	SWEGVGVVPDV	ECO:0000213	PubMed	9126974
P12661	WEGVGVVPDV is a linear peptidic epitope (epitope ID 122944) tested in 6 T cell assays and 2 B cell assays.	IEDB	122944	1204	1213	WEGVGVVPDV	ECO:0000213	PubMed	8050169
P12661	WEGVGVVPDV is a linear peptidic epitope (epitope ID 122944) tested in 6 T cell assays and 2 B cell assays.	IEDB	122944	1204	1213	WEGVGVVPDV	ECO:0000213	PubMed	1371240
P12661	GEAWDLAGVEPDI is a linear peptidic epitope (epitope ID 123216) tested in 10 T cell assays and 2 B cell assays.	IEDB	123216	902	914	GEAWDLAGVEPDI	ECO:0000213	PubMed	1690082
P12661	GEAWDLAGVEPDI is a linear peptidic epitope (epitope ID 123216) tested in 10 T cell assays and 2 B cell assays.	IEDB	123216	902	914	GEAWDLAGVEPDI	ECO:0000213	PubMed	1694880
P12661	GEAWDLAGVEPDI is a linear peptidic epitope (epitope ID 123216) tested in 10 T cell assays and 2 B cell assays.	IEDB	123216	902	914	GEAWDLAGVEPDI	ECO:0000213	PubMed	8050169
P12661	GSSWEGVGVVPDV is a linear peptidic epitope (epitope ID 123268) tested in 15 T cell assays and 2 B cell assays.	IEDB	123268	1201	1213	GSSWEGVGVVPDV	ECO:0000213	PubMed	8050169
P12661	GSSWEGVGVVPDV is a linear peptidic epitope (epitope ID 123268) tested in 15 T cell assays and 2 B cell assays.	IEDB	123268	1201	1213	GSSWEGVGVVPDV	ECO:0000213	PubMed	1690082
P12661	GSSWEGVGVVPDV is a linear peptidic epitope (epitope ID 123268) tested in 15 T cell assays and 2 B cell assays.	IEDB	123268	1201	1213	GSSWEGVGVVPDV	ECO:0000213	PubMed	1694880
P12661	WEGVGVVPDVAVP is a linear peptidic epitope (epitope ID 123841) tested in 12 T cell assays and 2 B cell assays.	IEDB	123841	1204	1216	WEGVGVVPDVAVP	ECO:0000213	PubMed	8050169
P12661	WEGVGVVPDVAVP is a linear peptidic epitope (epitope ID 123841) tested in 12 T cell assays and 2 B cell assays.	IEDB	123841	1204	1216	WEGVGVVPDVAVP	ECO:0000213	PubMed	9603463
P12661	GSSWEGVGVVPD is a linear peptidic epitope (epitope ID 124236) tested in 2 T cell assays.	IEDB	124236	1201	1212	GSSWEGVGVVPD	ECO:0000213	PubMed	1709661
P12661	TWEGSGVLPCV is a linear peptidic epitope (epitope ID 125588) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	125588	295	305	TWEGSGVLPCV	ECO:0000213	PubMed	7516403
P12763	IPGGPVRLCPGRIR is a linear peptidic epitope (epitope ID 143412) tested in 1 T cell assay and 2 MHC ligand assays.	IEDB	143412	342	355	IPGGPVRLCPGRIR	ECO:0000213	PubMed	8746565
P12763	DSRVVHAVEVALATFN is a linear peptidic epitope (epitope ID 143679) tested in 2 MHC ligand assays.	IEDB	143679	157	172	DSRVVHAVEVALATFN	ECO:0000213	PubMed	16393994
P12763	YKHTLNQIDSVKVWPRRP is a linear peptidic epitope (epitope ID 234343) tested in 5 MHC ligand assays.	IEDB	234343	56	73	YKHTLNQIDSVKVWPRRP	ECO:0000213	PubMed	1380674
P12763	YKHTLNQIDSVKVWPRRPT is a linear peptidic epitope (epitope ID 234344) tested in 6 MHC ligand assays.	IEDB	234344	56	74	YKHTLNQIDSVKVWPRRPT	ECO:0000213	PubMed	1380674
P12763	DSRVVHAVEVALATF is a linear peptidic epitope (epitope ID 237683) tested in 1 MHC ligand assay.	IEDB	237683	157	171	DSRVVHAVEVALATF	ECO:0000213	PubMed	11801660
P12763	DPDTEQAALAAVDYINK is a linear peptidic epitope (epitope ID 241677) tested in 1 MHC ligand assay.	IEDB	241677	34	50	DPDTEQAALAAVDYINK	ECO:0000213	PubMed	16075062
P12763	IDSVKVWPRRPTGEVYDI is a linear peptidic epitope (epitope ID 243959) tested in 1 MHC ligand assay.	IEDB	243959	63	80	IDSVKVWPRRPTGEVYDI	ECO:0000213	PubMed	8606061
P12763	LNQIDSVKVW is a linear peptidic epitope (epitope ID 419008) tested in 1 MHC ligand assay.	IEDB	419008	60	69	LNQIDSVKVW	ECO:0000213	PubMed	8119729
P12763	DLRHTFSGVASVESSSGEA is a linear peptidic epitope (epitope ID 423252) tested in 3 MHC ligand assays.	IEDB	423252	310	328	DLRHTFSGVASVESSSGEA	ECO:0000213	PubMed	15240697
P12763	GKTPIVGQPSIPGGPVR is a linear peptidic epitope (epitope ID 423316) tested in 4 MHC ligand assays.	IEDB	423316	332	348	GKTPIVGQPSIPGGPVR	ECO:0000213	PubMed	15240697
P12763	ISRAQFVPLPVSVSVE is a linear peptidic epitope (epitope ID 423364) tested in 4 MHC ligand assays.	IEDB	423364	185	200	ISRAQFVPLPVSVSVE	ECO:0000213	PubMed	15240697
P12763	SGEAFHVGKTPIVGQPS is a linear peptidic epitope (epitope ID 423507) tested in 1 MHC ligand assay.	IEDB	423507	325	341	SGEAFHVGKTPIVGQPS	ECO:0000213	PubMed	15240697
P12763	VGKTPIVGQPSIPGGPVR is a linear peptidic epitope (epitope ID 423574) tested in 4 MHC ligand assays.	IEDB	423574	331	348	VGKTPIVGQPSIPGGPVR	ECO:0000213	PubMed	15240697
P12763	TPIVGQPSIPGGPVR is a linear peptidic epitope (epitope ID 684773) tested in 18 MHC ligand assays.	IEDB	684773	334	348	TPIVGQPSIPGGPVR	ECO:0000213	PubMed	30573663
P12763	HTLNQIDSVKVWPR is a linear peptidic epitope (epitope ID 845048) tested in 4 MHC ligand assays.	IEDB	845048	58	71	HTLNQIDSVKVWPR	ECO:0000213	PubMed	30573663
P12763	KHTLNQIDSVKVWPR is a linear peptidic epitope (epitope ID 845920) tested in 5 MHC ligand assays.	IEDB	845920	57	71	KHTLNQIDSVKVWPR	ECO:0000213	PubMed	30573663
P12763	RAQFVPLPVSVSVE is a linear peptidic epitope (epitope ID 848002) tested in 3 MHC ligand assays.	IEDB	848002	187	200	RAQFVPLPVSVSVE	ECO:0000213	PubMed	30573663
P12763	SRAQFVPLPVSVSVE is a linear peptidic epitope (epitope ID 849137) tested in 3 MHC ligand assays.	IEDB	849137	186	200	SRAQFVPLPVSVSVE	ECO:0000213	PubMed	30573663
P12763	KTPIVGQPSIPGGP is a linear peptidic epitope (epitope ID 1611440) tested in 2 MHC ligand assays.	IEDB	1611440	333	346	KTPIVGQPSIPGGP	ECO:0000213	PubMed	30573663
P12763	KTPIVGQPSIPGGPV is a linear peptidic epitope (epitope ID 1611441) tested in 5 MHC ligand assays.	IEDB	1611441	333	347	KTPIVGQPSIPGGPV	ECO:0000213	PubMed	30573663
P12763	RHTFSGVASVESSSG is a linear peptidic epitope (epitope ID 1617472) tested in 2 MHC ligand assays.	IEDB	1617472	312	326	RHTFSGVASVESSSG	ECO:0000213	PubMed	30573663
P12763	RAQFVPLPVSVSVEF is a linear peptidic epitope (epitope ID 1873272) tested in 1 MHC ligand assay.	IEDB	1873272	187	201	RAQFVPLPVSVSVEF	ECO:0000213	PubMed	30573663
P13608	ATEGRVRVNSAYQDK is a linear peptidic epitope (epitope ID 107090) tested in 60 T cell assays, 1 B cell assay and 6 MHC ligand assays.	IEDB	107090	89	103	ATEGRVRVNSAYQDK	ECO:0000213	PubMed	24843873
P15497	RQRLTARLEALKEGGG is a linear peptidic epitope (epitope ID 237915) tested in 2 MHC ligand assays.	IEDB	237915	194	209	RQRLTARLEALKEGGG	ECO:0000213	PubMed	11801660
P15497	SGRDYVAQFEASALG is a linear peptidic epitope (epitope ID 848802) tested in 2 MHC ligand assays.	IEDB	848802	48	62	SGRDYVAQFEASALG	ECO:0000213	PubMed	30573663
P17697	ALKEVKQIKTQIEQTN is a linear peptidic epitope (epitope ID 237635) tested in 1 MHC ligand assay.	IEDB	237635	43	58	ALKEVKQIKTQIEQTN	ECO:0000213	PubMed	11801660
P17697	ALKEVKQIKTQIEQ is a linear peptidic epitope (epitope ID 497371) tested in 1 MHC ligand assay.	IEDB	497371	43	56	ALKEVKQIKTQIEQ	ECO:0000213	PubMed	26495903
P19034	LTQVQESLLGYWDTAK is a linear peptidic epitope (epitope ID 241932) tested in 1 MHC ligand assay.	IEDB	241932	37	52	LTQVQESLLGYWDTAK	ECO:0000213	PubMed	16075062
P19035	TAKDALSSVQESQVAQQARDW is a linear peptidic epitope (epitope ID 143771) tested in 2 MHC ligand assays.	IEDB	143771	42	62	TAKDALSSVQESQVAQQARDW	ECO:0000213	PubMed	16393994
P21457	YAQHVFRSFDANSDG is a linear peptidic epitope (epitope ID 123855) tested in 1 T cell assay.	IEDB	123855	65	79	YAQHVFRSFDANSDG	ECO:0000213	PubMed	11462170
P25326	TGKLVSLSAQNLVD is a linear peptidic epitope (epitope ID 153057) tested in 82 MHC ligand assays.	IEDB	153057	156	169	TGKLVSLSAQNLVD	ECO:0000213	PubMed	30573663
P25326	KLVSLSAQNLVD is a linear peptidic epitope (epitope ID 520063) tested in 13 MHC ligand assays.	IEDB	520063	158	169	KLVSLSAQNLVD	ECO:0000213	PubMed	30573663
P25326	TGKLVSLSAQNL is a linear peptidic epitope (epitope ID 527433) tested in 18 MHC ligand assays.	IEDB	527433	156	167	TGKLVSLSAQNL	ECO:0000213	PubMed	30573663
P25326	KTGKLVSLSAQNLVD is a linear peptidic epitope (epitope ID 646165) tested in 68 MHC ligand assays.	IEDB	646165	155	169	KTGKLVSLSAQNLVD	ECO:0000213	PubMed	30573663
P25326	GKLVSLSAQNLVD is a linear peptidic epitope (epitope ID 690449) tested in 19 MHC ligand assays.	IEDB	690449	157	169	GKLVSLSAQNLVD	ECO:0000213	PubMed	30573663
P25326	KTGKLVSLSAQNLV is a linear peptidic epitope (epitope ID 691220) tested in 28 MHC ligand assays.	IEDB	691220	155	168	KTGKLVSLSAQNLV	ECO:0000213	PubMed	30573663
P25326	KTGKLVSLSAQNL is a linear peptidic epitope (epitope ID 1105855) tested in 34 MHC ligand assays.	IEDB	1105855	155	167	KTGKLVSLSAQNL	ECO:0000213	PubMed	30573663
P29172	GDRSGYSS is a linear peptidic epitope (epitope ID 105209) tested in 2 B cell assays.	IEDB	105209	199	206	GDRSGYSS	ECO:0000213	PubMed	8455212
P31404	IKEKFSMVQVWPVRQ is a linear peptidic epitope (epitope ID 1872320) tested in 1 MHC ligand assay.	IEDB	1872320	199	213	IKEKFSMVQVWPVRQ	ECO:0000213	PubMed	30573663
P34955	YDRNTKSPLFVGKV is a linear peptidic epitope (epitope ID 143590) tested in 1 T cell assay and 2 MHC ligand assays.	IEDB	143590	397	410	YDRNTKSPLFVGKV	ECO:0000213	PubMed	8746565
P34955	YDRNTKSPLFVGKV is a linear peptidic epitope (epitope ID 143590) tested in 1 T cell assay and 2 MHC ligand assays.	IEDB	143590	397	410	YDRNTKSPLFVGKV	ECO:0000213	PubMed	19801983
P34955	SPVSIASAFAMLSLGAK is a linear peptidic epitope (epitope ID 143767) tested in 3 MHC ligand assays.	IEDB	143767	75	91	SPVSIASAFAMLSLGAK	ECO:0000213	PubMed	16393994
P34955	VDTFLEDVKNLYHSEA is a linear peptidic epitope (epitope ID 224282) tested in 4 MHC ligand assays.	IEDB	224282	149	164	VDTFLEDVKNLYHSEA	ECO:0000213	PubMed	8268130
P34955	LPPDVEFNRPFL is a linear peptidic epitope (epitope ID 423415) tested in 1 MHC ligand assay.	IEDB	423415	382	393	LPPDVEFNRPFL	ECO:0000213	PubMed	15240697
P34955	YDRNTKSPLFVGKVVNPTQA is a linear peptidic epitope (epitope ID 423602) tested in 5 MHC ligand assays.	IEDB	423602	397	416	YDRNTKSPLFVGKVVNPTQA	ECO:0000213	PubMed	15240697
P34955	GITKEQPLKVSKALH is a linear peptidic epitope (epitope ID 499163) tested in 1 MHC ligand assay.	IEDB	499163	342	356	GITKEQPLKVSKALH	ECO:0000213	PubMed	26495903
P40682	TAALTAVRPSRVA is a linear peptidic epitope (epitope ID 527168) tested in 3 MHC ligand assays.	IEDB	527168	215	227	TAALTAVRPSRVA	ECO:0000213	PubMed	30573663
P41361	GLEDLFSPEK is a linear peptidic epitope (epitope ID 747210) tested in 1 B cell assay.	IEDB	747210	372	381	GLEDLFSPEK	ECO:0000213	PubMed	8756699
P45478	FGFYRSGQAKETIP is a linear peptidic epitope (epitope ID 515735) tested in 15 MHC ligand assays.	IEDB	515735	244	257	FGFYRSGQAKETIP	ECO:0000213	PubMed	30573663
P45478	FGFYRSGQAKETIPL is a linear peptidic epitope (epitope ID 515736) tested in 19 MHC ligand assays.	IEDB	515736	244	258	FGFYRSGQAKETIPL	ECO:0000213	PubMed	30573663
P49907	TYVEDSIKTVYCEDK is a linear peptidic epitope (epitope ID 503239) tested in 1 MHC ligand assay.	IEDB	503239	157	171	TYVEDSIKTVYCEDK	ECO:0000213	PubMed	26495903
P49907	YVEDSIKTVYCEDK is a linear peptidic epitope (epitope ID 503931) tested in 1 MHC ligand assay.	IEDB	503931	158	171	YVEDSIKTVYCEDK	ECO:0000213	PubMed	26495903
P50448	FVILVPQTVKH is a linear peptidic epitope (epitope ID 843994) tested in 2 MHC ligand assays.	IEDB	843994	329	339	FVILVPQTVKH	ECO:0000213	PubMed	30573663
P50448	DSEIRSAEAVLGEAL is a linear peptidic epitope (epitope ID 1601299) tested in 2 MHC ligand assays.	IEDB	1601299	106	120	DSEIRSAEAVLGEAL	ECO:0000213	PubMed	30573663
P50448	FVILVPQTVKHH is a linear peptidic epitope (epitope ID 1871827) tested in 1 MHC ligand assay.	IEDB	1871827	329	340	FVILVPQTVKHH	ECO:0000213	PubMed	30573663
P53793	GSEHFIGLAGSGAAS is a linear peptidic epitope (epitope ID 644102) tested in 3 MHC ligand assays.	IEDB	644102	61	75	GSEHFIGLAGSGAAS	ECO:0000213	PubMed	30573663
P56652	KAREEHTVPERSTSII is a linear peptidic epitope (epitope ID 500070) tested in 1 MHC ligand assay.	IEDB	500070	375	390	KAREEHTVPERSTSII	ECO:0000213	PubMed	26495903
P61823	PVNTFVHESLADVQA is a linear peptidic epitope (epitope ID 108593) tested in 2 T cell assays.	IEDB	108593	68	82	PVNTFVHESLADVQA	ECO:0000213	PubMed	10820257
P61823	PVNTFVHESLADVQA is a linear peptidic epitope (epitope ID 108593) tested in 2 T cell assays.	IEDB	108593	68	82	PVNTFVHESLADVQA	ECO:0000213	PubMed	11238647
P61823	VNTFVHESLADVQA is a linear peptidic epitope (epitope ID 124828) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	124828	69	82	VNTFVHESLADVQA	ECO:0000213	PubMed	2265605
P62248	RPGAFKAELSKLVIV is a linear peptidic epitope (epitope ID 533543) tested in 5 MHC ligand assays.	IEDB	533543	152	166	RPGAFKAELSKLVIV	ECO:0000213	PubMed	30573663
P62803	GITKPAIRRLARRGG is a linear peptidic epitope (epitope ID 117295) tested in 7 T cell assays, 5 B cell assays and 1 MHC ligand assay.	IEDB	117295	29	43	GITKPAIRRLARRGG	ECO:0000213	PubMed	10878337
P62803	YALKRQGRTLYG is a linear peptidic epitope (epitope ID 117403) tested in 78 T cell assays, 14 B cell assays and 1 MHC ligand assay.	IEDB	117403	89	100	YALKRQGRTLYG	ECO:0000213	PubMed	10878337
P62803	YALKRQGRTLYGFG is a linear peptidic epitope (epitope ID 117404) tested in 3 T cell assays.	IEDB	117404	89	102	YALKRQGRTLYGFG	ECO:0000213	PubMed	10878337
P68103	RYEEIVKEVSTYIKK is a linear peptidic epitope (epitope ID 533607) tested in 11 MHC ligand assays.	IEDB	533607	166	180	RYEEIVKEVSTYIKK	ECO:0000213	PubMed	30573663
P68103	YEEIVKEVSTYIKK is a linear peptidic epitope (epitope ID 534504) tested in 5 MHC ligand assays.	IEDB	534504	167	180	YEEIVKEVSTYIKK	ECO:0000213	PubMed	30573663
P80109	SKEKNQVIIAAGRSS is a linear peptidic epitope (epitope ID 502346) tested in 1 MHC ligand assay.	IEDB	502346	808	822	SKEKNQVIIAAGRSS	ECO:0000213	PubMed	26495903
P80195	NTVKETIKYLKSLFS is a linear peptidic epitope (epitope ID 2246861) tested in 3 T cell assays.	IEDB	2246861	131	145	NTVKETIKYLKSLFS	ECO:0000213	PubMed	37604312
P80195	TIKYLKSLFSHAFEVVKT is a linear peptidic epitope (epitope ID 2247932) tested in 3 T cell assays.	IEDB	2247932	136	153	TIKYLKSLFSHAFEVVKT	ECO:0000213	PubMed	37604312
P81125	AGNAFKKADPQEAIN is a linear peptidic epitope (epitope ID 497269) tested in 6 MHC ligand assays.	IEDB	497269	88	102	AGNAFKKADPQEAIN	ECO:0000213	PubMed	30573663
P81125	ANMFKMAKNWSAAG is a linear peptidic epitope (epitope ID 640466) tested in 5 MHC ligand assays.	IEDB	640466	49	62	ANMFKMAKNWSAAG	ECO:0000213	PubMed	30573663
P81126	ANMFKMAKNWSAAGN is a linear peptidic epitope (epitope ID 640467) tested in 3 MHC ligand assays.	IEDB	640467	49	63	ANMFKMAKNWSAAGN	ECO:0000213	PubMed	30573663
P81644	GSELQTQAKAYFEKTQ is a linear peptidic epitope (epitope ID 237741) tested in 6 MHC ligand assays.	IEDB	237741	54	69	GSELQTQAKAYFEKTQ	ECO:0000213	PubMed	11801660
P81644	GSELQTQAKAYFEKTQ is a linear peptidic epitope (epitope ID 237741) tested in 6 MHC ligand assays.	IEDB	237741	54	69	GSELQTQAKAYFEKTQ	ECO:0000213	PubMed	16075062
P81644	RQAEESNLQSLVSQ is a linear peptidic epitope (epitope ID 501949) tested in 1 MHC ligand assay.	IEDB	501949	23	36	RQAEESNLQSLVSQ	ECO:0000213	PubMed	26495903
Q03247	EETMKEVKAYKEE is a linear peptidic epitope (epitope ID 241701) tested in 2 MHC ligand assays.	IEDB	241701	82	94	EETMKEVKAYKEE	ECO:0000213	PubMed	26495903
Q03247	EETMKEVKAYKEE is a linear peptidic epitope (epitope ID 241701) tested in 2 MHC ligand assays.	IEDB	241701	82	94	EETMKEVKAYKEE	ECO:0000213	PubMed	16075062
Q03247	AEAWRQKLHGRLE is a linear peptidic epitope (epitope ID 497199) tested in 1 MHC ligand assay.	IEDB	497199	224	236	AEAWRQKLHGRLE	ECO:0000213	PubMed	26495903
Q03247	ARVSKELQAAQAR is a linear peptidic epitope (epitope ID 497633) tested in 1 MHC ligand assay.	IEDB	497633	108	120	ARVSKELQAAQAR	ECO:0000213	PubMed	26495903
Q03247	ARVSKELQAAQARL is a linear peptidic epitope (epitope ID 497634) tested in 1 MHC ligand assay.	IEDB	497634	108	121	ARVSKELQAAQARL	ECO:0000213	PubMed	26495903
Q03247	ARVSKELQAAQARLG is a linear peptidic epitope (epitope ID 497635) tested in 1 MHC ligand assay.	IEDB	497635	108	122	ARVSKELQAAQARLG	ECO:0000213	PubMed	26495903
Q03247	ARVSKELQAAQARLGS is a linear peptidic epitope (epitope ID 497636) tested in 1 MHC ligand assay.	IEDB	497636	108	123	ARVSKELQAAQARLGS	ECO:0000213	PubMed	26495903
Q03247	EEQGNQMRLQAEAFQAR is a linear peptidic epitope (epitope ID 498440) tested in 1 MHC ligand assay.	IEDB	498440	261	277	EEQGNQMRLQAEAFQAR	ECO:0000213	PubMed	26495903
Q03247	EETMKEVKAYKEELE is a linear peptidic epitope (epitope ID 498453) tested in 1 MHC ligand assay.	IEDB	498453	82	96	EETMKEVKAYKEELE	ECO:0000213	PubMed	26495903
Q03247	EQGNQMRLQAEAFQ is a linear peptidic epitope (epitope ID 498724) tested in 1 MHC ligand assay.	IEDB	498724	262	275	EQGNQMRLQAEAFQ	ECO:0000213	PubMed	26495903
Q03247	EQGNQMRLQAEAFQAR is a linear peptidic epitope (epitope ID 498725) tested in 1 MHC ligand assay.	IEDB	498725	262	277	EQGNQMRLQAEAFQAR	ECO:0000213	PubMed	26495903
Q03247	EQGQSRAATLSTLAGQP is a linear peptidic epitope (epitope ID 498726) tested in 1 MHC ligand assay.	IEDB	498726	203	219	EQGQSRAATLSTLAGQP	ECO:0000213	PubMed	26495903
Q03247	ETMKEVKAYKE is a linear peptidic epitope (epitope ID 498817) tested in 1 MHC ligand assay.	IEDB	498817	83	93	ETMKEVKAYKE	ECO:0000213	PubMed	26495903
Q03247	ETMKEVKAYKEEL is a linear peptidic epitope (epitope ID 498819) tested in 1 MHC ligand assay.	IEDB	498819	83	95	ETMKEVKAYKEEL	ECO:0000213	PubMed	26495903
Q03247	ETMKEVKAYKEELE is a linear peptidic epitope (epitope ID 498820) tested in 1 MHC ligand assay.	IEDB	498820	83	96	ETMKEVKAYKEELE	ECO:0000213	PubMed	26495903
Q03247	ETMKEVKAYKEELEG is a linear peptidic epitope (epitope ID 498821) tested in 1 MHC ligand assay.	IEDB	498821	83	97	ETMKEVKAYKEELEG	ECO:0000213	PubMed	26495903
Q03247	ETQARVSKELQAAQAR is a linear peptidic epitope (epitope ID 498822) tested in 2 MHC ligand assays.	IEDB	498822	105	120	ETQARVSKELQAAQAR	ECO:0000213	PubMed	26495903
Q03247	ETQARVSKELQAAQARL is a linear peptidic epitope (epitope ID 498823) tested in 1 MHC ligand assay.	IEDB	498823	105	121	ETQARVSKELQAAQARL	ECO:0000213	PubMed	26495903
Q03247	ETQARVSKELQAAQARLG is a linear peptidic epitope (epitope ID 498824) tested in 1 MHC ligand assay.	IEDB	498824	105	122	ETQARVSKELQAAQARLG	ECO:0000213	PubMed	26495903
Q03247	ETQARVSKELQAAQARLGS is a linear peptidic epitope (epitope ID 498825) tested in 1 MHC ligand assay.	IEDB	498825	105	123	ETQARVSKELQAAQARLGS	ECO:0000213	PubMed	26495903
Q03247	GQSRAATLSTLAGQP is a linear peptidic epitope (epitope ID 499383) tested in 1 MHC ligand assay.	IEDB	499383	205	219	GQSRAATLSTLAGQP	ECO:0000213	PubMed	26495903
Q03247	GRLEEVGVRAQ is a linear peptidic epitope (epitope ID 499409) tested in 1 MHC ligand assay.	IEDB	499409	233	243	GRLEEVGVRAQ	ECO:0000213	PubMed	26495903
Q03247	GRLEEVGVRAQD is a linear peptidic epitope (epitope ID 499410) tested in 1 MHC ligand assay.	IEDB	499410	233	244	GRLEEVGVRAQD	ECO:0000213	PubMed	26495903
Q03247	GRLEEVGVRAQDR is a linear peptidic epitope (epitope ID 499411) tested in 1 MHC ligand assay.	IEDB	499411	233	245	GRLEEVGVRAQDR	ECO:0000213	PubMed	26495903
Q03247	GRLEEVGVRAQDRLD is a linear peptidic epitope (epitope ID 499412) tested in 1 MHC ligand assay.	IEDB	499412	233	247	GRLEEVGVRAQDRLD	ECO:0000213	PubMed	26495903
Q03247	GRLEEVGVRAQDRLDK is a linear peptidic epitope (epitope ID 499413) tested in 1 MHC ligand assay.	IEDB	499413	233	248	GRLEEVGVRAQDRLDK	ECO:0000213	PubMed	26495903
Q03247	HGRLEEVGVRAQ is a linear peptidic epitope (epitope ID 499595) tested in 1 MHC ligand assay.	IEDB	499595	232	243	HGRLEEVGVRAQ	ECO:0000213	PubMed	26495903
Q03247	HGRLEEVGVRAQD is a linear peptidic epitope (epitope ID 499596) tested in 1 MHC ligand assay.	IEDB	499596	232	244	HGRLEEVGVRAQD	ECO:0000213	PubMed	26495903
Q03247	HGRLEEVGVRAQDR is a linear peptidic epitope (epitope ID 499597) tested in 1 MHC ligand assay.	IEDB	499597	232	245	HGRLEEVGVRAQDR	ECO:0000213	PubMed	26495903
Q03247	HGRLEEVGVRAQDRLD is a linear peptidic epitope (epitope ID 499598) tested in 1 MHC ligand assay.	IEDB	499598	232	247	HGRLEEVGVRAQDRLD	ECO:0000213	PubMed	26495903
Q03247	HGRLEEVGVRAQDRLDK is a linear peptidic epitope (epitope ID 499599) tested in 1 MHC ligand assay.	IEDB	499599	232	248	HGRLEEVGVRAQDRLDK	ECO:0000213	PubMed	26495903
Q03247	IRQQLEEVHAKVEEQ is a linear peptidic epitope (epitope ID 499968) tested in 1 MHC ligand assay.	IEDB	499968	249	263	IRQQLEEVHAKVEEQ	ECO:0000213	PubMed	26495903
Q03247	IRQQLEEVHAKVEEQGN is a linear peptidic epitope (epitope ID 499969) tested in 1 MHC ligand assay.	IEDB	499969	249	265	IRQQLEEVHAKVEEQGN	ECO:0000213	PubMed	26495903
Q03247	IRQQLEEVHAKVEEQGNQ is a linear peptidic epitope (epitope ID 499970) tested in 1 MHC ligand assay.	IEDB	499970	249	266	IRQQLEEVHAKVEEQGNQ	ECO:0000213	PubMed	26495903
Q03247	KIRQQLEEVHAKVEEQGN is a linear peptidic epitope (epitope ID 500262) tested in 1 MHC ligand assay.	IEDB	500262	248	265	KIRQQLEEVHAKVEEQGN	ECO:0000213	PubMed	26495903
Q03247	LEEVGVRAQDRLD is a linear peptidic epitope (epitope ID 500737) tested in 1 MHC ligand assay.	IEDB	500737	235	247	LEEVGVRAQDRLD	ECO:0000213	PubMed	26495903
Q03247	LHGRLEEVGVRAQD is a linear peptidic epitope (epitope ID 500796) tested in 1 MHC ligand assay.	IEDB	500796	231	244	LHGRLEEVGVRAQD	ECO:0000213	PubMed	26495903
Q03247	LHGRLEEVGVRAQDR is a linear peptidic epitope (epitope ID 500797) tested in 1 MHC ligand assay.	IEDB	500797	231	245	LHGRLEEVGVRAQDR	ECO:0000213	PubMed	26495903
Q03247	MEETMKEVKAYKE is a linear peptidic epitope (epitope ID 501141) tested in 1 MHC ligand assay.	IEDB	501141	81	93	MEETMKEVKAYKE	ECO:0000213	PubMed	26495903
Q03247	MEETMKEVKAYKEELE is a linear peptidic epitope (epitope ID 501143) tested in 1 MHC ligand assay.	IEDB	501143	81	96	MEETMKEVKAYKEELE	ECO:0000213	PubMed	26495903
Q03247	QARVSKELQAAQAR is a linear peptidic epitope (epitope ID 501528) tested in 1 MHC ligand assay.	IEDB	501528	107	120	QARVSKELQAAQAR	ECO:0000213	PubMed	26495903
Q03247	QARVSKELQAAQARLG is a linear peptidic epitope (epitope ID 501529) tested in 1 MHC ligand assay.	IEDB	501529	107	122	QARVSKELQAAQARLG	ECO:0000213	PubMed	26495903
Q03247	QARVSKELQAAQARLGS is a linear peptidic epitope (epitope ID 501530) tested in 1 MHC ligand assay.	IEDB	501530	107	123	QARVSKELQAAQARLGS	ECO:0000213	PubMed	26495903
Q03247	QLEEVHAKVEEQGN is a linear peptidic epitope (epitope ID 501615) tested in 1 MHC ligand assay.	IEDB	501615	252	265	QLEEVHAKVEEQGN	ECO:0000213	PubMed	26495903
Q03247	QQLEEVHAKVEEQ is a linear peptidic epitope (epitope ID 501675) tested in 1 MHC ligand assay.	IEDB	501675	251	263	QQLEEVHAKVEEQ	ECO:0000213	PubMed	26495903
Q03247	QQLEEVHAKVEEQG is a linear peptidic epitope (epitope ID 501676) tested in 1 MHC ligand assay.	IEDB	501676	251	264	QQLEEVHAKVEEQG	ECO:0000213	PubMed	26495903
Q03247	QQLEEVHAKVEEQGN is a linear peptidic epitope (epitope ID 501677) tested in 1 MHC ligand assay.	IEDB	501677	251	265	QQLEEVHAKVEEQGN	ECO:0000213	PubMed	26495903
Q03247	QQLEEVHAKVEEQGNQ is a linear peptidic epitope (epitope ID 501678) tested in 1 MHC ligand assay.	IEDB	501678	251	266	QQLEEVHAKVEEQGNQ	ECO:0000213	PubMed	26495903
Q03247	RAEAWRQKLHGRLE is a linear peptidic epitope (epitope ID 501728) tested in 1 MHC ligand assay.	IEDB	501728	223	236	RAEAWRQKLHGRLE	ECO:0000213	PubMed	26495903
Q03247	RLEEVGVRAQDR is a linear peptidic epitope (epitope ID 501878) tested in 1 MHC ligand assay.	IEDB	501878	234	245	RLEEVGVRAQDR	ECO:0000213	PubMed	26495903
Q03247	RLEEVGVRAQDRL is a linear peptidic epitope (epitope ID 501879) tested in 1 MHC ligand assay.	IEDB	501879	234	246	RLEEVGVRAQDRL	ECO:0000213	PubMed	26495903
Q03247	RLEEVGVRAQDRLD is a linear peptidic epitope (epitope ID 501880) tested in 1 MHC ligand assay.	IEDB	501880	234	247	RLEEVGVRAQDRLD	ECO:0000213	PubMed	26495903
Q03247	RQQLEEVHAKVEEQ is a linear peptidic epitope (epitope ID 501975) tested in 1 MHC ligand assay.	IEDB	501975	250	263	RQQLEEVHAKVEEQ	ECO:0000213	PubMed	26495903
Q03247	RQQLEEVHAKVEEQGN is a linear peptidic epitope (epitope ID 501976) tested in 1 MHC ligand assay.	IEDB	501976	250	265	RQQLEEVHAKVEEQGN	ECO:0000213	PubMed	26495903
Q03247	RQQLEEVHAKVEEQGNQ is a linear peptidic epitope (epitope ID 501977) tested in 1 MHC ligand assay.	IEDB	501977	250	266	RQQLEEVHAKVEEQGNQ	ECO:0000213	PubMed	26495903
Q03247	RQQLEEVHAKVEEQGNQM is a linear peptidic epitope (epitope ID 501978) tested in 1 MHC ligand assay.	IEDB	501978	250	267	RQQLEEVHAKVEEQGNQM	ECO:0000213	PubMed	26495903
Q03247	RVSKELQAAQAR is a linear peptidic epitope (epitope ID 502062) tested in 1 MHC ligand assay.	IEDB	502062	109	120	RVSKELQAAQAR	ECO:0000213	PubMed	26495903
Q03247	TQARVSKELQAAQAR is a linear peptidic epitope (epitope ID 503093) tested in 1 MHC ligand assay.	IEDB	503093	106	120	TQARVSKELQAAQAR	ECO:0000213	PubMed	26495903
Q03247	TQARVSKELQAAQARL is a linear peptidic epitope (epitope ID 503094) tested in 1 MHC ligand assay.	IEDB	503094	106	121	TQARVSKELQAAQARL	ECO:0000213	PubMed	26495903
Q03247	TQARVSKELQAAQARLG is a linear peptidic epitope (epitope ID 503095) tested in 1 MHC ligand assay.	IEDB	503095	106	122	TQARVSKELQAAQARLG	ECO:0000213	PubMed	26495903
Q03247	VEEQGNQMRLQAEAFQAR is a linear peptidic epitope (epitope ID 503338) tested in 1 MHC ligand assay.	IEDB	503338	260	277	VEEQGNQMRLQAEAFQAR	ECO:0000213	PubMed	26495903
Q03247	AATLSTLAGQPLLER is a linear peptidic epitope (epitope ID 841695) tested in 3 MHC ligand assays.	IEDB	841695	209	223	AATLSTLAGQPLLER	ECO:0000213	PubMed	30573663
Q06154	ITDQVPFSV is a linear peptidic epitope (epitope ID 28864) tested in 105 T cell assays, 25 MHC ligand assays and has 3D structure(s) 6vma, 1tvb and 6vm7.	IEDB	28864	209	217	ITDQVPFSV	ECO:0000213	PubMed	36608422
Q07537	FKNFFYIISPGVTK is a linear peptidic epitope (epitope ID 531706) tested in 5 MHC ligand assays.	IEDB	531706	377	390	FKNFFYIISPGVTK	ECO:0000213	PubMed	30573663
Q08E54	LVFFAEDV is a linear peptidic epitope (epitope ID 40332) tested in 16 B cell assays.	IEDB	40332	613	620	LVFFAEDV	ECO:0000213	PubMed	20217101
Q08E54	GLMVGGVV is a linear peptidic epitope (epitope ID 105228) tested in 9 B cell assays.	IEDB	105228	629	636	GLMVGGVV	ECO:0000213	PubMed	20217101
Q0VCM6	YPSTQFGSLTGLQSL is a linear peptidic epitope (epitope ID 534567) tested in 13 MHC ligand assays.	IEDB	534567	475	489	YPSTQFGSLTGLQSL	ECO:0000213	PubMed	30573663
Q0ZCB4	ERAEAWRQKLHGRL is a linear peptidic epitope (epitope ID 234683) tested in 1 MHC ligand assay.	IEDB	234683	143	156	ERAEAWRQKLHGRL	ECO:0000213	PubMed	8746565
Q0ZCB4	RAEAWRQKLHGRL is a linear peptidic epitope (epitope ID 235584) tested in 1 MHC ligand assay.	IEDB	235584	144	156	RAEAWRQKLHGRL	ECO:0000213	PubMed	8746565
Q17Q89	NVVFKLLGPVLVKQE is a linear peptidic epitope (epitope ID 648114) tested in 5 MHC ligand assays.	IEDB	648114	54	68	NVVFKLLGPVLVKQE	ECO:0000213	PubMed	30573663
Q17Q89	NVVFKLLGPVLVK is a linear peptidic epitope (epitope ID 1873139) tested in 1 MHC ligand assay.	IEDB	1873139	54	66	NVVFKLLGPVLVK	ECO:0000213	PubMed	30573663
Q17QI5	RNIDLVAQRGERLE is a linear peptidic epitope (epitope ID 649277) tested in 6 MHC ligand assays.	IEDB	649277	142	155	RNIDLVAQRGERLE	ECO:0000213	PubMed	30573663
Q17QL5	EDFIVWMRTAALPT is a linear peptidic epitope (epitope ID 641959) tested in 4 MHC ligand assays.	IEDB	641959	255	268	EDFIVWMRTAALPT	ECO:0000213	PubMed	30573663
Q17QL5	NEDFIVWMRTAALPT is a linear peptidic epitope (epitope ID 1111235) tested in 3 MHC ligand assays.	IEDB	1111235	254	268	NEDFIVWMRTAALPT	ECO:0000213	PubMed	30573663
Q17R06	DKHITTLQASFLTKK is a linear peptidic epitope (epitope ID 1132686) tested in 5 MHC ligand assays.	IEDB	1132686	43	57	DKHITTLQASFLTKK	ECO:0000213	PubMed	30573663
Q1RMP1	LALGGAAAVLG is a linear peptidic epitope (epitope ID 1872702) tested in 1 MHC ligand assay.	IEDB	1872702	11	21	LALGGAAAVLG	ECO:0000213	PubMed	30573663
Q27955	WSSMEIMEAYSVARQ is a linear peptidic epitope (epitope ID 1391192) tested in 3 MHC ligand assays.	IEDB	1391192	190	204	WSSMEIMEAYSVARQ	ECO:0000213	PubMed	30573663
Q28133	DQGTCLLLTEVA is a linear peptidic epitope (epitope ID 9848) tested in 2 T cell assays.	IEDB	9848	75	86	DQGTCLLLTEVA	ECO:0000213	PubMed	9973397
Q28133	ELEKYQQLNSERGV is a linear peptidic epitope (epitope ID 13024) tested in 2 T cell assays.	IEDB	13024	143	156	ELEKYQQLNSERGV	ECO:0000213	PubMed	9973397
Q28133	GERITKMTEGLAK is a linear peptidic epitope (epitope ID 19412) tested in 2 T cell assays.	IEDB	19412	123	135	GERITKMTEGLAK	ECO:0000213	PubMed	9973397
Q28133	PGEWRIIYAAADNK is a linear peptidic epitope (epitope ID 47640) tested in 2 T cell assays.	IEDB	47640	29	42	PGEWRIIYAAADNK	ECO:0000213	PubMed	9973397
Q28133	RIECINDC is a linear peptidic epitope (epitope ID 54135) tested in 2 T cell assays.	IEDB	54135	57	64	RIECINDC	ECO:0000213	PubMed	9973397
Q28133	VAKRQEGYVYVL is a linear peptidic epitope (epitope ID 67652) tested in 2 T cell assays.	IEDB	67652	85	96	VAKRQEGYVYVL	ECO:0000213	PubMed	9973397
Q28133	VSENMLVTYV is a linear peptidic epitope (epitope ID 70919) tested in 2 T cell assays.	IEDB	70919	109	118	VSENMLVTYV	ECO:0000213	PubMed	9973397
Q28172	HGYWSEWSPE is a linear peptidic epitope (epitope ID 839009) tested in 28 B cell assays.	IEDB	839009	212	221	HGYWSEWSPE	ECO:0000213	PubMed	17675186
Q28175	KVNPETLETI is a linear peptidic epitope (epitope ID 767942) tested in 9 B cell assays.	IEDB	767942	154	163	KVNPETLETI	ECO:0000213	PubMed	16379027
Q28194	VQGKQHVVSVEEAL is a linear peptidic epitope (epitope ID 503594) tested in 1 MHC ligand assay.	IEDB	503594	116	129	VQGKQHVVSVEEAL	ECO:0000213	PubMed	26495903
Q29443	TVFDNLPNPEDRKN is a linear peptidic epitope (epitope ID 131722) tested in 1 MHC ligand assay.	IEDB	131722	232	245	TVFDNLPNPEDRKN	ECO:0000213	PubMed	10233671
Q29443	YLGDDYVRAM is a linear peptidic epitope (epitope ID 156806) tested in 3 MHC ligand assays.	IEDB	156806	675	684	YLGDDYVRAM	ECO:0000213	PubMed	21209280
Q29443	DVAFVKDQTVIQ is a linear peptidic epitope (epitope ID 234071) tested in 2 MHC ligand assays.	IEDB	234071	555	566	DVAFVKDQTVIQ	ECO:0000213	PubMed	12391225
Q29443	DVAFVKDQTVIQN is a linear peptidic epitope (epitope ID 234072) tested in 2 MHC ligand assays.	IEDB	234072	555	567	DVAFVKDQTVIQN	ECO:0000213	PubMed	12391225
Q29443	DVAFVKDQTVIQNTD is a linear peptidic epitope (epitope ID 234073) tested in 3 MHC ligand assays.	IEDB	234073	555	569	DVAFVKDQTVIQNTD	ECO:0000213	PubMed	12391225
Q29443	DVAFVKDQTVIQNTDG is a linear peptidic epitope (epitope ID 234074) tested in 2 MHC ligand assays.	IEDB	234074	555	570	DVAFVKDQTVIQNTDG	ECO:0000213	PubMed	12391225
Q29443	DVAFVKDQTVIQNTDGN is a linear peptidic epitope (epitope ID 234075) tested in 2 MHC ligand assays.	IEDB	234075	555	571	DVAFVKDQTVIQNTDGN	ECO:0000213	PubMed	12391225
Q29443	GDVAFVKDQTVIQ is a linear peptidic epitope (epitope ID 234106) tested in 4 MHC ligand assays.	IEDB	234106	554	566	GDVAFVKDQTVIQ	ECO:0000213	PubMed	12391225
Q29443	GDVAFVKDQTVIQN is a linear peptidic epitope (epitope ID 234107) tested in 2 MHC ligand assays.	IEDB	234107	554	567	GDVAFVKDQTVIQN	ECO:0000213	PubMed	12391225
Q29443	GDVAFVKDQTVIQNTD is a linear peptidic epitope (epitope ID 234108) tested in 2 MHC ligand assays.	IEDB	234108	554	569	GDVAFVKDQTVIQNTD	ECO:0000213	PubMed	12391225
Q29443	GDVAFVKDQTVIQNTDG is a linear peptidic epitope (epitope ID 234109) tested in 4 MHC ligand assays.	IEDB	234109	554	570	GDVAFVKDQTVIQNTDG	ECO:0000213	PubMed	12391225
Q29443	GDVAFVKDQTVIQNTDGN is a linear peptidic epitope (epitope ID 234110) tested in 2 MHC ligand assays.	IEDB	234110	554	571	GDVAFVKDQTVIQNTDGN	ECO:0000213	PubMed	12391225
Q29443	GDVAFVKDQTVIQNTDGNN is a linear peptidic epitope (epitope ID 234111) tested in 1 MHC ligand assay.	IEDB	234111	554	572	GDVAFVKDQTVIQNTDGNN	ECO:0000213	PubMed	12391225
Q29443	NPQTHYYAVAVVKKDTDF is a linear peptidic epitope (epitope ID 234172) tested in 1 MHC ligand assay.	IEDB	234172	108	125	NPQTHYYAVAVVKKDTDF	ECO:0000213	PubMed	12648094
Q29443	MVPSHAVVARTVGGKED is a linear peptidic epitope (epitope ID 237854) tested in 4 MHC ligand assays.	IEDB	237854	268	284	MVPSHAVVARTVGGKED	ECO:0000213	PubMed	11801660
Q29443	MVPSHAVVARTVGGKED is a linear peptidic epitope (epitope ID 237854) tested in 4 MHC ligand assays.	IEDB	237854	268	284	MVPSHAVVARTVGGKED	ECO:0000213	PubMed	26495903
Q29443	DVIWELLNHAQEH is a linear peptidic epitope (epitope ID 419148) tested in 2 MHC ligand assays.	IEDB	419148	284	296	DVIWELLNHAQEH	ECO:0000213	PubMed	8315383
Q29443	DVIWELLNHAQEHFG is a linear peptidic epitope (epitope ID 419149) tested in 1 MHC ligand assay.	IEDB	419149	284	298	DVIWELLNHAQEHFG	ECO:0000213	PubMed	8315383
Q29443	YLGYEYVTALQNLRES is a linear peptidic epitope (epitope ID 441846) tested in 1 MHC ligand assay.	IEDB	441846	337	352	YLGYEYVTALQNLRES	ECO:0000213	PubMed	18512783
Q29443	AMVPSHAVVARTVGGKED is a linear peptidic epitope (epitope ID 497397) tested in 1 MHC ligand assay.	IEDB	497397	267	284	AMVPSHAVVARTVGGKED	ECO:0000213	PubMed	26495903
Q29443	KDTDFKLNELRGKK is a linear peptidic epitope (epitope ID 500124) tested in 3 MHC ligand assays.	IEDB	500124	121	134	KDTDFKLNELRGKK	ECO:0000213	PubMed	26495903
Q29443	KDTDFKLNELRGKKS is a linear peptidic epitope (epitope ID 500125) tested in 2 MHC ligand assays.	IEDB	500125	121	135	KDTDFKLNELRGKKS	ECO:0000213	PubMed	26495903
Q29443	KKDTDFKLNELRGKK is a linear peptidic epitope (epitope ID 500269) tested in 2 MHC ligand assays.	IEDB	500269	120	134	KKDTDFKLNELRGKK	ECO:0000213	PubMed	26495903
Q29443	KKDTDFKLNELRGKKS is a linear peptidic epitope (epitope ID 500270) tested in 2 MHC ligand assays.	IEDB	500270	120	135	KKDTDFKLNELRGKKS	ECO:0000213	PubMed	26495903
Q29443	KPNNLKPVVAEFHG is a linear peptidic epitope (epitope ID 500408) tested in 1 MHC ligand assay.	IEDB	500408	91	104	KPNNLKPVVAEFHG	ECO:0000213	PubMed	26495903
Q29443	KPNNLKPVVAEFHGT is a linear peptidic epitope (epitope ID 500409) tested in 1 MHC ligand assay.	IEDB	500409	91	105	KPNNLKPVVAEFHGT	ECO:0000213	PubMed	26495903
Q29443	KPNNLKPVVAEFHGTK is a linear peptidic epitope (epitope ID 500410) tested in 1 MHC ligand assay.	IEDB	500410	91	106	KPNNLKPVVAEFHGTK	ECO:0000213	PubMed	26495903
Q29443	KPNNLKPVVAEFHGTKD is a linear peptidic epitope (epitope ID 500411) tested in 1 MHC ligand assay.	IEDB	500411	91	107	KPNNLKPVVAEFHGTKD	ECO:0000213	PubMed	26495903
Q29443	LAMVPSHAVVARTVGGK is a linear peptidic epitope (epitope ID 500670) tested in 1 MHC ligand assay.	IEDB	500670	266	282	LAMVPSHAVVARTVGGK	ECO:0000213	PubMed	26495903
Q29443	LAMVPSHAVVARTVGGKE is a linear peptidic epitope (epitope ID 500671) tested in 1 MHC ligand assay.	IEDB	500671	266	283	LAMVPSHAVVARTVGGKE	ECO:0000213	PubMed	26495903
Q29443	LKPNNLKPVVAEFHGTK is a linear peptidic epitope (epitope ID 500831) tested in 1 MHC ligand assay.	IEDB	500831	90	106	LKPNNLKPVVAEFHGTK	ECO:0000213	PubMed	26495903
Q29443	LKPNNLKPVVAEFHGTKD is a linear peptidic epitope (epitope ID 500832) tested in 1 MHC ligand assay.	IEDB	500832	90	107	LKPNNLKPVVAEFHGTKD	ECO:0000213	PubMed	26495903
Q29443	LKPVVAEFHGTK is a linear peptidic epitope (epitope ID 500833) tested in 1 MHC ligand assay.	IEDB	500833	95	106	LKPVVAEFHGTK	ECO:0000213	PubMed	26495903
Q29443	LKPVVAEFHGTKD is a linear peptidic epitope (epitope ID 500834) tested in 1 MHC ligand assay.	IEDB	500834	95	107	LKPVVAEFHGTKD	ECO:0000213	PubMed	26495903
Q29443	MVPSHAVVARTVG is a linear peptidic epitope (epitope ID 501199) tested in 1 MHC ligand assay.	IEDB	501199	268	280	MVPSHAVVARTVG	ECO:0000213	PubMed	26495903
Q29443	MVPSHAVVARTVGGKE is a linear peptidic epitope (epitope ID 501202) tested in 1 MHC ligand assay.	IEDB	501202	268	283	MVPSHAVVARTVGGKE	ECO:0000213	PubMed	26495903
Q29443	MVPSHAVVARTVGGKEDV is a linear peptidic epitope (epitope ID 501203) tested in 1 MHC ligand assay.	IEDB	501203	268	285	MVPSHAVVARTVGGKEDV	ECO:0000213	PubMed	26495903
Q29443	NLKPVVAEFHGTK is a linear peptidic epitope (epitope ID 501301) tested in 1 MHC ligand assay.	IEDB	501301	94	106	NLKPVVAEFHGTK	ECO:0000213	PubMed	26495903
Q29443	VPSHAVVARTVG is a linear peptidic epitope (epitope ID 503557) tested in 1 MHC ligand assay.	IEDB	503557	269	280	VPSHAVVARTVG	ECO:0000213	PubMed	26495903
Q29443	VPSHAVVARTVGG is a linear peptidic epitope (epitope ID 503558) tested in 1 MHC ligand assay.	IEDB	503558	269	281	VPSHAVVARTVGG	ECO:0000213	PubMed	26495903
Q29443	VPSHAVVARTVGGK is a linear peptidic epitope (epitope ID 503559) tested in 1 MHC ligand assay.	IEDB	503559	269	282	VPSHAVVARTVGGK	ECO:0000213	PubMed	26495903
Q29443	VPSHAVVARTVGGKE is a linear peptidic epitope (epitope ID 503560) tested in 1 MHC ligand assay.	IEDB	503560	269	283	VPSHAVVARTVGGKE	ECO:0000213	PubMed	26495903
Q29443	VPSHAVVARTVGGKED is a linear peptidic epitope (epitope ID 503561) tested in 1 MHC ligand assay.	IEDB	503561	269	284	VPSHAVVARTVGGKED	ECO:0000213	PubMed	26495903
Q29443	ENVLRILESGPFVS is a linear peptidic epitope (epitope ID 789783) tested in 4 MHC ligand assays.	IEDB	789783	43	56	ENVLRILESGPFVS	ECO:0000213	PubMed	30573663
Q29443	YLAMVPSHAVVAR is a linear peptidic epitope (epitope ID 1874029) tested in 1 MHC ligand assay.	IEDB	1874029	265	277	YLAMVPSHAVVAR	ECO:0000213	PubMed	30573663
Q29443	YLAMVPSHAVVART is a linear peptidic epitope (epitope ID 1874031) tested in 1 MHC ligand assay.	IEDB	1874031	265	278	YLAMVPSHAVVART	ECO:0000213	PubMed	30573663
Q2HJG5	ERQELRILVGTNLVR is a linear peptidic epitope (epitope ID 531601) tested in 9 MHC ligand assays.	IEDB	531601	212	226	ERQELRILVGTNLVR	ECO:0000213	PubMed	30573663
Q2KIU3	AKDNYRHLSGNVVLQ is a linear peptidic epitope (epitope ID 1870978) tested in 1 MHC ligand assay.	IEDB	1870978	163	177	AKDNYRHLSGNVVLQ	ECO:0000213	PubMed	30573663
Q2KIW6	IVDKYIGESARLIRE is a linear peptidic epitope (epitope ID 845575) tested in 10 MHC ligand assays.	IEDB	845575	203	217	IVDKYIGESARLIRE	ECO:0000213	PubMed	30573663
Q2KIW6	IVDKYIGESARLIR is a linear peptidic epitope (epitope ID 1236826) tested in 4 MHC ligand assays.	IEDB	1236826	203	216	IVDKYIGESARLIR	ECO:0000213	PubMed	30573663
Q2KJA1	ARTIEYLQPNPASR is a linear peptidic epitope (epitope ID 1599355) tested in 4 MHC ligand assays.	IEDB	1599355	52	65	ARTIEYLQPNPASR	ECO:0000213	PubMed	30573663
Q2KJA1	ARTIEYLQPNPASRA is a linear peptidic epitope (epitope ID 1599356) tested in 4 MHC ligand assays.	IEDB	1599356	52	66	ARTIEYLQPNPASRA	ECO:0000213	PubMed	30573663
Q2KJA1	LARTIEYLQPNPASR is a linear peptidic epitope (epitope ID 1611834) tested in 3 MHC ligand assays.	IEDB	1611834	51	65	LARTIEYLQPNPASR	ECO:0000213	PubMed	30573663
Q2KJF1	AGEEEPLAVAWSTHGPA is a linear peptidic epitope (epitope ID 497255) tested in 1 MHC ligand assay.	IEDB	497255	445	461	AGEEEPLAVAWSTHGPA	ECO:0000213	PubMed	26495903
Q2KJF1	GAEEQLVPRASTSPD is a linear peptidic epitope (epitope ID 499005) tested in 1 MHC ligand assay.	IEDB	499005	249	263	GAEEQLVPRASTSPD	ECO:0000213	PubMed	26495903
Q2KJF1	GAEEQLVPRASTSPDR is a linear peptidic epitope (epitope ID 499006) tested in 1 MHC ligand assay.	IEDB	499006	249	264	GAEEQLVPRASTSPDR	ECO:0000213	PubMed	26495903
Q2KJF1	LRAGEEEPLAVAWSTHGPA is a linear peptidic epitope (epitope ID 501018) tested in 1 MHC ligand assay.	IEDB	501018	443	461	LRAGEEEPLAVAWSTHGPA	ECO:0000213	PubMed	26495903
Q2KJF1	RAGEEEPLAVAWSTH is a linear peptidic epitope (epitope ID 501729) tested in 1 MHC ligand assay.	IEDB	501729	444	458	RAGEEEPLAVAWSTH	ECO:0000213	PubMed	26495903
Q2KJF1	RAGEEEPLAVAWSTHG is a linear peptidic epitope (epitope ID 501730) tested in 1 MHC ligand assay.	IEDB	501730	444	459	RAGEEEPLAVAWSTHG	ECO:0000213	PubMed	26495903
Q2KJF1	RAGEEEPLAVAWSTHGPA is a linear peptidic epitope (epitope ID 501731) tested in 1 MHC ligand assay.	IEDB	501731	444	461	RAGEEEPLAVAWSTHGPA	ECO:0000213	PubMed	26495903
Q2KJH9	SGEKEVNLAVQDAKA is a linear peptidic epitope (epitope ID 502246) tested in 1 MHC ligand assay.	IEDB	502246	46	60	SGEKEVNLAVQDAKA	ECO:0000213	PubMed	26495903
Q2TBQ1	GNYFTTQKTFKVKER is a linear peptidic epitope (epitope ID 1872084) tested in 1 MHC ligand assay.	IEDB	1872084	161	175	GNYFTTQKTFKVKER	ECO:0000213	PubMed	30573663
Q2UVX4	ESEETVVLEAHGGQG is a linear peptidic epitope (epitope ID 498788) tested in 1 MHC ligand assay.	IEDB	498788	37	51	ESEETVVLEAHGGQG	ECO:0000213	PubMed	26495903
Q2UVX4	SEETVVLEAHGGQG is a linear peptidic epitope (epitope ID 502196) tested in 1 MHC ligand assay.	IEDB	502196	38	51	SEETVVLEAHGGQG	ECO:0000213	PubMed	26495903
Q2UVX4	NPMYSMITPNILR is a linear peptidic epitope (epitope ID 847573) tested in 3 MHC ligand assays.	IEDB	847573	23	35	NPMYSMITPNILR	ECO:0000213	PubMed	30573663
Q2UVX4	NPMYSMITPNILRLE is a linear peptidic epitope (epitope ID 1873101) tested in 1 MHC ligand assay.	IEDB	1873101	23	37	NPMYSMITPNILRLE	ECO:0000213	PubMed	30573663
Q32KY0	KDILTSNNIEVEKM is a linear peptidic epitope (epitope ID 500095) tested in 1 MHC ligand assay.	IEDB	500095	164	177	KDILTSNNIEVEKM	ECO:0000213	PubMed	26495903
Q32KY0	KDILTSNNIEVEKMT is a linear peptidic epitope (epitope ID 500096) tested in 1 MHC ligand assay.	IEDB	500096	164	178	KDILTSNNIEVEKMT	ECO:0000213	PubMed	26495903
Q32L40	DDELILIKNTKAR is a linear peptidic epitope (epitope ID 689728) tested in 6 MHC ligand assays.	IEDB	689728	358	370	DDELILIKNTKAR	ECO:0000213	PubMed	30573663
Q32L40	LKYFVEAGAMAVRR is a linear peptidic epitope (epitope ID 1872816) tested in 2 MHC ligand assays.	IEDB	1872816	297	310	LKYFVEAGAMAVRR	ECO:0000213	PubMed	30573663
Q32L40	LKYFVEAGAMAVRRV is a linear peptidic epitope (epitope ID 1872817) tested in 1 MHC ligand assay.	IEDB	1872817	297	311	LKYFVEAGAMAVRRV	ECO:0000213	PubMed	30573663
Q32LB7	AEEEFNIEKGRLVQ is a linear peptidic epitope (epitope ID 530711) tested in 3 MHC ligand assays.	IEDB	530711	34	47	AEEEFNIEKGRLVQ	ECO:0000213	PubMed	30573663
Q32LB7	EEFNIEKGRLVQ is a linear peptidic epitope (epitope ID 531459) tested in 3 MHC ligand assays.	IEDB	531459	36	47	EEFNIEKGRLVQ	ECO:0000213	PubMed	30573663
Q32LB7	EEFNIEKGRLVQTQ is a linear peptidic epitope (epitope ID 531460) tested in 4 MHC ligand assays.	IEDB	531460	36	49	EEFNIEKGRLVQTQ	ECO:0000213	PubMed	30573663
Q32LB7	EEFNIEKGRLVQTQR is a linear peptidic epitope (epitope ID 1871361) tested in 1 MHC ligand assay.	IEDB	1871361	36	50	EEFNIEKGRLVQTQR	ECO:0000213	PubMed	30573663
Q32PD5	RRVLQALEGLKMVEK is a linear peptidic epitope (epitope ID 1618436) tested in 3 MHC ligand assays.	IEDB	1618436	101	115	RRVLQALEGLKMVEK	ECO:0000213	PubMed	30573663
Q32PI4	KSEAHHAPEASLSKETE is a linear peptidic epitope (epitope ID 500500) tested in 1 MHC ligand assay.	IEDB	500500	33	49	KSEAHHAPEASLSKETE	ECO:0000213	PubMed	26495903
Q32S29	GKKRKRSRKE is a linear peptidic epitope (epitope ID 133836) tested in 3 B cell assays.	IEDB	133836	27	36	GKKRKRSRKE	ECO:0000213	PubMed	2578822
Q32S29	KKAVTKAQKKD is a linear peptidic epitope (epitope ID 133860) tested in 1 B cell assay and 1 MHC ligand assay.	IEDB	133860	16	26	KKAVTKAQKKD	ECO:0000213	PubMed	2578822
Q32S29	PDTGISSKAM is a linear peptidic epitope (epitope ID 133908) tested in 2 B cell assays.	IEDB	133908	51	60	PDTGISSKAM	ECO:0000213	PubMed	2578822
Q32S29	PEPAKKVPAPK is a linear peptidic epitope (epitope ID 133909) tested in 5 B cell assays.	IEDB	133909	2	12	PEPAKKVPAPK	ECO:0000213	PubMed	2578822
Q3MHW6	ILAFVDMVARPSMG is a linear peptidic epitope (epitope ID 1872330) tested in 2 MHC ligand assays.	IEDB	1872330	304	317	ILAFVDMVARPSMG	ECO:0000213	PubMed	30573663
Q3MHW6	LAFVDMVARPSMG is a linear peptidic epitope (epitope ID 1872691) tested in 2 MHC ligand assays.	IEDB	1872691	305	317	LAFVDMVARPSMG	ECO:0000213	PubMed	30573663
Q3SX14	RVLRAQPVQVAEGSEPD is a linear peptidic epitope (epitope ID 502057) tested in 9 MHC ligand assays.	IEDB	502057	572	588	RVLRAQPVQVAEGSEPD	ECO:0000213	PubMed	26495903
Q3SX14	VLRAQPVQVAEGSEPD is a linear peptidic epitope (epitope ID 503460) tested in 4 MHC ligand assays.	IEDB	503460	573	588	VLRAQPVQVAEGSEPD	ECO:0000213	PubMed	26495903
Q3SZ57	ELEKYIQESQALAKR is a linear peptidic epitope (epitope ID 843448) tested in 2 MHC ligand assays.	IEDB	843448	401	415	ELEKYIQESQALAKR	ECO:0000213	PubMed	30573663
Q3SZ57	GPRTFRAITVTKVS is a linear peptidic epitope (epitope ID 844519) tested in 2 MHC ligand assays.	IEDB	844519	231	244	GPRTFRAITVTKVS	ECO:0000213	PubMed	30573663
Q3SZ57	LEKYIQESQALAKR is a linear peptidic epitope (epitope ID 1872742) tested in 1 MHC ligand assay.	IEDB	1872742	402	415	LEKYIQESQALAKR	ECO:0000213	PubMed	30573663
Q3SZR3	IQAAFFYLEPRHAED is a linear peptidic epitope (epitope ID 1872383) tested in 1 MHC ligand assay.	IEDB	1872383	63	77	IQAAFFYLEPRHAED	ECO:0000213	PubMed	30573663
Q3SZV7	SSQLYIMAGQKLWR is a linear peptidic epitope (epitope ID 849228) tested in 3 MHC ligand assays.	IEDB	849228	362	375	SSQLYIMAGQKLWR	ECO:0000213	PubMed	30573663
Q3T052	APSVILPLPGQSVDR is a linear peptidic epitope (epitope ID 783700) tested in 4 MHC ligand assays.	IEDB	783700	717	731	APSVILPLPGQSVDR	ECO:0000213	PubMed	30573663
Q3T052	LVYEELLARHLG is a linear peptidic epitope (epitope ID 1872987) tested in 1 MHC ligand assay.	IEDB	1872987	145	156	LVYEELLARHLG	ECO:0000213	PubMed	30573663
Q3T0D5	IEYYAMLAKTGVHH is a linear peptidic epitope (epitope ID 845212) tested in 4 MHC ligand assays.	IEDB	845212	60	73	IEYYAMLAKTGVHH	ECO:0000213	PubMed	30573663
Q3T0P6	GASLELLEGKVLPG is a linear peptidic epitope (epitope ID 531790) tested in 5 MHC ligand assays.	IEDB	531790	397	410	GASLELLEGKVLPG	ECO:0000213	PubMed	30573663
Q3T0P6	RPFLAILGGAKVADK is a linear peptidic epitope (epitope ID 533541) tested in 17 MHC ligand assays.	IEDB	533541	206	220	RPFLAILGGAKVADK	ECO:0000213	PubMed	30573663
Q3T0P6	LAILGGAKVADK is a linear peptidic epitope (epitope ID 646317) tested in 4 MHC ligand assays.	IEDB	646317	209	220	LAILGGAKVADK	ECO:0000213	PubMed	30573663
Q3T0P6	GGASLELLEGKVLPG is a linear peptidic epitope (epitope ID 1219614) tested in 4 MHC ligand assays.	IEDB	1219614	396	410	GGASLELLEGKVLPG	ECO:0000213	PubMed	30573663
Q3ZBX0	AAGQIAVLGL is a linear peptidic epitope (epitope ID 1870856) tested in 1 MHC ligand assay.	IEDB	1870856	2	11	AAGQIAVLGL	ECO:0000213	PubMed	30573663
Q3ZC00	FIKVFHGLKSTEVAK is a linear peptidic epitope (epitope ID 531702) tested in 2 MHC ligand assays.	IEDB	531702	74	88	FIKVFHGLKSTEVAK	ECO:0000213	PubMed	30573663
Q3ZC81	SLHHWNFVMKTQPE is a linear peptidic epitope (epitope ID 502377) tested in 1 MHC ligand assay.	IEDB	502377	20	33	SLHHWNFVMKTQPE	ECO:0000213	PubMed	26495903
Q3ZCH9	RALPDFKGI is a linear peptidic epitope (epitope ID 194261) tested in 1 MHC ligand assay.	IEDB	194261	97	105	RALPDFKGI	ECO:0000213	PubMed	22544926
Q3ZCL3	VPYELQKGQALIT is a linear peptidic epitope (epitope ID 1873918) tested in 1 MHC ligand assay.	IEDB	1873918	97	109	VPYELQKGQALIT	ECO:0000213	PubMed	30573663
Q3ZCL3	VPYELQKGQALITF is a linear peptidic epitope (epitope ID 1873919) tested in 1 MHC ligand assay.	IEDB	1873919	97	110	VPYELQKGQALITF	ECO:0000213	PubMed	30573663
Q3ZCL3	VPYELQKGQALITFE is a linear peptidic epitope (epitope ID 1873920) tested in 1 MHC ligand assay.	IEDB	1873920	97	111	VPYELQKGQALITFE	ECO:0000213	PubMed	30573663
Q56K14	INALIKAAGVNVEPF is a linear peptidic epitope (epitope ID 1233793) tested in 7 MHC ligand assays.	IEDB	1233793	28	42	INALIKAAGVNVEPF	ECO:0000213	PubMed	30573663
Q5EA36	RAIEALHGHELRPG is a linear peptidic epitope (epitope ID 1114000) tested in 9 MHC ligand assays.	IEDB	1114000	50	63	RAIEALHGHELRPG	ECO:0000213	PubMed	30573663
Q5EA67	AKSYATGIQAQGGTN is a linear peptidic epitope (epitope ID 497361) tested in 1 MHC ligand assay.	IEDB	497361	338	352	AKSYATGIQAQGGTN	ECO:0000213	PubMed	26495903
Q5EA67	AKSYATGIQAQGGTNIN is a linear peptidic epitope (epitope ID 497362) tested in 1 MHC ligand assay.	IEDB	497362	338	354	AKSYATGIQAQGGTNIN	ECO:0000213	PubMed	26495903
Q5EA67	EAKSYATGIQAQGGTN is a linear peptidic epitope (epitope ID 498305) tested in 1 MHC ligand assay.	IEDB	498305	337	352	EAKSYATGIQAQGGTN	ECO:0000213	PubMed	26495903
Q5EA67	EAKSYATGIQAQGGTNIN is a linear peptidic epitope (epitope ID 498306) tested in 1 MHC ligand assay.	IEDB	498306	337	354	EAKSYATGIQAQGGTNIN	ECO:0000213	PubMed	26495903
Q5EA67	KSYATGIQAQGGTN is a linear peptidic epitope (epitope ID 500533) tested in 1 MHC ligand assay.	IEDB	500533	339	352	KSYATGIQAQGGTN	ECO:0000213	PubMed	26495903
Q5EA67	KSYATGIQAQGGTNIN is a linear peptidic epitope (epitope ID 500534) tested in 1 MHC ligand assay.	IEDB	500534	339	354	KSYATGIQAQGGTNIN	ECO:0000213	PubMed	26495903
Q5I2B0	EGQFMYVTGGRLG is a linear peptidic epitope (epitope ID 1871421) tested in 1 MHC ligand assay.	IEDB	1871421	192	204	EGQFMYVTGGRLG	ECO:0000213	PubMed	30573663
Q5I2B0	VTEGQFMYVTGGRLG is a linear peptidic epitope (epitope ID 1873943) tested in 1 MHC ligand assay.	IEDB	1873943	190	204	VTEGQFMYVTGGRLG	ECO:0000213	PubMed	30573663
Q5J7T6	DVNEFRAVTPLGRPDAE is a linear peptidic epitope (epitope ID 10680) tested in 2 MHC ligand assays.	IEDB	10680	38	54	DVNEFRAVTPLGRPDAE	ECO:0000213	PubMed	12648094
Q5J7T6	DVNEFRAVTPLGRPD is a linear peptidic epitope (epitope ID 234076) tested in 1 MHC ligand assay.	IEDB	234076	38	52	DVNEFRAVTPLGRPD	ECO:0000213	PubMed	12648094
Q5J7T6	DVNEFRAVTPLGRPDA is a linear peptidic epitope (epitope ID 234077) tested in 1 MHC ligand assay.	IEDB	234077	38	53	DVNEFRAVTPLGRPDA	ECO:0000213	PubMed	12648094
Q6VUQ8	YVYGFHPPQIEIDL is a linear peptidic epitope (epitope ID 436007) tested in 1 MHC ligand assay.	IEDB	436007	7	20	YVYGFHPPQIEIDL	ECO:0000213	PubMed	11465105
Q6VUQ8	YVYGFHPPQIEIDLL is a linear peptidic epitope (epitope ID 436008) tested in 1 MHC ligand assay.	IEDB	436008	7	21	YVYGFHPPQIEIDLL	ECO:0000213	PubMed	11465105
Q6XL67	ATYKRRLQKRSSRPL is a linear peptidic epitope (epitope ID 107091) tested in 1 T cell assay.	IEDB	107091	2342	2356	ATYKRRLQKRSSRPL	ECO:0000213	PubMed	14558103
Q76LU5	KIINILTKQLKRK is a linear peptidic epitope (epitope ID 1872516) tested in 1 MHC ligand assay.	IEDB	1872516	93	105	KIINILTKQLKRK	ECO:0000213	PubMed	30573663
Q7SIH1	IPVRDLKPAIVK is a linear peptidic epitope (epitope ID 1608456) tested in 2 MHC ligand assays.	IEDB	1608456	1473	1484	IPVRDLKPAIVK	ECO:0000213	PubMed	30573663
Q7SIH1	KPIYKPEQTVKFR is a linear peptidic epitope (epitope ID 1610764) tested in 3 MHC ligand assays.	IEDB	1610764	135	147	KPIYKPEQTVKFR	ECO:0000213	PubMed	30573663
Q7SIH1	STKFQVENSNRLL is a linear peptidic epitope (epitope ID 1620692) tested in 2 MHC ligand assays.	IEDB	1620692	1324	1336	STKFQVENSNRLL	ECO:0000213	PubMed	30573663
Q7SIH1	KDMYSFLQDMGLKA is a linear peptidic epitope (epitope ID 1872472) tested in 1 MHC ligand assay.	IEDB	1872472	666	679	KDMYSFLQDMGLKA	ECO:0000213	PubMed	30573663
Q7YRX0	AAPRLPEVPA is a linear peptidic epitope (epitope ID 1870868) tested in 1 MHC ligand assay.	IEDB	1870868	96	105	AAPRLPEVPA	ECO:0000213	PubMed	30573663
Q8SPF8	LTKEALVVTQAS is a linear peptidic epitope (epitope ID 501071) tested in 1 MHC ligand assay.	IEDB	501071	461	472	LTKEALVVTQAS	ECO:0000213	PubMed	26495903
Q8SPF8	SLTKEALVVTQAS is a linear peptidic epitope (epitope ID 502386) tested in 1 MHC ligand assay.	IEDB	502386	460	472	SLTKEALVVTQAS	ECO:0000213	PubMed	26495903
Q8SPF8	SLTKEALVVTQASS is a linear peptidic epitope (epitope ID 502387) tested in 1 MHC ligand assay.	IEDB	502387	460	473	SLTKEALVVTQASS	ECO:0000213	PubMed	26495903
Q95114	FVRIQPVAWHNRITL is a linear peptidic epitope (epitope ID 2245491) tested in 6 T cell assays.	IEDB	2245491	406	420	FVRIQPVAWHNRITL	ECO:0000213	PubMed	37604312
Q95114	GHIQYVAAYRVAYGD is a linear peptidic epitope (epitope ID 2245583) tested in 6 T cell assays.	IEDB	2245583	351	365	GHIQYVAAYRVAYGD	ECO:0000213	PubMed	37604312
Q95114	PFQARFVRIQPVAWH is a linear peptidic epitope (epitope ID 2246933) tested in 6 T cell assays.	IEDB	2246933	401	415	PFQARFVRIQPVAWH	ECO:0000213	PubMed	37604312
Q95118	AQHWSDWSYP is a linear peptidic epitope (epitope ID 838998) tested in 25 B cell assays.	IEDB	838998	241	250	AQHWSDWSYP	ECO:0000213	PubMed	17675186
Q95121	APDFSKITGKPIK is a linear peptidic epitope (epitope ID 841948) tested in 2 MHC ligand assays.	IEDB	841948	338	350	APDFSKITGKPIK	ECO:0000213	PubMed	30573663
Q95121	DAPDFSKITGKPIK is a linear peptidic epitope (epitope ID 1871125) tested in 1 MHC ligand assay.	IEDB	1871125	337	350	DAPDFSKITGKPIK	ECO:0000213	PubMed	30573663
Q9MYK6	DSDMGRMGPI is a linear peptidic epitope (epitope ID 134656) tested in 3 B cell assays.	IEDB	134656	131	140	DSDMGRMGPI	ECO:0000213	PubMed	2266538
Q9N2I2	VFDLYRALAAAAPAQ is a linear peptidic epitope (epitope ID 1873793) tested in 1 MHC ligand assay.	IEDB	1873793	45	59	VFDLYRALAAAAPAQ	ECO:0000213	PubMed	30573663
Q9TUM9	QQRIRAEREKER is a linear peptidic epitope (epitope ID 767983) tested in 1 B cell assay.	IEDB	767983	134	145	QQRIRAEREKER	ECO:0000213	PubMed	12955276
Q9TUM9	VSLKDRIEKR is a linear peptidic epitope (epitope ID 768037) tested in 2 B cell assays.	IEDB	768037	118	127	VSLKDRIEKR	ECO:0000213	PubMed	12955276
Q9TUM9	VSLKDRIEKR is a linear peptidic epitope (epitope ID 768037) tested in 2 B cell assays.	IEDB	768037	118	127	VSLKDRIEKR	ECO:0000213	PubMed	8961925
