accession	features.description	features.xrefs.name	features.xrefs.id	features.begin	features.end	features.epitopeSequence	features.evidences.code	features.evidences.source.name	features.evidences.source.id
A0A663DJA2	INVFAFPFTIYSLLL is a linear peptidic epitope (epitope ID 1310502) tested in 3 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1310502	4	18	INVFAFPFTIYSLLL	ECO:0000213	PubMed	32999467
A0A663DJA2	NVFAFPFTI is a linear peptidic epitope (epitope ID 1330542) tested in 15 T cell assays and 1 MHC ligand assay.	IEDB	1330542	5	13	NVFAFPFTI	ECO:0000213	PubMed	34793243
A0A663DJA2	NVFAFPFTI is a linear peptidic epitope (epitope ID 1330542) tested in 15 T cell assays and 1 MHC ligand assay.	IEDB	1330542	5	13	NVFAFPFTI	ECO:0000213	PubMed	38605956
A0A663DJA2	NVFAFPFTI is a linear peptidic epitope (epitope ID 1330542) tested in 15 T cell assays and 1 MHC ligand assay.	IEDB	1330542	5	13	NVFAFPFTI	ECO:0000213	PubMed	33911008
A0A663DJA2	YINVFAFPF is a linear peptidic epitope (epitope ID 1334359) tested in 10 T cell assays and 1 MHC ligand assay.	IEDB	1334359	3	11	YINVFAFPF	ECO:0000213	PubMed	34793243
A0A663DJA2	YINVFAFPF is a linear peptidic epitope (epitope ID 1334359) tested in 10 T cell assays and 1 MHC ligand assay.	IEDB	1334359	3	11	YINVFAFPF	ECO:0000213	PubMed	38605956
A0A663DJA2	YINVFAFPF is a linear peptidic epitope (epitope ID 1334359) tested in 10 T cell assays and 1 MHC ligand assay.	IEDB	1334359	3	11	YINVFAFPF	ECO:0000213	PubMed	33911008
A0A663DJA2	FAFPFTIYS is a linear peptidic epitope (epitope ID 2134048) tested in 1 T cell assay.	IEDB	2134048	7	15	FAFPFTIYS	ECO:0000213	PubMed	34793243
A0A6B9VLF3	SSDNIALLVQ is a linear peptidic epitope (epitope ID 1309584) tested in 2 B cell assays.	IEDB	1309584	213	222	SSDNIALLVQ	ECO:0000213	PubMed	32844713
A0A6B9VLF3	RTLSYYKL is a linear peptidic epitope (epitope ID 1330035) tested in 3 T cell assays and 2 MHC ligand assays.	IEDB	1330035	174	181	RTLSYYKL	ECO:0000213	PubMed	33464307
A0A6B9VSS2	IRQEEVQEL is a linear peptidic epitope (epitope ID 1310507) tested in 7 T cell assays and 10 MHC ligand assays.	IEDB	1310507	88	96	IRQEEVQEL	ECO:0000213	PubMed	33464307
A0A6B9VSS2	QELYSPIFL is a linear peptidic epitope (epitope ID 1313332) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1313332	94	102	QELYSPIFL	ECO:0000213	PubMed	33464307
A0A6B9VSS2	FLIVAAIVF is a linear peptidic epitope (epitope ID 1392152) tested in 1 T cell assay.	IEDB	1392152	101	109	FLIVAAIVF	ECO:0000213	PubMed	33464307
A0A6B9VSS2	IFLIVAAI is a linear peptidic epitope (epitope ID 1392215) tested in 1 T cell assay.	IEDB	1392215	100	107	IFLIVAAI	ECO:0000213	PubMed	33464307
A0A6B9VSS2	QFAFACPDGVKHVY is a linear peptidic epitope (epitope ID 1392373) tested in 1 T cell assay.	IEDB	1392373	62	75	QFAFACPDGVKHVY	ECO:0000213	PubMed	33464307
A0A6B9VSS2	QFAFACPDGVKHVYQ is a linear peptidic epitope (epitope ID 1392374) tested in 1 T cell assay, 4 B cell assays and 3 MHC ligand assays.	IEDB	1392374	62	76	QFAFACPDGVKHVYQ	ECO:0000213	PubMed	33464307
A0A6B9VSS2	TQFAFACPDGVKHV is a linear peptidic epitope (epitope ID 1392471) tested in 1 T cell assay.	IEDB	1392471	61	74	TQFAFACPDGVKHV	ECO:0000213	PubMed	33464307
A0A6B9VSS2	VQELYSPI is a linear peptidic epitope (epitope ID 1392497) tested in 1 T cell assay.	IEDB	1392497	93	100	VQELYSPI	ECO:0000213	PubMed	33464307
A0A6B9VTP3	FYSKWYIRVGARKSA is a linear peptidic epitope (epitope ID 1310428) tested in 22 T cell assays, 10 B cell assays and 18 MHC ligand assays.	IEDB	1310428	41	55	FYSKWYIRVGARKSA	ECO:0000213	PubMed	33464307
A0A6B9VTP3	SKWYIRVGARKSAPL is a linear peptidic epitope (epitope ID 1310806) tested in 25 T cell assays and 4 MHC ligand assays.	IEDB	1310806	43	57	SKWYIRVGARKSAPL	ECO:0000213	PubMed	33464307
A0A6B9VTP3	YIRVGARKSAPLIEL is a linear peptidic epitope (epitope ID 1310959) tested in 9 T cell assays, 6 B cell assays and 3 MHC ligand assays.	IEDB	1310959	46	60	YIRVGARKSAPLIEL	ECO:0000213	PubMed	33464307
A0A6B9VTP3	FYSKWYIRVGARK is a linear peptidic epitope (epitope ID 1392163) tested in 1 T cell assay.	IEDB	1392163	41	53	FYSKWYIRVGARK	ECO:0000213	PubMed	33464307
A0A6B9WFC7	TALRLCAYCC is a linear peptidic epitope (epitope ID 1309590) tested in 2 B cell assays.	IEDB	1309590	35	44	TALRLCAYCC	ECO:0000213	PubMed	32844713
A0A6B9WFC7	FYVYSRVKNLNSSRV is a linear peptidic epitope (epitope ID 1310430) tested in 22 T cell assays, 2 B cell assays and 7 MHC ligand assays.	IEDB	1310430	56	70	FYVYSRVKNLNSSRV	ECO:0000213	PubMed	33744048
A0A6B9WFC7	FYVYSRVKNLNSSRV is a linear peptidic epitope (epitope ID 1310430) tested in 22 T cell assays, 2 B cell assays and 7 MHC ligand assays.	IEDB	1310430	56	70	FYVYSRVKNLNSSRV	ECO:0000213	PubMed	33923363
A0A6C0QGH5	PINLVRDLPQGFWAL is a linear peptidic epitope (epitope ID 1313286) tested in 1 T cell assay.	IEDB	1313286	209	223	PINLVRDLPQGFWAL	ECO:0000213	PubMed	33104167
A0A6C0RQ44	LPPANTNSF is a linear peptidic epitope (epitope ID 2134174) tested in 1 T cell assay.	IEDB	2134174	24	32	LPPANTNSF	ECO:0000213	PubMed	34793243
A0A6G6CXB7	ILLNKHIDAYKTFPP is a linear peptidic epitope (epitope ID 27183) tested in 17 T cell assays, 8 B cell assays and 20 MHC ligand assays.	IEDB	27183	351	365	ILLNKHIDAYKTFPP	ECO:0000213	PubMed	33464307
A0A6G6CXB7	LLNKHIDAYKTFP is a linear peptidic epitope (epitope ID 985589) tested in 13 T cell assays.	IEDB	985589	352	364	LLNKHIDAYKTFP	ECO:0000213	PubMed	33464307
A0A6G6CXB7	QRNAPRITFGGPSDS is a linear peptidic epitope (epitope ID 1313380) tested in 3 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1313380	9	23	QRNAPRITFGGPSDS	ECO:0000213	PubMed	33464307
A0A6G6CXB7	FPRGQGVPINTNSSP is a linear peptidic epitope (epitope ID 1316855) tested in 3 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1316855	66	80	FPRGQGVPINTNSSP	ECO:0000213	PubMed	33464307
A0A6G6CXB7	ALLLLDRL is a linear peptidic epitope (epitope ID 1334551) tested in 3 T cell assays.	IEDB	1334551	220	227	ALLLLDRL	ECO:0000213	PubMed	33464307
A0A6G6CXB7	LLDRLNQL is a linear peptidic epitope (epitope ID 1334594) tested in 6 T cell assays and 1 MHC ligand assay.	IEDB	1334594	223	230	LLDRLNQL	ECO:0000213	PubMed	33464307
A0A6G6CXB7	DLKFPRGQGVPINTN is a linear peptidic epitope (epitope ID 1392109) tested in 1 T cell assay and 5 MHC ligand assays.	IEDB	1392109	63	77	DLKFPRGQGVPINTN	ECO:0000213	PubMed	33464307
A0A6G6CXB7	GPQNQRNAPRITFG is a linear peptidic epitope (epitope ID 1392187) tested in 1 T cell assay.	IEDB	1392187	5	18	GPQNQRNAPRITFG	ECO:0000213	PubMed	33464307
A0A6G6CXB7	GYYRRATR is a linear peptidic epitope (epitope ID 1392204) tested in 1 T cell assay.	IEDB	1392204	85	92	GYYRRATR	ECO:0000213	PubMed	33464307
A0A6G6CXB7	LKFPRGQGVPINTN is a linear peptidic epitope (epitope ID 1392267) tested in 1 T cell assay.	IEDB	1392267	64	77	LKFPRGQGVPINTN	ECO:0000213	PubMed	33464307
A0A6G6CXB7	NQRNAPRITFGGPSD is a linear peptidic epitope (epitope ID 1392332) tested in 1 T cell assay, 4 B cell assays and 5 MHC ligand assays.	IEDB	1392332	8	22	NQRNAPRITFGGPSD	ECO:0000213	PubMed	33464307
A0A6G6CXB7	PRITFGGPSDSTGS is a linear peptidic epitope (epitope ID 1392359) tested in 1 T cell assay.	IEDB	1392359	13	26	PRITFGGPSDSTGS	ECO:0000213	PubMed	33464307
A0A6G6CXB7	QTVTKKSAAEASKK is a linear peptidic epitope (epitope ID 1392392) tested in 1 T cell assay.	IEDB	1392392	244	257	QTVTKKSAAEASKK	ECO:0000213	PubMed	33464307
A0A6G6CXB7	RNAPRITFGGPSDS is a linear peptidic epitope (epitope ID 1392402) tested in 1 T cell assay.	IEDB	1392402	10	23	RNAPRITFGGPSDS	ECO:0000213	PubMed	33464307
A0A6G6CXB7	YYRRATRR is a linear peptidic epitope (epitope ID 1392541) tested in 1 T cell assay.	IEDB	1392541	86	93	YYRRATRR	ECO:0000213	PubMed	33464307
A0A6G7K2L4	NQKLIANQF is a linear peptidic epitope (epitope ID 1075005) tested in 42 T cell assays, 2 MHC ligand assays and has 3D structure(s) 8elh.	IEDB	1075005	919	927	NQKLIANQF	ECO:0000213	PubMed	33399535
A0A6G7K2L4	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	33399535
A0A6G7K2L4	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	34249101
A0A6G7K2L4	AAYYVGYL is a linear peptidic epitope (epitope ID 1309656) tested in 5 T cell assays and 3 MHC ligand assays.	IEDB	1309656	263	270	AAYYVGYL	ECO:0000213	PubMed	33464307
A0A6G7K2L4	LDSKVGGNYNYLYRL is a linear peptidic epitope (epitope ID 1310565) tested in 19 T cell assays, 32 B cell assays and 7 MHC ligand assays.	IEDB	1310565	441	455	LDSKVGGNYNYLYRL	ECO:0000213	PubMed	33464307
A0A6G7K2L4	NVTWFHAIHVSGTNG is a linear peptidic epitope (epitope ID 1310701) tested in 24 T cell assays, 29 B cell assays and 11 MHC ligand assays.	IEDB	1310701	61	75	NVTWFHAIHVSGTNG	ECO:0000213	PubMed	33464307
A0A6G7K2L4	FPQSAPHGV is a linear peptidic epitope (epitope ID 1316853) tested in 8 T cell assays and 4 MHC ligand assays.	IEDB	1316853	1052	1060	FPQSAPHGV	ECO:0000213	PubMed	33464307
A0A6G7K2L4	CVNFNFNGL is a linear peptidic epitope (epitope ID 1392098) tested in 8 T cell assays.	IEDB	1392098	538	546	CVNFNFNGL	ECO:0000213	PubMed	33464307
A0A6G7K2L4	DLLFNKVTL is a linear peptidic epitope (epitope ID 1392110) tested in 3 T cell assays.	IEDB	1392110	820	828	DLLFNKVTL	ECO:0000213	PubMed	33464307
A0A6G7K2L4	EIYQAGST is a linear peptidic epitope (epitope ID 1392132) tested in 1 T cell assay.	IEDB	1392132	471	478	EIYQAGST	ECO:0000213	PubMed	33464307
A0A6G7K2L4	GYLQPRTF is a linear peptidic epitope (epitope ID 1392203) tested in 1 T cell assay.	IEDB	1392203	268	275	GYLQPRTF	ECO:0000213	PubMed	33464307
A0A6G7K2L4	KNKCVNFNF is a linear peptidic epitope (epitope ID 1392241) tested in 9 T cell assays.	IEDB	1392241	535	543	KNKCVNFNF	ECO:0000213	PubMed	33464307
A0A6G7K2L4	KVGGNYNYLYRLFRK is a linear peptidic epitope (epitope ID 1392253) tested in 1 T cell assay and 7 MHC ligand assays.	IEDB	1392253	444	458	KVGGNYNYLYRLFRK	ECO:0000213	PubMed	33464307
A0A6G7K2L4	NVTWFHAIHVS is a linear peptidic epitope (epitope ID 1392339) tested in 1 T cell assay.	IEDB	1392339	61	71	NVTWFHAIHVS	ECO:0000213	PubMed	33464307
A0A6G7K2L4	NVTWFHAIHVSGTN is a linear peptidic epitope (epitope ID 1392340) tested in 1 T cell assay.	IEDB	1392340	61	74	NVTWFHAIHVSGTN	ECO:0000213	PubMed	33464307
A0A6G7K2L4	PIGINITRF is a linear peptidic epitope (epitope ID 1392354) tested in 1 T cell assay.	IEDB	1392354	230	238	PIGINITRF	ECO:0000213	PubMed	33464307
A0A6G7K2L4	QLPPAYTNSFTRGV is a linear peptidic epitope (epitope ID 1392382) tested in 2 T cell assays.	IEDB	1392382	23	36	QLPPAYTNSFTRGV	ECO:0000213	PubMed	33464307
A0A6G7K2L4	RGWIFGTT is a linear peptidic epitope (epitope ID 1392397) tested in 1 T cell assay.	IEDB	1392397	102	109	RGWIFGTT	ECO:0000213	PubMed	33464307
A0A6G7K2L4	RTQLPPAYTNSFTR is a linear peptidic epitope (epitope ID 1392408) tested in 1 T cell assay.	IEDB	1392408	21	34	RTQLPPAYTNSFTR	ECO:0000213	PubMed	33464307
A0A6G7K2L4	TQLPPAYTNSFTRGV is a linear peptidic epitope (epitope ID 1392477) tested in 1 T cell assay, 6 B cell assays and 7 MHC ligand assays.	IEDB	1392477	22	36	TQLPPAYTNSFTRGV	ECO:0000213	PubMed	33464307
A0A6G7K2L4	TWFHAIHVSGTNGTK is a linear peptidic epitope (epitope ID 1392483) tested in 1 T cell assay, 4 B cell assays and 9 MHC ligand assays.	IEDB	1392483	63	77	TWFHAIHVSGTNGTK	ECO:0000213	PubMed	33464307
A0A6G7K2L4	VTWFHAIHVSGTN is a linear peptidic epitope (epitope ID 1392507) tested in 1 T cell assay.	IEDB	1392507	62	74	VTWFHAIHVSGTN	ECO:0000213	PubMed	33464307
A0A6G7K2L4	VTWFHAIHVSGTNGT is a linear peptidic epitope (epitope ID 1392508) tested in 6 T cell assays and 9 MHC ligand assays.	IEDB	1392508	62	76	VTWFHAIHVSGTNGT	ECO:0000213	PubMed	33464307
A0A6G7K2L4	VVVLSFEL is a linear peptidic epitope (epitope ID 1392512) tested in 4 T cell assays.	IEDB	1392512	510	517	VVVLSFEL	ECO:0000213	PubMed	33464307
A0A6G7S6S0	YLYALVYFL is a linear peptidic epitope (epitope ID 1311604) tested in 19 T cell assays and 4 MHC ligand assays.	IEDB	1311604	107	115	YLYALVYFL	ECO:0000213	PubMed	33464307
A0A6G7S6S0	EPIYDEPTTTTSVPL is a linear peptidic epitope (epitope ID 1340666) tested in 2 T cell assays, 16 B cell assays and 3 MHC ligand assays.	IEDB	1340666	261	275	EPIYDEPTTTTSVPL	ECO:0000213	PubMed	33464307
A0A6G7S6S0	CYDYCIPYNSVTSSI is a linear peptidic epitope (epitope ID 1392099) tested in 1 T cell assay, 4 B cell assays and 4 MHC ligand assays.	IEDB	1392099	153	167	CYDYCIPYNSVTSSI	ECO:0000213	PubMed	33464307
A0A6G7S6S0	PTTTTSVPL is a linear peptidic epitope (epitope ID 1392361) tested in 1 T cell assay.	IEDB	1392361	267	275	PTTTTSVPL	ECO:0000213	PubMed	33464307
A0A6G7S6S0	YALVYFLQS is a linear peptidic epitope (epitope ID 1392520) tested in 1 T cell assay.	IEDB	1392520	109	117	YALVYFLQS	ECO:0000213	PubMed	33464307
A0A6G7S6S0	YDEPTTTTSVPL is a linear peptidic epitope (epitope ID 1392523) tested in 1 T cell assay and 5 B cell assays.	IEDB	1392523	264	275	YDEPTTTTSVPL	ECO:0000213	PubMed	33464307
A0A6G7S6S0	YDYCIPYNSVTSSIV is a linear peptidic epitope (epitope ID 1392524) tested in 1 T cell assay and 3 MHC ligand assays.	IEDB	1392524	154	168	YDYCIPYNSVTSSIV	ECO:0000213	PubMed	33464307
A0A6H0C4T4	HVYQLRARL is a linear peptidic epitope (epitope ID 2134105) tested in 1 T cell assay.	IEDB	2134105	73	81	HVYQLRARL	ECO:0000213	PubMed	34793243
A0A6H0C4T4	RARLVSPKL is a linear peptidic epitope (epitope ID 2134250) tested in 1 T cell assay.	IEDB	2134250	78	86	RARLVSPKL	ECO:0000213	PubMed	34793243
A0A6H1PIT3	ATSRMLSYY is a linear peptidic epitope (epitope ID 2134011) tested in 1 T cell assay.	IEDB	2134011	171	179	ATSRMLSYY	ECO:0000213	PubMed	34793243
A0A6M3DDE8	YTDIATSAC is a linear peptidic epitope (epitope ID 2134372) tested in 1 T cell assay.	IEDB	2134372	2905	2913	YTDIATSAC	ECO:0000213	PubMed	34793243
A0A6M3DDN3	RFYFYTSKTTVASLIN is a linear peptidic epitope (epitope ID 1690117) tested in 12 T cell assays and 2 B cell assays.	IEDB	1690117	1421	1436	RFYFYTSKTTVASLIN	ECO:0000213	PubMed	36969239
A0A6M3DDN3	RKHFSMMILS is a linear peptidic epitope (epitope ID 2133004) tested in 1 T cell assay.	IEDB	2133004	5142	5151	RKHFSMMILS	ECO:0000213	PubMed	35486722
A0A6M3DDN3	SLTYSTAAL is a linear peptidic epitope (epitope ID 2134275) tested in 1 T cell assay.	IEDB	2134275	2242	2250	SLTYSTAAL	ECO:0000213	PubMed	34793243
A0A6M3SQW8	RTAPHGHVV is a linear peptidic epitope (epitope ID 2134262) tested in 1 T cell assay.	IEDB	2134262	77	85	RTAPHGHVV	ECO:0000213	PubMed	34793243
A0A6M5A1N0	NPANNASIV is a linear peptidic epitope (epitope ID 2134214) tested in 2 T cell assays.	IEDB	2134214	150	158	NPANNASIV	ECO:0000213	PubMed	34793243
A0A6V7AL95	GINASVVNIQKEIDR is a linear peptidic epitope (epitope ID 1069816) tested in 20 T cell assays, 24 B cell assays and 10 MHC ligand assays.	IEDB	1069816	1180	1194	GINASVVNIQKEIDR	ECO:0000213	PubMed	32887977
A0A6V7AL95	NLLLQYGSFCTQLNR is a linear peptidic epitope (epitope ID 1071580) tested in 26 T cell assays, 24 B cell assays and 26 MHC ligand assays.	IEDB	1071580	760	774	NLLLQYGSFCTQLNR	ECO:0000213	PubMed	32887977
A0A6V7AL95	NLVRDLPQGFSALEP is a linear peptidic epitope (epitope ID 1071585) tested in 20 T cell assays, 24 B cell assays and 22 MHC ligand assays.	IEDB	1071585	220	234	NLVRDLPQGFSALEP	ECO:0000213	PubMed	32887977
A0A6V7AL95	SVTTEILPVSMTKTS is a linear peptidic epitope (epitope ID 1072965) tested in 20 T cell assays, 29 B cell assays and 8 MHC ligand assays.	IEDB	1072965	730	744	SVTTEILPVSMTKTS	ECO:0000213	PubMed	32887977
A0A6V7AL95	VVLSFELLHAPATVC is a linear peptidic epitope (epitope ID 1073956) tested in 20 T cell assays, 26 B cell assays and 8 MHC ligand assays.	IEDB	1073956	520	534	VVLSFELLHAPATVC	ECO:0000213	PubMed	32887977
A0A6V7AL95	YLYRLFRKSNLKPFE is a linear peptidic epitope (epitope ID 1074201) tested in 46 T cell assays, 38 B cell assays and 19 MHC ligand assays.	IEDB	1074201	460	474	YLYRLFRKSNLKPFE	ECO:0000213	PubMed	32887977
A0A6V7AL95	CTFEYVSQPFLMDLE is a linear peptidic epitope (epitope ID 1309110) tested in 54 T cell assays, 10 B cell assays and 34 MHC ligand assays.	IEDB	1309110	175	189	CTFEYVSQPFLMDLE	ECO:0000213	PubMed	32887977
A0A6V7AL95	EFVFKNIDGYFKIYS is a linear peptidic epitope (epitope ID 1309113) tested in 37 T cell assays, 18 B cell assays and 9 MHC ligand assays.	IEDB	1309113	200	214	EFVFKNIDGYFKIYS	ECO:0000213	PubMed	32887977
A0A6V7AL95	GGNYNYLYRLFRKSN is a linear peptidic epitope (epitope ID 1309117) tested in 24 T cell assays, 14 B cell assays and 7 MHC ligand assays.	IEDB	1309117	455	469	GGNYNYLYRLFRKSN	ECO:0000213	PubMed	32887977
A0A6V7AL95	GPKKSTNLVKNKCVN is a linear peptidic epitope (epitope ID 1309118) tested in 13 T cell assays, 12 B cell assays and 8 MHC ligand assays.	IEDB	1309118	535	549	GPKKSTNLVKNKCVN	ECO:0000213	PubMed	32887977
A0A6V7AL95	GVSPTKLNDLCFTNV is a linear peptidic epitope (epitope ID 1309120) tested in 19 T cell assays, 26 B cell assays and 7 MHC ligand assays.	IEDB	1309120	390	404	GVSPTKLNDLCFTNV	ECO:0000213	PubMed	32887977
A0A6V7AL95	KHTPINLVRDLPQGF is a linear peptidic epitope (epitope ID 1309123) tested in 16 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1309123	215	229	KHTPINLVRDLPQGF	ECO:0000213	PubMed	32887977
A0A6V7AL95	LIDLQELGKYEQYI is a linear peptidic epitope (epitope ID 1309125) tested in 2 T cell assays.	IEDB	1309125	1206	1219	LIDLQELGKYEQYI	ECO:0000213	PubMed	32887977
A0A6V7AL95	NFSQILPDPSKPSKR is a linear peptidic epitope (epitope ID 1309132) tested in 30 T cell assays, 25 B cell assays and 25 MHC ligand assays.	IEDB	1309132	810	824	NFSQILPDPSKPSKR	ECO:0000213	PubMed	32887977
A0A6V7AL95	STECSNLLLQYGSFC is a linear peptidic epitope (epitope ID 1309139) tested in 16 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1309139	755	769	STECSNLLLQYGSFC	ECO:0000213	PubMed	32887977
A0A6V7AL95	TDEMIAQYTSALLAG is a linear peptidic epitope (epitope ID 1309140) tested in 21 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1309140	875	889	TDEMIAQYTSALLAG	ECO:0000213	PubMed	32887977
A0A6V7AL95	YAWNRKRISNCVADY is a linear peptidic epitope (epitope ID 1309143) tested in 31 T cell assays, 23 B cell assays and 18 MHC ligand assays.	IEDB	1309143	360	374	YAWNRKRISNCVADY	ECO:0000213	PubMed	32887977
A0A6V7AL95	YEQYIKWPWYIWLGF is a linear peptidic epitope (epitope ID 1309144) tested in 15 T cell assays and 7 MHC ligand assays.	IEDB	1309144	1215	1229	YEQYIKWPWYIWLGF	ECO:0000213	PubMed	32887977
P0DTC1	ALCTFLLNK is a linear peptidic epitope (epitope ID 2463) tested in 3 T cell assays and 7 MHC ligand assays.	IEDB	2463	3179	3187	ALCTFLLNK	ECO:0000213	PubMed	34506741
P0DTC1	ALWEIQQVV is a linear peptidic epitope (epitope ID 2998) tested in 35 T cell assays and 35 MHC ligand assays.	IEDB	2998	4094	4102	ALWEIQQVV	ECO:0000213	PubMed	34210785
P0DTC1	ALWEIQQVV is a linear peptidic epitope (epitope ID 2998) tested in 35 T cell assays and 35 MHC ligand assays.	IEDB	2998	4094	4102	ALWEIQQVV	ECO:0000213	PubMed	34506741
P0DTC1	ALWEIQQVV is a linear peptidic epitope (epitope ID 2998) tested in 35 T cell assays and 35 MHC ligand assays.	IEDB	2998	4094	4102	ALWEIQQVV	ECO:0000213	PubMed	35389886
P0DTC1	ALWEIQQVV is a linear peptidic epitope (epitope ID 2998) tested in 35 T cell assays and 35 MHC ligand assays.	IEDB	2998	4094	4102	ALWEIQQVV	ECO:0000213	PubMed	35484232
P0DTC1	ALWEIQQVV is a linear peptidic epitope (epitope ID 2998) tested in 35 T cell assays and 35 MHC ligand assays.	IEDB	2998	4094	4102	ALWEIQQVV	ECO:0000213	PubMed	36254196
P0DTC1	ALWEIQQVV is a linear peptidic epitope (epitope ID 2998) tested in 35 T cell assays and 35 MHC ligand assays.	IEDB	2998	4094	4102	ALWEIQQVV	ECO:0000213	PubMed	38932408
P0DTC1	CTDDNALAY is a linear peptidic epitope (epitope ID 7121) tested in 14 T cell assays and 31 MHC ligand assays.	IEDB	7121	4163	4171	CTDDNALAY	ECO:0000213	PubMed	35484232
P0DTC1	CTDDNALAYY is a linear peptidic epitope (epitope ID 7122) tested in 27 T cell assays and 7 MHC ligand assays.	IEDB	7122	4163	4172	CTDDNALAYY	ECO:0000213	PubMed	35389886
P0DTC1	CTDDNALAYY is a linear peptidic epitope (epitope ID 7122) tested in 27 T cell assays and 7 MHC ligand assays.	IEDB	7122	4163	4172	CTDDNALAYY	ECO:0000213	PubMed	35484232
P0DTC1	CTDDNALAYY is a linear peptidic epitope (epitope ID 7122) tested in 27 T cell assays and 7 MHC ligand assays.	IEDB	7122	4163	4172	CTDDNALAYY	ECO:0000213	PubMed	36254196
P0DTC1	FLLNKEMYL is a linear peptidic epitope (epitope ID 16737) tested in 31 T cell assays and 16 MHC ligand assays.	IEDB	16737	3183	3191	FLLNKEMYL	ECO:0000213	PubMed	35389886
P0DTC1	FLLNKEMYL is a linear peptidic epitope (epitope ID 16737) tested in 31 T cell assays and 16 MHC ligand assays.	IEDB	16737	3183	3191	FLLNKEMYL	ECO:0000213	PubMed	36254196
P0DTC1	FLLNKEMYL is a linear peptidic epitope (epitope ID 16737) tested in 31 T cell assays and 16 MHC ligand assays.	IEDB	16737	3183	3191	FLLNKEMYL	ECO:0000213	PubMed	38605956
P0DTC1	FLLPSLATV is a linear peptidic epitope (epitope ID 16743) tested in 16 T cell assays and 16 MHC ligand assays.	IEDB	16743	3639	3647	FLLPSLATV	ECO:0000213	PubMed	38608022
P0DTC1	FLNRFTTTL is a linear peptidic epitope (epitope ID 16786) tested in 20 T cell assays and 13 MHC ligand assays.	IEDB	16786	3482	3490	FLNRFTTTL	ECO:0000213	PubMed	34210785
P0DTC1	FLNRFTTTL is a linear peptidic epitope (epitope ID 16786) tested in 20 T cell assays and 13 MHC ligand assays.	IEDB	16786	3482	3490	FLNRFTTTL	ECO:0000213	PubMed	38781962
P0DTC1	FRYMNSQGL is a linear peptidic epitope (epitope ID 17657) tested in 4 T cell assays and 14 MHC ligand assays.	IEDB	17657	3820	3828	FRYMNSQGL	ECO:0000213	PubMed	35389886
P0DTC1	KLWAQCVQL is a linear peptidic epitope (epitope ID 32240) tested in 44 T cell assays and 34 MHC ligand assays.	IEDB	32240	3886	3894	KLWAQCVQL	ECO:0000213	PubMed	35389886
P0DTC1	KLWAQCVQL is a linear peptidic epitope (epitope ID 32240) tested in 44 T cell assays and 34 MHC ligand assays.	IEDB	32240	3886	3894	KLWAQCVQL	ECO:0000213	PubMed	35484232
P0DTC1	KLWAQCVQL is a linear peptidic epitope (epitope ID 32240) tested in 44 T cell assays and 34 MHC ligand assays.	IEDB	32240	3886	3894	KLWAQCVQL	ECO:0000213	PubMed	36254196
P0DTC1	MPASWVMRI is a linear peptidic epitope (epitope ID 42260) tested in 10 T cell assays and 29 MHC ligand assays.	IEDB	42260	3655	3663	MPASWVMRI	ECO:0000213	PubMed	35389886
P0DTC1	NPKTPKYKF is a linear peptidic epitope (epitope ID 45385) tested in 2 T cell assays and 21 MHC ligand assays.	IEDB	45385	3358	3366	NPKTPKYKF	ECO:0000213	PubMed	38781962
P0DTC1	QTFSVLACY is a linear peptidic epitope (epitope ID 52511) tested in 1 T cell assay and 11 MHC ligand assays.	IEDB	52511	3373	3381	QTFSVLACY	ECO:0000213	PubMed	38781962
P0DTC1	SEFSSLPSY is a linear peptidic epitope (epitope ID 57432) tested in 16 T cell assays and 26 MHC ligand assays.	IEDB	57432	3946	3954	SEFSSLPSY	ECO:0000213	PubMed	34171305
P0DTC1	SEFSSLPSY is a linear peptidic epitope (epitope ID 57432) tested in 16 T cell assays and 26 MHC ligand assays.	IEDB	57432	3946	3954	SEFSSLPSY	ECO:0000213	PubMed	38932408
P0DTC1	SPSGVYQCAM is a linear peptidic epitope (epitope ID 60255) tested in 3 T cell assays and 5 MHC ligand assays.	IEDB	60255	3384	3393	SPSGVYQCAM	ECO:0000213	PubMed	38781962
P0DTC1	VLAWLYAAV is a linear peptidic epitope (epitope ID 69392) tested in 14 T cell assays and 12 MHC ligand assays.	IEDB	69392	3467	3475	VLAWLYAAV	ECO:0000213	PubMed	34210785
P0DTC1	VYMPASWVM is a linear peptidic epitope (epitope ID 72100) tested in 5 T cell assays and 9 MHC ligand assays.	IEDB	72100	3653	3661	VYMPASWVM	ECO:0000213	PubMed	34506741
P0DTC1	TLGVLVPHV is a linear peptidic epitope (epitope ID 120241) tested in 7 T cell assays and 2 MHC ligand assays.	IEDB	120241	103	111	TLGVLVPHV	ECO:0000213	PubMed	34210785
P0DTC1	VLLSVLQQL is a linear peptidic epitope (epitope ID 120287) tested in 12 T cell assays and 2 MHC ligand assays.	IEDB	120287	3871	3879	VLLSVLQQL	ECO:0000213	PubMed	34210785
P0DTC1	VLLSVLQQL is a linear peptidic epitope (epitope ID 120287) tested in 12 T cell assays and 2 MHC ligand assays.	IEDB	120287	3871	3879	VLLSVLQQL	ECO:0000213	PubMed	34506741
P0DTC1	HTTDPSFLGRY is a linear peptidic epitope (epitope ID 1074924) tested in 17 T cell assays.	IEDB	1074924	1636	1646	HTTDPSFLGRY	ECO:0000213	PubMed	35389886
P0DTC1	HTTDPSFLGRY is a linear peptidic epitope (epitope ID 1074924) tested in 17 T cell assays.	IEDB	1074924	1636	1646	HTTDPSFLGRY	ECO:0000213	PubMed	35484232
P0DTC1	SEISMDNSPNL is a linear peptidic epitope (epitope ID 1075043) tested in 4 T cell assays.	IEDB	1075043	4112	4122	SEISMDNSPNL	ECO:0000213	PubMed	35389886
P0DTC1	FGDDTVIEV is a linear peptidic epitope (epitope ID 1125057) tested in 10 T cell assays and 10 MHC ligand assays.	IEDB	1125057	825	833	FGDDTVIEV	ECO:0000213	PubMed	34171305
P0DTC1	FGDDTVIEV is a linear peptidic epitope (epitope ID 1125057) tested in 10 T cell assays and 10 MHC ligand assays.	IEDB	1125057	825	833	FGDDTVIEV	ECO:0000213	PubMed	38608022
P0DTC1	WLMWLIINL is a linear peptidic epitope (epitope ID 1125145) tested in 14 T cell assays and 3 MHC ligand assays.	IEDB	1125145	2363	2371	WLMWLIINL	ECO:0000213	PubMed	38605956
P0DTC1	ILFTRFFYV is a linear peptidic epitope (epitope ID 1309121) tested in 15 T cell assays and 2 MHC ligand assays.	IEDB	1309121	2332	2340	ILFTRFFYV	ECO:0000213	PubMed	35484232
P0DTC1	ILFTRFFYV is a linear peptidic epitope (epitope ID 1309121) tested in 15 T cell assays and 2 MHC ligand assays.	IEDB	1309121	2332	2340	ILFTRFFYV	ECO:0000213	PubMed	38932408
P0DTC1	SMWALIISV is a linear peptidic epitope (epitope ID 1309138) tested in 21 T cell assays and 6 MHC ligand assays.	IEDB	1309138	3732	3740	SMWALIISV	ECO:0000213	PubMed	34210785
P0DTC1	SMWALIISV is a linear peptidic epitope (epitope ID 1309138) tested in 21 T cell assays and 6 MHC ligand assays.	IEDB	1309138	3732	3740	SMWALIISV	ECO:0000213	PubMed	38605956
P0DTC1	TLMNVLTLV is a linear peptidic epitope (epitope ID 1309141) tested in 17 T cell assays and 4 MHC ligand assays.	IEDB	1309141	3710	3718	TLMNVLTLV	ECO:0000213	PubMed	34210785
P0DTC1	APHGHVMVEL is a linear peptidic epitope (epitope ID 1310280) tested in 10 T cell assays and 9 MHC ligand assays.	IEDB	1310280	79	88	APHGHVMVEL	ECO:0000213	PubMed	34171305
P0DTC1	ASMPTTIAK is a linear peptidic epitope (epitope ID 1310291) tested in 17 T cell assays and 6 MHC ligand assays.	IEDB	1310291	2192	2200	ASMPTTIAK	ECO:0000213	PubMed	34506741
P0DTC1	ASMPTTIAK is a linear peptidic epitope (epitope ID 1310291) tested in 17 T cell assays and 6 MHC ligand assays.	IEDB	1310291	2192	2200	ASMPTTIAK	ECO:0000213	PubMed	35389886
P0DTC1	ASMPTTIAK is a linear peptidic epitope (epitope ID 1310291) tested in 17 T cell assays and 6 MHC ligand assays.	IEDB	1310291	2192	2200	ASMPTTIAK	ECO:0000213	PubMed	36254196
P0DTC1	DLKGKYVQI is a linear peptidic epitope (epitope ID 1310332) tested in 7 T cell assays.	IEDB	1310332	4344	4352	DLKGKYVQI	ECO:0000213	PubMed	38932408
P0DTC1	ESPFVMMSAPPAQYE is a linear peptidic epitope (epitope ID 1310374) tested in 7 T cell assays, 8 B cell assays and 7 MHC ligand assays.	IEDB	1310374	1801	1815	ESPFVMMSAPPAQYE	ECO:0000213	PubMed	38605956
P0DTC1	MVLGSLAATVRLQAG is a linear peptidic epitope (epitope ID 1310650) tested in 3 T cell assays, 8 B cell assays and 3 MHC ligand assays.	IEDB	1310650	4241	4255	MVLGSLAATVRLQAG	ECO:0000213	PubMed	38781962
P0DTC1	NYMPYFFTL is a linear peptidic epitope (epitope ID 1310703) tested in 15 T cell assays and 1 MHC ligand assay.	IEDB	1310703	2167	2175	NYMPYFFTL	ECO:0000213	PubMed	34506741
P0DTC1	TTDPSFLGRY is a linear peptidic epitope (epitope ID 1310872) tested in 51 T cell assays and 1 MHC ligand assay.	IEDB	1310872	1637	1646	TTDPSFLGRY	ECO:0000213	PubMed	34729465
P0DTC1	TTDPSFLGRY is a linear peptidic epitope (epitope ID 1310872) tested in 51 T cell assays and 1 MHC ligand assay.	IEDB	1310872	1637	1646	TTDPSFLGRY	ECO:0000213	PubMed	35383307
P0DTC1	TTDPSFLGRY is a linear peptidic epitope (epitope ID 1310872) tested in 51 T cell assays and 1 MHC ligand assay.	IEDB	1310872	1637	1646	TTDPSFLGRY	ECO:0000213	PubMed	35389886
P0DTC1	TTDPSFLGRY is a linear peptidic epitope (epitope ID 1310872) tested in 51 T cell assays and 1 MHC ligand assay.	IEDB	1310872	1637	1646	TTDPSFLGRY	ECO:0000213	PubMed	35484232
P0DTC1	TTDPSFLGRY is a linear peptidic epitope (epitope ID 1310872) tested in 51 T cell assays and 1 MHC ligand assay.	IEDB	1310872	1637	1646	TTDPSFLGRY	ECO:0000213	PubMed	35750048
P0DTC1	TTDPSFLGRY is a linear peptidic epitope (epitope ID 1310872) tested in 51 T cell assays and 1 MHC ligand assay.	IEDB	1310872	1637	1646	TTDPSFLGRY	ECO:0000213	PubMed	36254196
P0DTC1	TTDPSFLGRY is a linear peptidic epitope (epitope ID 1310872) tested in 51 T cell assays and 1 MHC ligand assay.	IEDB	1310872	1637	1646	TTDPSFLGRY	ECO:0000213	PubMed	38932408
P0DTC1	TTDPSFLGRY is a linear peptidic epitope (epitope ID 1310872) tested in 51 T cell assays and 1 MHC ligand assay.	IEDB	1310872	1637	1646	TTDPSFLGRY	ECO:0000213	PubMed	39284068
P0DTC1	VLSFCAFAVDAAKAY is a linear peptidic epitope (epitope ID 1310903) tested in 3 T cell assays, 12 B cell assays and 3 MHC ligand assays.	IEDB	1310903	4266	4280	VLSFCAFAVDAAKAY	ECO:0000213	PubMed	38781962
P0DTC1	GTDLEGNFY is a linear peptidic epitope (epitope ID 1311156) tested in 15 T cell assays and 2 MHC ligand assays.	IEDB	1311156	3437	3445	GTDLEGNFY	ECO:0000213	PubMed	35389886
P0DTC1	GTDLEGNFY is a linear peptidic epitope (epitope ID 1311156) tested in 15 T cell assays and 2 MHC ligand assays.	IEDB	1311156	3437	3445	GTDLEGNFY	ECO:0000213	PubMed	36254196
P0DTC1	KTIQPRVEK is a linear peptidic epitope (epitope ID 1311176) tested in 13 T cell assays and 3 MHC ligand assays.	IEDB	1311176	282	290	KTIQPRVEK	ECO:0000213	PubMed	35389886
P0DTC1	KTIQPRVEK is a linear peptidic epitope (epitope ID 1311176) tested in 13 T cell assays and 3 MHC ligand assays.	IEDB	1311176	282	290	KTIQPRVEK	ECO:0000213	PubMed	36254196
P0DTC1	NTCDGTTFTY is a linear peptidic epitope (epitope ID 1311195) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1311195	4082	4091	NTCDGTTFTY	ECO:0000213	PubMed	35389886
P0DTC1	PTDNYITTY is a linear peptidic epitope (epitope ID 1311201) tested in 25 T cell assays and 2 MHC ligand assays.	IEDB	1311201	1321	1329	PTDNYITTY	ECO:0000213	PubMed	35383307
P0DTC1	PTDNYITTY is a linear peptidic epitope (epitope ID 1311201) tested in 25 T cell assays and 2 MHC ligand assays.	IEDB	1311201	1321	1329	PTDNYITTY	ECO:0000213	PubMed	35389886
P0DTC1	PTDNYITTY is a linear peptidic epitope (epitope ID 1311201) tested in 25 T cell assays and 2 MHC ligand assays.	IEDB	1311201	1321	1329	PTDNYITTY	ECO:0000213	PubMed	35484232
P0DTC1	PTDNYITTY is a linear peptidic epitope (epitope ID 1311201) tested in 25 T cell assays and 2 MHC ligand assays.	IEDB	1311201	1321	1329	PTDNYITTY	ECO:0000213	PubMed	36254196
P0DTC1	RPDTRYVL is a linear peptidic epitope (epitope ID 1311209) tested in 11 T cell assays and 1 MHC ligand assay.	IEDB	1311209	2949	2956	RPDTRYVL	ECO:0000213	PubMed	36254196
P0DTC1	RPDTRYVL is a linear peptidic epitope (epitope ID 1311209) tested in 11 T cell assays and 1 MHC ligand assay.	IEDB	1311209	2949	2956	RPDTRYVL	ECO:0000213	PubMed	38932408
P0DTC1	VTDTPKGPK is a linear peptidic epitope (epitope ID 1311231) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1311231	4216	4224	VTDTPKGPK	ECO:0000213	PubMed	36254196
P0DTC1	YLFDESGEFKL is a linear peptidic epitope (epitope ID 1311238) tested in 14 T cell assays and 2 MHC ligand assays.	IEDB	1311238	906	916	YLFDESGEFKL	ECO:0000213	PubMed	34171305
P0DTC1	YLFDESGEFKL is a linear peptidic epitope (epitope ID 1311238) tested in 14 T cell assays and 2 MHC ligand assays.	IEDB	1311238	906	916	YLFDESGEFKL	ECO:0000213	PubMed	35389886
P0DTC1	YLFDESGEFKL is a linear peptidic epitope (epitope ID 1311238) tested in 14 T cell assays and 2 MHC ligand assays.	IEDB	1311238	906	916	YLFDESGEFKL	ECO:0000213	PubMed	36254196
P0DTC1	FLAHIQWMV is a linear peptidic epitope (epitope ID 1311559) tested in 11 T cell assays and 3 MHC ligand assays.	IEDB	1311559	3122	3130	FLAHIQWMV	ECO:0000213	PubMed	34506741
P0DTC1	SAFAMMFVK is a linear peptidic epitope (epitope ID 1311587) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	1311587	3622	3630	SAFAMMFVK	ECO:0000213	PubMed	36254196
P0DTC1	STFNVPMEK is a linear peptidic epitope (epitope ID 1311591) tested in 11 T cell assays and 6 MHC ligand assays.	IEDB	1311591	2600	2608	STFNVPMEK	ECO:0000213	PubMed	36254196
P0DTC1	AIFYLITPV is a linear peptidic epitope (epitope ID 1311971) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1311971	2785	2793	AIFYLITPV	ECO:0000213	PubMed	34506741
P0DTC1	CLHVVGPNV is a linear peptidic epitope (epitope ID 1311982) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1311982	1114	1122	CLHVVGPNV	ECO:0000213	PubMed	34506741
P0DTC1	FLALCADSI is a linear peptidic epitope (epitope ID 1311988) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1311988	685	693	FLALCADSI	ECO:0000213	PubMed	34506741
P0DTC1	IIWFLLLSV is a linear peptidic epitope (epitope ID 1311999) tested in 15 T cell assays and 3 MHC ligand assays.	IEDB	1311999	2230	2238	IIWFLLLSV	ECO:0000213	PubMed	34506741
P0DTC1	KLNEEIAII is a linear peptidic epitope (epitope ID 1312009) tested in 6 T cell assays and 1 MHC ligand assay.	IEDB	1312009	468	476	KLNEEIAII	ECO:0000213	PubMed	34506741
P0DTC1	KLNEEIAII is a linear peptidic epitope (epitope ID 1312009) tested in 6 T cell assays and 1 MHC ligand assay.	IEDB	1312009	468	476	KLNEEIAII	ECO:0000213	PubMed	38781962
P0DTC1	LLFLMSFTV is a linear peptidic epitope (epitope ID 1312016) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1312016	3083	3091	LLFLMSFTV	ECO:0000213	PubMed	34506741
P0DTC1	MLFTMLRKL is a linear peptidic epitope (epitope ID 1312023) tested in 6 T cell assays and 2 MHC ligand assays.	IEDB	1312023	4032	4040	MLFTMLRKL	ECO:0000213	PubMed	34210785
P0DTC1	QLFFSYFAV is a linear peptidic epitope (epitope ID 1312027) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1312027	2348	2356	QLFFSYFAV	ECO:0000213	PubMed	34506741
P0DTC1	SLIYSTAAL is a linear peptidic epitope (epitope ID 1312040) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1312040	2242	2250	SLIYSTAAL	ECO:0000213	PubMed	34506741
P0DTC1	SLPGVFCGV is a linear peptidic epitope (epitope ID 1312041) tested in 16 T cell assays and 4 MHC ligand assays.	IEDB	1312041	3013	3021	SLPGVFCGV	ECO:0000213	PubMed	34210785
P0DTC1	SLPGVFCGV is a linear peptidic epitope (epitope ID 1312041) tested in 16 T cell assays and 4 MHC ligand assays.	IEDB	1312041	3013	3021	SLPGVFCGV	ECO:0000213	PubMed	38605956
P0DTC1	VMVELVAEL is a linear peptidic epitope (epitope ID 1312058) tested in 19 T cell assays and 4 MHC ligand assays.	IEDB	1312058	84	92	VMVELVAEL	ECO:0000213	PubMed	34210785
P0DTC1	VMVELVAEL is a linear peptidic epitope (epitope ID 1312058) tested in 19 T cell assays and 4 MHC ligand assays.	IEDB	1312058	84	92	VMVELVAEL	ECO:0000213	PubMed	38605956
P0DTC1	WMVMFTPLV is a linear peptidic epitope (epitope ID 1312059) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1312059	3128	3136	WMVMFTPLV	ECO:0000213	PubMed	34506741
P0DTC1	YLASGGQPI is a linear peptidic epitope (epitope ID 1312061) tested in 11 T cell assays and 2 MHC ligand assays.	IEDB	1312061	4283	4291	YLASGGQPI	ECO:0000213	PubMed	38605956
P0DTC1	YLATALLTL is a linear peptidic epitope (epitope ID 1312062) tested in 20 T cell assays and 10 MHC ligand assays.	IEDB	1312062	1675	1683	YLATALLTL	ECO:0000213	PubMed	34210785
P0DTC1	YLATALLTL is a linear peptidic epitope (epitope ID 1312062) tested in 20 T cell assays and 10 MHC ligand assays.	IEDB	1312062	1675	1683	YLATALLTL	ECO:0000213	PubMed	34506741
P0DTC1	YLATALLTL is a linear peptidic epitope (epitope ID 1312062) tested in 20 T cell assays and 10 MHC ligand assays.	IEDB	1312062	1675	1683	YLATALLTL	ECO:0000213	PubMed	38605956
P0DTC1	YLNSTNVTI is a linear peptidic epitope (epitope ID 1312064) tested in 8 T cell assays and 2 MHC ligand assays.	IEDB	1312064	2270	2278	YLNSTNVTI	ECO:0000213	PubMed	34171305
P0DTC1	YMPYFFTLL is a linear peptidic epitope (epitope ID 1312066) tested in 5 T cell assays and 2 MHC ligand assays.	IEDB	1312066	2168	2176	YMPYFFTLL	ECO:0000213	PubMed	34506741
P0DTC1	IYLYLTFYL is a linear peptidic epitope (epitope ID 1312789) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1312789	3108	3116	IYLYLTFYL	ECO:0000213	PubMed	34506741
P0DTC1	MYASAVVLL is a linear peptidic epitope (epitope ID 1313188) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1313188	3684	3692	MYASAVVLL	ECO:0000213	PubMed	34506741
P0DTC1	VVTTKIALK is a linear peptidic epitope (epitope ID 1313935) tested in 4 T cell assays and 2 MHC ligand assays.	IEDB	1313935	2753	2761	VVTTKIALK	ECO:0000213	PubMed	34506741
P0DTC1	WSMATYYLF is a linear peptidic epitope (epitope ID 1313970) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1313970	900	908	WSMATYYLF	ECO:0000213	PubMed	34506741
P0DTC1	YYHTTDPSF is a linear peptidic epitope (epitope ID 1314074) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1314074	1634	1642	YYHTTDPSF	ECO:0000213	PubMed	34506741
P0DTC1	YYTSNPTTF is a linear peptidic epitope (epitope ID 1314077) tested in 8 T cell assays and 2 MHC ligand assays.	IEDB	1314077	1536	1544	YYTSNPTTF	ECO:0000213	PubMed	34506741
P0DTC1	QVVNVVTTK is a linear peptidic epitope (epitope ID 1323647) tested in 2 T cell assays.	IEDB	1323647	2749	2757	QVVNVVTTK	ECO:0000213	PubMed	34506741
P0DTC1	TTIAKNTVK is a linear peptidic epitope (epitope ID 1325973) tested in 3 T cell assays.	IEDB	1325973	2196	2204	TTIAKNTVK	ECO:0000213	PubMed	34506741
P0DTC1	WLDMVDTSL is a linear peptidic epitope (epitope ID 1327781) tested in 5 T cell assays.	IEDB	1327781	3666	3674	WLDMVDTSL	ECO:0000213	PubMed	34506741
P0DTC1	FLKKDAPYI is a linear peptidic epitope (epitope ID 1330451) tested in 3 T cell assays.	IEDB	1330451	1278	1286	FLKKDAPYI	ECO:0000213	PubMed	34506741
P0DTC1	KLVNKFLAL is a linear peptidic epitope (epitope ID 1330500) tested in 6 T cell assays.	IEDB	1330500	680	688	KLVNKFLAL	ECO:0000213	PubMed	34506741
P0DTC1	TSEDMLNPNY is a linear peptidic epitope (epitope ID 1330632) tested in 3 T cell assays.	IEDB	1330632	3308	3317	TSEDMLNPNY	ECO:0000213	PubMed	38781962
P0DTC1	YLITPVHVM is a linear peptidic epitope (epitope ID 1330659) tested in 7 T cell assays.	IEDB	1330659	2788	2796	YLITPVHVM	ECO:0000213	PubMed	34506741
P0DTC1	YYRSLPGVF is a linear peptidic epitope (epitope ID 1330665) tested in 2 T cell assays.	IEDB	1330665	3010	3018	YYRSLPGVF	ECO:0000213	PubMed	34506741
P0DTC1	CLEASFNYL is a linear peptidic epitope (epitope ID 1331131) tested in 11 T cell assays and 1 MHC ligand assay.	IEDB	1331131	2210	2218	CLEASFNYL	ECO:0000213	PubMed	38605956
P0DTC1	EEFEPSTQYEY is a linear peptidic epitope (epitope ID 1331528) tested in 4 T cell assays and 10 MHC ligand assays.	IEDB	1331528	939	949	EEFEPSTQYEY	ECO:0000213	PubMed	34171305
P0DTC1	EIKESVQTF is a linear peptidic epitope (epitope ID 1331598) tested in 5 T cell assays and 10 MHC ligand assays.	IEDB	1331598	670	678	EIKESVQTF	ECO:0000213	PubMed	34171305
P0DTC1	FASEAARVV is a linear peptidic epitope (epitope ID 1331935) tested in 4 T cell assays and 10 MHC ligand assays.	IEDB	1331935	536	544	FASEAARVV	ECO:0000213	PubMed	34171305
P0DTC1	FAVDAAKAY is a linear peptidic epitope (epitope ID 1331939) tested in 6 T cell assays and 10 MHC ligand assays.	IEDB	1331939	4272	4280	FAVDAAKAY	ECO:0000213	PubMed	34171305
P0DTC1	ILSPLYAFA is a linear peptidic epitope (epitope ID 1332376) tested in 2 T cell assays.	IEDB	1332376	529	537	ILSPLYAFA	ECO:0000213	PubMed	34506741
P0DTC1	KSAFYILPSIISNEK is a linear peptidic epitope (epitope ID 1332526) tested in 16 T cell assays, 4 B cell assays, 8 MHC ligand assays and has 3D structure(s) 8cmf.	IEDB	1332526	1350	1364	KSAFYILPSIISNEK	ECO:0000213	PubMed	38605956
P0DTC1	STSAFVETV is a linear peptidic epitope (epitope ID 1333818) tested in 8 T cell assays and 10 MHC ligand assays.	IEDB	1333818	483	491	STSAFVETV	ECO:0000213	PubMed	34171305
P0DTC1	TANPKTPKY is a linear peptidic epitope (epitope ID 1333907) tested in 4 T cell assays.	IEDB	1333907	3356	3364	TANPKTPKY	ECO:0000213	PubMed	38781962
P0DTC1	VRIQPGQTF is a linear peptidic epitope (epitope ID 1334276) tested in 2 T cell assays.	IEDB	1334276	3367	3375	VRIQPGQTF	ECO:0000213	PubMed	38781962
P0DTC1	AIMQLFFSY is a linear peptidic epitope (epitope ID 1596897) tested in 1 T cell assay.	IEDB	1596897	2345	2353	AIMQLFFSY	ECO:0000213	PubMed	34506741
P0DTC1	EWFLAYILF is a linear peptidic epitope (epitope ID 1596995) tested in 2 T cell assays.	IEDB	1596995	2326	2334	EWFLAYILF	ECO:0000213	PubMed	34506741
P0DTC1	FCDLKGKYV is a linear peptidic epitope (epitope ID 1597000) tested in 3 T cell assays.	IEDB	1597000	4342	4350	FCDLKGKYV	ECO:0000213	PubMed	34506741
P0DTC1	FLPGVYSVI is a linear peptidic epitope (epitope ID 1597017) tested in 4 T cell assays.	IEDB	1597017	3100	3108	FLPGVYSVI	ECO:0000213	PubMed	34506741
P0DTC1	FVAAIFYLI is a linear peptidic epitope (epitope ID 1597029) tested in 2 T cell assays.	IEDB	1597029	2782	2790	FVAAIFYLI	ECO:0000213	PubMed	34506741
P0DTC1	KLDGFMGRI is a linear peptidic epitope (epitope ID 1597118) tested in 3 T cell assays.	IEDB	1597118	292	300	KLDGFMGRI	ECO:0000213	PubMed	34506741
P0DTC1	QLEMELTPV is a linear peptidic epitope (epitope ID 1597273) tested in 3 T cell assays.	IEDB	1597273	1011	1019	QLEMELTPV	ECO:0000213	PubMed	34506741
P0DTC1	VVCTEIDPK is a linear peptidic epitope (epitope ID 1597420) tested in 1 T cell assay.	IEDB	1597420	1887	1895	VVCTEIDPK	ECO:0000213	PubMed	34506741
P0DTC1	YILFTRFFY is a linear peptidic epitope (epitope ID 1597427) tested in 1 T cell assay.	IEDB	1597427	2331	2339	YILFTRFFY	ECO:0000213	PubMed	34506741
P0DTC1	YLYLTFYLT is a linear peptidic epitope (epitope ID 1597439) tested in 1 T cell assay.	IEDB	1597439	3109	3117	YLYLTFYLT	ECO:0000213	PubMed	34506741
P0DTC1	AGTDTTITV is a linear peptidic epitope (epitope ID 1625569) tested in 1 MHC ligand assay.	IEDB	1625569	3457	3465	AGTDTTITV	ECO:0000213	PubMed	34171305
P0DTC1	HEIAWYTERSE is a linear peptidic epitope (epitope ID 1626302) tested in 1 MHC ligand assay.	IEDB	1626302	236	246	HEIAWYTERSE	ECO:0000213	PubMed	34171305
P0DTC1	LATNNLVVM is a linear peptidic epitope (epitope ID 1626525) tested in 4 T cell assays.	IEDB	1626525	590	598	LATNNLVVM	ECO:0000213	PubMed	34171305
P0DTC1	TAQNSVRVL is a linear peptidic epitope (epitope ID 1627289) tested in 1 MHC ligand assay.	IEDB	1627289	554	562	TAQNSVRVL	ECO:0000213	PubMed	34171305
P0DTC1	TTTIKPVTY is a linear peptidic epitope (epitope ID 1627405) tested in 1 MHC ligand assay.	IEDB	1627405	1874	1882	TTTIKPVTY	ECO:0000213	PubMed	34171305
P0DTC1	TVIEVQGY is a linear peptidic epitope (epitope ID 1627415) tested in 1 MHC ligand assay.	IEDB	1627415	829	836	TVIEVQGY	ECO:0000213	PubMed	34171305
P0DTC1	MVTNNTFTLK is a linear peptidic epitope (epitope ID 2060867) tested in 5 T cell assays and 2 MHC ligand assays.	IEDB	2060867	807	816	MVTNNTFTLK	ECO:0000213	PubMed	35389886
P0DTC1	MVTNNTFTLK is a linear peptidic epitope (epitope ID 2060867) tested in 5 T cell assays and 2 MHC ligand assays.	IEDB	2060867	807	816	MVTNNTFTLK	ECO:0000213	PubMed	36254196
P0DTC1	NDFNLVAMKYNYEPL is a linear peptidic epitope (epitope ID 2125317) tested in 1 T cell assay, 8 B cell assays and 4 MHC ligand assays.	IEDB	2125317	3491	3505	NDFNLVAMKYNYEPL	ECO:0000213	PubMed	38781962
P0DTC1	ASFSASTSAF is a linear peptidic epitope (epitope ID 2259116) tested in 1 T cell assay.	IEDB	2259116	478	487	ASFSASTSAF	ECO:0000213	PubMed	38781962
P0DTC1	DFNLVAMKY is a linear peptidic epitope (epitope ID 2259124) tested in 1 T cell assay.	IEDB	2259124	3492	3500	DFNLVAMKY	ECO:0000213	PubMed	38781962
P0DTC1	FVRIQPGQTF is a linear peptidic epitope (epitope ID 2259169) tested in 1 T cell assay.	IEDB	2259169	3366	3375	FVRIQPGQTF	ECO:0000213	PubMed	38781962
P0DTC1	GRTILGSAL is a linear peptidic epitope (epitope ID 2259177) tested in 1 T cell assay.	IEDB	2259177	3541	3549	GRTILGSAL	ECO:0000213	PubMed	38781962
P0DTC1	IQPGQTFSVL is a linear peptidic epitope (epitope ID 2259180) tested in 1 T cell assay.	IEDB	2259180	3369	3378	IQPGQTFSVL	ECO:0000213	PubMed	38781962
P0DTC1	KLAKKFDTF is a linear peptidic epitope (epitope ID 2259194) tested in 1 T cell assay.	IEDB	2259194	258	266	KLAKKFDTF	ECO:0000213	PubMed	38781962
P0DTC1	SPSGVYQCA is a linear peptidic epitope (epitope ID 2259239) tested in 1 T cell assay.	IEDB	2259239	3384	3392	SPSGVYQCA	ECO:0000213	PubMed	38781962
P0DTC1	VLDMCASLK is a linear peptidic epitope (epitope ID 2259247) tested in 1 T cell assay.	IEDB	2259247	3524	3532	VLDMCASLK	ECO:0000213	PubMed	38781962
P0DTC1	VRQCSGVTF is a linear peptidic epitope (epitope ID 2259251) tested in 1 T cell assay.	IEDB	2259251	3560	3568	VRQCSGVTF	ECO:0000213	PubMed	38781962
P0DTC1	WFLNRFTTTL is a linear peptidic epitope (epitope ID 2259254) tested in 1 T cell assay.	IEDB	2259254	3481	3490	WFLNRFTTTL	ECO:0000213	PubMed	38781962
P0DTC2	AEVQIDRLI is a linear peptidic epitope (epitope ID 1220) tested in 5 T cell assays and 7 MHC ligand assays.	IEDB	1220	989	997	AEVQIDRLI	ECO:0000213	PubMed	35383307
P0DTC2	ALNTLVKQL is a linear peptidic epitope (epitope ID 2801) tested in 41 T cell assays and 7 MHC ligand assays.	IEDB	2801	958	966	ALNTLVKQL	ECO:0000213	PubMed	34222571
P0DTC2	ALNTLVKQL is a linear peptidic epitope (epitope ID 2801) tested in 41 T cell assays and 7 MHC ligand assays.	IEDB	2801	958	966	ALNTLVKQL	ECO:0000213	PubMed	34968416
P0DTC2	ALNTLVKQL is a linear peptidic epitope (epitope ID 2801) tested in 41 T cell assays and 7 MHC ligand assays.	IEDB	2801	958	966	ALNTLVKQL	ECO:0000213	PubMed	38257752
P0DTC2	ALNTLVKQL is a linear peptidic epitope (epitope ID 2801) tested in 41 T cell assays and 7 MHC ligand assays.	IEDB	2801	958	966	ALNTLVKQL	ECO:0000213	PubMed	38605956
P0DTC2	ALNTLVKQL is a linear peptidic epitope (epitope ID 2801) tested in 41 T cell assays and 7 MHC ligand assays.	IEDB	2801	958	966	ALNTLVKQL	ECO:0000213	PubMed	38608022
P0DTC2	ALNTLVKQL is a linear peptidic epitope (epitope ID 2801) tested in 41 T cell assays and 7 MHC ligand assays.	IEDB	2801	958	966	ALNTLVKQL	ECO:0000213	PubMed	33911008
P0DTC2	APHGVVFLHV is a linear peptidic epitope (epitope ID 3589) tested in 1 T cell assay and 5 MHC ligand assays.	IEDB	3589	1056	1065	APHGVVFLHV	ECO:0000213	PubMed	33853928
P0DTC2	AQKFNGLTVLPPLLT is a linear peptidic epitope (epitope ID 3982) tested in 16 T cell assays, 8 B cell assays and 8 MHC ligand assays.	IEDB	3982	852	866	AQKFNGLTVLPPLLT	ECO:0000213	PubMed	35891550
P0DTC2	ASANLAATK is a linear peptidic epitope (epitope ID 4321) tested in 10 T cell assays and 7 MHC ligand assays.	IEDB	4321	1020	1028	ASANLAATK	ECO:0000213	PubMed	34728796
P0DTC2	CVADYSVLY is a linear peptidic epitope (epitope ID 7247) tested in 19 T cell assays, 9 MHC ligand assays and has 3D structure(s) 8xkc.	IEDB	7247	361	369	CVADYSVLY	ECO:0000213	PubMed	34968416
P0DTC2	CVADYSVLY is a linear peptidic epitope (epitope ID 7247) tested in 19 T cell assays, 9 MHC ligand assays and has 3D structure(s) 8xkc.	IEDB	7247	361	369	CVADYSVLY	ECO:0000213	PubMed	35484232
P0DTC2	CVADYSVLY is a linear peptidic epitope (epitope ID 7247) tested in 19 T cell assays, 9 MHC ligand assays and has 3D structure(s) 8xkc.	IEDB	7247	361	369	CVADYSVLY	ECO:0000213	PubMed	36302758
P0DTC2	CVADYSVLY is a linear peptidic epitope (epitope ID 7247) tested in 19 T cell assays, 9 MHC ligand assays and has 3D structure(s) 8xkc.	IEDB	7247	361	369	CVADYSVLY	ECO:0000213	PubMed	37468623
P0DTC2	CVADYSVLY is a linear peptidic epitope (epitope ID 7247) tested in 19 T cell assays, 9 MHC ligand assays and has 3D structure(s) 8xkc.	IEDB	7247	361	369	CVADYSVLY	ECO:0000213	PubMed	38885041
P0DTC2	CVADYSVLY is a linear peptidic epitope (epitope ID 7247) tested in 19 T cell assays, 9 MHC ligand assays and has 3D structure(s) 8xkc.	IEDB	7247	361	369	CVADYSVLY	ECO:0000213	PubMed	37275886
P0DTC2	CVADYSVLY is a linear peptidic epitope (epitope ID 7247) tested in 19 T cell assays, 9 MHC ligand assays and has 3D structure(s) 8xkc.	IEDB	7247	361	369	CVADYSVLY	ECO:0000213	PubMed	33853928
P0DTC2	DDSEPVLKGVKLHYT is a linear peptidic epitope (epitope ID 7868) tested in 10 T cell assays, 22 B cell assays and 8 MHC ligand assays.	IEDB	7868	1259	1273	DDSEPVLKGVKLHYT	ECO:0000213	PubMed	35957961
P0DTC2	DKYFKNHTSPDVDLG is a linear peptidic epitope (epitope ID 9006) tested in 8 T cell assays, 17 B cell assays and 8 MHC ligand assays.	IEDB	9006	1153	1167	DKYFKNHTSPDVDLG	ECO:0000213	PubMed	36646780
P0DTC2	FIAGLIAIV is a linear peptidic epitope (epitope ID 16156) tested in 76 T cell assays and 20 MHC ligand assays.	IEDB	16156	1220	1228	FIAGLIAIV	ECO:0000213	PubMed	33338412
P0DTC2	FIAGLIAIV is a linear peptidic epitope (epitope ID 16156) tested in 76 T cell assays and 20 MHC ligand assays.	IEDB	16156	1220	1228	FIAGLIAIV	ECO:0000213	PubMed	34098342
P0DTC2	FIAGLIAIV is a linear peptidic epitope (epitope ID 16156) tested in 76 T cell assays and 20 MHC ligand assays.	IEDB	16156	1220	1228	FIAGLIAIV	ECO:0000213	PubMed	34210785
P0DTC2	FIAGLIAIV is a linear peptidic epitope (epitope ID 16156) tested in 76 T cell assays and 20 MHC ligand assays.	IEDB	16156	1220	1228	FIAGLIAIV	ECO:0000213	PubMed	34728796
P0DTC2	FIAGLIAIV is a linear peptidic epitope (epitope ID 16156) tested in 76 T cell assays and 20 MHC ligand assays.	IEDB	16156	1220	1228	FIAGLIAIV	ECO:0000213	PubMed	34793243
P0DTC2	FIAGLIAIV is a linear peptidic epitope (epitope ID 16156) tested in 76 T cell assays and 20 MHC ligand assays.	IEDB	16156	1220	1228	FIAGLIAIV	ECO:0000213	PubMed	35104433
P0DTC2	FIAGLIAIV is a linear peptidic epitope (epitope ID 16156) tested in 76 T cell assays and 20 MHC ligand assays.	IEDB	16156	1220	1228	FIAGLIAIV	ECO:0000213	PubMed	35937077
P0DTC2	FIAGLIAIV is a linear peptidic epitope (epitope ID 16156) tested in 76 T cell assays and 20 MHC ligand assays.	IEDB	16156	1220	1228	FIAGLIAIV	ECO:0000213	PubMed	38105139
P0DTC2	FIAGLIAIV is a linear peptidic epitope (epitope ID 16156) tested in 76 T cell assays and 20 MHC ligand assays.	IEDB	16156	1220	1228	FIAGLIAIV	ECO:0000213	PubMed	38539271
P0DTC2	FIAGLIAIV is a linear peptidic epitope (epitope ID 16156) tested in 76 T cell assays and 20 MHC ligand assays.	IEDB	16156	1220	1228	FIAGLIAIV	ECO:0000213	PubMed	38605956
P0DTC2	FIAGLIAIV is a linear peptidic epitope (epitope ID 16156) tested in 76 T cell assays and 20 MHC ligand assays.	IEDB	16156	1220	1228	FIAGLIAIV	ECO:0000213	PubMed	38608022
P0DTC2	FIAGLIAIV is a linear peptidic epitope (epitope ID 16156) tested in 76 T cell assays and 20 MHC ligand assays.	IEDB	16156	1220	1228	FIAGLIAIV	ECO:0000213	PubMed	33911008
P0DTC2	FIAGLIAIV is a linear peptidic epitope (epitope ID 16156) tested in 76 T cell assays and 20 MHC ligand assays.	IEDB	16156	1220	1228	FIAGLIAIV	ECO:0000213	PubMed	32791978
P0DTC2	FIAGLIAIV is a linear peptidic epitope (epitope ID 16156) tested in 76 T cell assays and 20 MHC ligand assays.	IEDB	16156	1220	1228	FIAGLIAIV	ECO:0000213	PubMed	33853928
P0DTC2	GAALQIPFAMQMAYR is a linear peptidic epitope (epitope ID 18514) tested in 11 T cell assays, 18 B cell assays and 10 MHC ligand assays.	IEDB	18514	891	905	GAALQIPFAMQMAYR	ECO:0000213	PubMed	35139340
P0DTC2	GAALQIPFAMQMAYR is a linear peptidic epitope (epitope ID 18514) tested in 11 T cell assays, 18 B cell assays and 10 MHC ligand assays.	IEDB	18514	891	905	GAALQIPFAMQMAYR	ECO:0000213	PubMed	35957961
P0DTC2	GRLQSLQTY is a linear peptidic epitope (epitope ID 22144) tested in 5 T cell assays and 13 MHC ligand assays.	IEDB	22144	999	1007	GRLQSLQTY	ECO:0000213	PubMed	35389886
P0DTC2	GWTFGAGAALQIPFA is a linear peptidic epitope (epitope ID 23293) tested in 15 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	23293	885	899	GWTFGAGAALQIPFA	ECO:0000213	PubMed	35389886
P0DTC2	GWTFGAGAALQIPFA is a linear peptidic epitope (epitope ID 23293) tested in 15 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	23293	885	899	GWTFGAGAALQIPFA	ECO:0000213	PubMed	34061349
P0DTC2	IDRLITGRLQSLQTY is a linear peptidic epitope (epitope ID 25662) tested in 6 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	25662	993	1007	IDRLITGRLQSLQTY	ECO:0000213	PubMed	38716629
P0DTC2	IEDLLFNKVTLADAG is a linear peptidic epitope (epitope ID 25754) tested in 10 T cell assays and 10 MHC ligand assays.	IEDB	25754	818	832	IEDLLFNKVTLADAG	ECO:0000213	PubMed	35389886
P0DTC2	IEDLLFNKVTLADAG is a linear peptidic epitope (epitope ID 25754) tested in 10 T cell assays and 10 MHC ligand assays.	IEDB	25754	818	832	IEDLLFNKVTLADAG	ECO:0000213	PubMed	33220791
P0DTC2	IITTDNTFV is a linear peptidic epitope (epitope ID 26710) tested in 4 T cell assays and 3 MHC ligand assays.	IEDB	26710	1114	1122	IITTDNTFV	ECO:0000213	PubMed	34793243
P0DTC2	ISGINASVVNIQKEI is a linear peptidic epitope (epitope ID 28511) tested in 13 T cell assays, 9 B cell assays and 10 MHC ligand assays.	IEDB	28511	1169	1183	ISGINASVVNIQKEI	ECO:0000213	PubMed	35389886
P0DTC2	ISGINASVVNIQKEI is a linear peptidic epitope (epitope ID 28511) tested in 13 T cell assays, 9 B cell assays and 10 MHC ligand assays.	IEDB	28511	1169	1183	ISGINASVVNIQKEI	ECO:0000213	PubMed	38716629
P0DTC2	KGIYQTSN is a linear peptidic epitope (epitope ID 30987) tested in 2 T cell assays and 7 B cell assays.	IEDB	30987	310	317	KGIYQTSN	ECO:0000213	PubMed	34672530
P0DTC2	KGIYQTSN is a linear peptidic epitope (epitope ID 30987) tested in 2 T cell assays and 7 B cell assays.	IEDB	30987	310	317	KGIYQTSN	ECO:0000213	PubMed	35371042
P0DTC2	LGDISGINASVVNIQ is a linear peptidic epitope (epitope ID 36075) tested in 8 T cell assays, 5 B cell assays and 9 MHC ligand assays.	IEDB	36075	1166	1180	LGDISGINASVVNIQ	ECO:0000213	PubMed	35957961
P0DTC2	LITGRLQSL is a linear peptidic epitope (epitope ID 36724) tested in 25 T cell assays and 2 MHC ligand assays.	IEDB	36724	996	1004	LITGRLQSL	ECO:0000213	PubMed	34793243
P0DTC2	LITGRLQSL is a linear peptidic epitope (epitope ID 36724) tested in 25 T cell assays and 2 MHC ligand assays.	IEDB	36724	996	1004	LITGRLQSL	ECO:0000213	PubMed	38608022
P0DTC2	LLFNKVTLA is a linear peptidic epitope (epitope ID 37289) tested in 28 T cell assays and 14 MHC ligand assays.	IEDB	37289	821	829	LLFNKVTLA	ECO:0000213	PubMed	34725257
P0DTC2	LLFNKVTLA is a linear peptidic epitope (epitope ID 37289) tested in 28 T cell assays and 14 MHC ligand assays.	IEDB	37289	821	829	LLFNKVTLA	ECO:0000213	PubMed	34793243
P0DTC2	LLFNKVTLA is a linear peptidic epitope (epitope ID 37289) tested in 28 T cell assays and 14 MHC ligand assays.	IEDB	37289	821	829	LLFNKVTLA	ECO:0000213	PubMed	35484232
P0DTC2	LLFNKVTLA is a linear peptidic epitope (epitope ID 37289) tested in 28 T cell assays and 14 MHC ligand assays.	IEDB	37289	821	829	LLFNKVTLA	ECO:0000213	PubMed	37193826
P0DTC2	LLFNKVTLA is a linear peptidic epitope (epitope ID 37289) tested in 28 T cell assays and 14 MHC ligand assays.	IEDB	37289	821	829	LLFNKVTLA	ECO:0000213	PubMed	39456150
P0DTC2	LLQYGSFCT is a linear peptidic epitope (epitope ID 37724) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	37724	753	761	LLQYGSFCT	ECO:0000213	PubMed	38866784
P0DTC2	LQDVVNQNAQALNTL is a linear peptidic epitope (epitope ID 38831) tested in 9 MHC ligand assays.	IEDB	38831	948	962	LQDVVNQNAQALNTL	ECO:0000213	PubMed	34004174
P0DTC2	LQIPFAMQM is a linear peptidic epitope (epitope ID 38855) tested in 4 T cell assays and 25 MHC ligand assays.	IEDB	38855	894	902	LQIPFAMQM	ECO:0000213	PubMed	35389886
P0DTC2	LQIPFAMQM is a linear peptidic epitope (epitope ID 38855) tested in 4 T cell assays and 25 MHC ligand assays.	IEDB	38855	894	902	LQIPFAMQM	ECO:0000213	PubMed	38781962
P0DTC2	LQSLQTYVTQQLIRA is a linear peptidic epitope (epitope ID 38990) tested in 19 T cell assays, 24 B cell assays and 8 MHC ligand assays.	IEDB	38990	1001	1015	LQSLQTYVTQQLIRA	ECO:0000213	PubMed	34465633
P0DTC2	LQSLQTYVTQQLIRA is a linear peptidic epitope (epitope ID 38990) tested in 19 T cell assays, 24 B cell assays and 8 MHC ligand assays.	IEDB	38990	1001	1015	LQSLQTYVTQQLIRA	ECO:0000213	PubMed	35389886
P0DTC2	LQSLQTYVTQQLIRA is a linear peptidic epitope (epitope ID 38990) tested in 19 T cell assays, 24 B cell assays and 8 MHC ligand assays.	IEDB	38990	1001	1015	LQSLQTYVTQQLIRA	ECO:0000213	PubMed	35957961
P0DTC2	LQSLQTYVTQQLIRA is a linear peptidic epitope (epitope ID 38990) tested in 19 T cell assays, 24 B cell assays and 8 MHC ligand assays.	IEDB	38990	1001	1015	LQSLQTYVTQQLIRA	ECO:0000213	PubMed	38716629
P0DTC2	LQTYVTQQLIRAAEI is a linear peptidic epitope (epitope ID 39003) tested in 7 T cell assays and 8 MHC ligand assays.	IEDB	39003	1004	1018	LQTYVTQQLIRAAEI	ECO:0000213	PubMed	35389886
P0DTC2	NLNESLIDL is a linear peptidic epitope (epitope ID 44814) tested in 26 T cell assays and 9 MHC ligand assays.	IEDB	44814	1192	1200	NLNESLIDL	ECO:0000213	PubMed	34098342
P0DTC2	NLNESLIDL is a linear peptidic epitope (epitope ID 44814) tested in 26 T cell assays and 9 MHC ligand assays.	IEDB	44814	1192	1200	NLNESLIDL	ECO:0000213	PubMed	34171305
P0DTC2	NLNESLIDL is a linear peptidic epitope (epitope ID 44814) tested in 26 T cell assays and 9 MHC ligand assays.	IEDB	44814	1192	1200	NLNESLIDL	ECO:0000213	PubMed	34793243
P0DTC2	NLNESLIDL is a linear peptidic epitope (epitope ID 44814) tested in 26 T cell assays and 9 MHC ligand assays.	IEDB	44814	1192	1200	NLNESLIDL	ECO:0000213	PubMed	38214610
P0DTC2	NLNESLIDL is a linear peptidic epitope (epitope ID 44814) tested in 26 T cell assays and 9 MHC ligand assays.	IEDB	44814	1192	1200	NLNESLIDL	ECO:0000213	PubMed	38608022
P0DTC2	PYRVVVLSF is a linear peptidic epitope (epitope ID 50166) tested in 9 T cell assays and 8 MHC ligand assays.	IEDB	50166	507	515	PYRVVVLSF	ECO:0000213	PubMed	34728796
P0DTC2	QIPFAMQMAYRFNGI is a linear peptidic epitope (epitope ID 51112) tested in 11 T cell assays, 11 B cell assays and 8 MHC ligand assays.	IEDB	51112	895	909	QIPFAMQMAYRFNGI	ECO:0000213	PubMed	35389886
P0DTC2	QQLIRAAEIRASANL is a linear peptidic epitope (epitope ID 52057) tested in 12 T cell assays and 13 MHC ligand assays.	IEDB	52057	1010	1024	QQLIRAAEIRASANL	ECO:0000213	PubMed	35389886
P0DTC2	QQLIRAAEIRASANL is a linear peptidic epitope (epitope ID 52057) tested in 12 T cell assays and 13 MHC ligand assays.	IEDB	52057	1010	1024	QQLIRAAEIRASANL	ECO:0000213	PubMed	38117652
P0DTC2	QQLIRAAEIRASANL is a linear peptidic epitope (epitope ID 52057) tested in 12 T cell assays and 13 MHC ligand assays.	IEDB	52057	1010	1024	QQLIRAAEIRASANL	ECO:0000213	PubMed	33220791
P0DTC2	QTYVTQQLIRAAEIR is a linear peptidic epitope (epitope ID 52672) tested in 12 T cell assays, 9 B cell assays and 11 MHC ligand assays.	IEDB	52672	1005	1019	QTYVTQQLIRAAEIR	ECO:0000213	PubMed	35389886
P0DTC2	RLDKVEAEV is a linear peptidic epitope (epitope ID 54507) tested in 27 T cell assays and 17 MHC ligand assays.	IEDB	54507	983	991	RLDKVEAEV	ECO:0000213	PubMed	34210785
P0DTC2	RLDKVEAEV is a linear peptidic epitope (epitope ID 54507) tested in 27 T cell assays and 17 MHC ligand assays.	IEDB	54507	983	991	RLDKVEAEV	ECO:0000213	PubMed	34222571
P0DTC2	RLDKVEAEV is a linear peptidic epitope (epitope ID 54507) tested in 27 T cell assays and 17 MHC ligand assays.	IEDB	54507	983	991	RLDKVEAEV	ECO:0000213	PubMed	34725257
P0DTC2	RLDKVEAEV is a linear peptidic epitope (epitope ID 54507) tested in 27 T cell assays and 17 MHC ligand assays.	IEDB	54507	983	991	RLDKVEAEV	ECO:0000213	PubMed	34728796
P0DTC2	RLDKVEAEV is a linear peptidic epitope (epitope ID 54507) tested in 27 T cell assays and 17 MHC ligand assays.	IEDB	54507	983	991	RLDKVEAEV	ECO:0000213	PubMed	34793243
P0DTC2	RLDKVEAEV is a linear peptidic epitope (epitope ID 54507) tested in 27 T cell assays and 17 MHC ligand assays.	IEDB	54507	983	991	RLDKVEAEV	ECO:0000213	PubMed	35937077
P0DTC2	RLDKVEAEV is a linear peptidic epitope (epitope ID 54507) tested in 27 T cell assays and 17 MHC ligand assays.	IEDB	54507	983	991	RLDKVEAEV	ECO:0000213	PubMed	37193826
P0DTC2	RLDKVEAEV is a linear peptidic epitope (epitope ID 54507) tested in 27 T cell assays and 17 MHC ligand assays.	IEDB	54507	983	991	RLDKVEAEV	ECO:0000213	PubMed	38539271
P0DTC2	RLDKVEAEV is a linear peptidic epitope (epitope ID 54507) tested in 27 T cell assays and 17 MHC ligand assays.	IEDB	54507	983	991	RLDKVEAEV	ECO:0000213	PubMed	33853928
P0DTC2	RLNEVAKNL is a linear peptidic epitope (epitope ID 54680) tested in 46 T cell assays and 6 MHC ligand assays.	IEDB	54680	1185	1193	RLNEVAKNL	ECO:0000213	PubMed	33972535
P0DTC2	RLNEVAKNL is a linear peptidic epitope (epitope ID 54680) tested in 46 T cell assays and 6 MHC ligand assays.	IEDB	54680	1185	1193	RLNEVAKNL	ECO:0000213	PubMed	34098342
P0DTC2	RLNEVAKNL is a linear peptidic epitope (epitope ID 54680) tested in 46 T cell assays and 6 MHC ligand assays.	IEDB	54680	1185	1193	RLNEVAKNL	ECO:0000213	PubMed	34793243
P0DTC2	RLNEVAKNL is a linear peptidic epitope (epitope ID 54680) tested in 46 T cell assays and 6 MHC ligand assays.	IEDB	54680	1185	1193	RLNEVAKNL	ECO:0000213	PubMed	35116022
P0DTC2	RLNEVAKNL is a linear peptidic epitope (epitope ID 54680) tested in 46 T cell assays and 6 MHC ligand assays.	IEDB	54680	1185	1193	RLNEVAKNL	ECO:0000213	PubMed	38257752
P0DTC2	RLNEVAKNL is a linear peptidic epitope (epitope ID 54680) tested in 46 T cell assays and 6 MHC ligand assays.	IEDB	54680	1185	1193	RLNEVAKNL	ECO:0000213	PubMed	38539271
P0DTC2	RLNEVAKNL is a linear peptidic epitope (epitope ID 54680) tested in 46 T cell assays and 6 MHC ligand assays.	IEDB	54680	1185	1193	RLNEVAKNL	ECO:0000213	PubMed	38608022
P0DTC2	RLQSLQTYV is a linear peptidic epitope (epitope ID 54725) tested in 76 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1e, 7n1b and 8gom.	IEDB	54725	1000	1008	RLQSLQTYV	ECO:0000213	PubMed	34728796
P0DTC2	RLQSLQTYV is a linear peptidic epitope (epitope ID 54725) tested in 76 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1e, 7n1b and 8gom.	IEDB	54725	1000	1008	RLQSLQTYV	ECO:0000213	PubMed	34793243
P0DTC2	RLQSLQTYV is a linear peptidic epitope (epitope ID 54725) tested in 76 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1e, 7n1b and 8gom.	IEDB	54725	1000	1008	RLQSLQTYV	ECO:0000213	PubMed	35013235
P0DTC2	RLQSLQTYV is a linear peptidic epitope (epitope ID 54725) tested in 76 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1e, 7n1b and 8gom.	IEDB	54725	1000	1008	RLQSLQTYV	ECO:0000213	PubMed	35389886
P0DTC2	RLQSLQTYV is a linear peptidic epitope (epitope ID 54725) tested in 76 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1e, 7n1b and 8gom.	IEDB	54725	1000	1008	RLQSLQTYV	ECO:0000213	PubMed	35484232
P0DTC2	RLQSLQTYV is a linear peptidic epitope (epitope ID 54725) tested in 76 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1e, 7n1b and 8gom.	IEDB	54725	1000	1008	RLQSLQTYV	ECO:0000213	PubMed	36254196
P0DTC2	RLQSLQTYV is a linear peptidic epitope (epitope ID 54725) tested in 76 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1e, 7n1b and 8gom.	IEDB	54725	1000	1008	RLQSLQTYV	ECO:0000213	PubMed	36494499
P0DTC2	RLQSLQTYV is a linear peptidic epitope (epitope ID 54725) tested in 76 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1e, 7n1b and 8gom.	IEDB	54725	1000	1008	RLQSLQTYV	ECO:0000213	PubMed	36806685
P0DTC2	RLQSLQTYV is a linear peptidic epitope (epitope ID 54725) tested in 76 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1e, 7n1b and 8gom.	IEDB	54725	1000	1008	RLQSLQTYV	ECO:0000213	PubMed	38214610
P0DTC2	RLQSLQTYV is a linear peptidic epitope (epitope ID 54725) tested in 76 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1e, 7n1b and 8gom.	IEDB	54725	1000	1008	RLQSLQTYV	ECO:0000213	PubMed	38539271
P0DTC2	RLQSLQTYV is a linear peptidic epitope (epitope ID 54725) tested in 76 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1e, 7n1b and 8gom.	IEDB	54725	1000	1008	RLQSLQTYV	ECO:0000213	PubMed	38605956
P0DTC2	RLQSLQTYV is a linear peptidic epitope (epitope ID 54725) tested in 76 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1e, 7n1b and 8gom.	IEDB	54725	1000	1008	RLQSLQTYV	ECO:0000213	PubMed	38608022
P0DTC2	RLQSLQTYV is a linear peptidic epitope (epitope ID 54725) tested in 76 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1e, 7n1b and 8gom.	IEDB	54725	1000	1008	RLQSLQTYV	ECO:0000213	PubMed	33911008
P0DTC2	RLQSLQTYV is a linear peptidic epitope (epitope ID 54725) tested in 76 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1e, 7n1b and 8gom.	IEDB	54725	1000	1008	RLQSLQTYV	ECO:0000213	PubMed	32791978
P0DTC2	RLQSLQTYV is a linear peptidic epitope (epitope ID 54725) tested in 76 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1e, 7n1b and 8gom.	IEDB	54725	1000	1008	RLQSLQTYV	ECO:0000213	PubMed	34044428
P0DTC2	SEPVLKGVKL is a linear peptidic epitope (epitope ID 57592) tested in 10 T cell assays and 6 MHC ligand assays.	IEDB	57592	1261	1270	SEPVLKGVKL	ECO:0000213	PubMed	35389886
P0DTC2	SFIEDLLFNK is a linear peptidic epitope (epitope ID 57792) tested in 6 MHC ligand assays.	IEDB	57792	816	825	SFIEDLLFNK	ECO:0000213	PubMed	34004174
P0DTC2	SLIDLQELGK is a linear peptidic epitope (epitope ID 59161) tested in 2 T cell assays and 6 MHC ligand assays.	IEDB	59161	1196	1205	SLIDLQELGK	ECO:0000213	PubMed	34728796
P0DTC2	SPDVDLGDISGINAS is a linear peptidic epitope (epitope ID 60024) tested in 14 T cell assays, 32 B cell assays and 7 MHC ligand assays.	IEDB	60024	1161	1175	SPDVDLGDISGINAS	ECO:0000213	PubMed	35957961
P0DTC2	SSNFGAISSVLNDIL is a linear peptidic epitope (epitope ID 61229) tested in 22 T cell assays, 10 B cell assays and 9 MHC ligand assays.	IEDB	61229	967	981	SSNFGAISSVLNDIL	ECO:0000213	PubMed	35891550
P0DTC2	VLNDILSRL is a linear peptidic epitope (epitope ID 69657) tested in 68 T cell assays, 20 MHC ligand assays and has 3D structure(s) 7sis.	IEDB	69657	976	984	VLNDILSRL	ECO:0000213	PubMed	34098342
P0DTC2	VLNDILSRL is a linear peptidic epitope (epitope ID 69657) tested in 68 T cell assays, 20 MHC ligand assays and has 3D structure(s) 7sis.	IEDB	69657	976	984	VLNDILSRL	ECO:0000213	PubMed	34210785
P0DTC2	VLNDILSRL is a linear peptidic epitope (epitope ID 69657) tested in 68 T cell assays, 20 MHC ligand assays and has 3D structure(s) 7sis.	IEDB	69657	976	984	VLNDILSRL	ECO:0000213	PubMed	34793243
P0DTC2	VLNDILSRL is a linear peptidic epitope (epitope ID 69657) tested in 68 T cell assays, 20 MHC ligand assays and has 3D structure(s) 7sis.	IEDB	69657	976	984	VLNDILSRL	ECO:0000213	PubMed	35139340
P0DTC2	VLNDILSRL is a linear peptidic epitope (epitope ID 69657) tested in 68 T cell assays, 20 MHC ligand assays and has 3D structure(s) 7sis.	IEDB	69657	976	984	VLNDILSRL	ECO:0000213	PubMed	35937077
P0DTC2	VLNDILSRL is a linear peptidic epitope (epitope ID 69657) tested in 68 T cell assays, 20 MHC ligand assays and has 3D structure(s) 7sis.	IEDB	69657	976	984	VLNDILSRL	ECO:0000213	PubMed	38105139
P0DTC2	VLNDILSRL is a linear peptidic epitope (epitope ID 69657) tested in 68 T cell assays, 20 MHC ligand assays and has 3D structure(s) 7sis.	IEDB	69657	976	984	VLNDILSRL	ECO:0000213	PubMed	38214610
P0DTC2	VLNDILSRL is a linear peptidic epitope (epitope ID 69657) tested in 68 T cell assays, 20 MHC ligand assays and has 3D structure(s) 7sis.	IEDB	69657	976	984	VLNDILSRL	ECO:0000213	PubMed	38605956
P0DTC2	VLNDILSRL is a linear peptidic epitope (epitope ID 69657) tested in 68 T cell assays, 20 MHC ligand assays and has 3D structure(s) 7sis.	IEDB	69657	976	984	VLNDILSRL	ECO:0000213	PubMed	38608022
P0DTC2	VLNDILSRL is a linear peptidic epitope (epitope ID 69657) tested in 68 T cell assays, 20 MHC ligand assays and has 3D structure(s) 7sis.	IEDB	69657	976	984	VLNDILSRL	ECO:0000213	PubMed	33911008
P0DTC2	VLNDILSRL is a linear peptidic epitope (epitope ID 69657) tested in 68 T cell assays, 20 MHC ligand assays and has 3D structure(s) 7sis.	IEDB	69657	976	984	VLNDILSRL	ECO:0000213	PubMed	32913053
P0DTC2	VLNDILSRL is a linear peptidic epitope (epitope ID 69657) tested in 68 T cell assays, 20 MHC ligand assays and has 3D structure(s) 7sis.	IEDB	69657	976	984	VLNDILSRL	ECO:0000213	PubMed	33853928
P0DTC2	VNFNFNGL is a linear peptidic epitope (epitope ID 70066) tested in 45 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	70066	539	546	VNFNFNGL	ECO:0000213	PubMed	35561224
P0DTC2	VNFNFNGL is a linear peptidic epitope (epitope ID 70066) tested in 45 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	70066	539	546	VNFNFNGL	ECO:0000213	PubMed	35803932
P0DTC2	VNFNFNGL is a linear peptidic epitope (epitope ID 70066) tested in 45 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	70066	539	546	VNFNFNGL	ECO:0000213	PubMed	37036004
P0DTC2	VNFNFNGL is a linear peptidic epitope (epitope ID 70066) tested in 45 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	70066	539	546	VNFNFNGL	ECO:0000213	PubMed	37886945
P0DTC2	VRFPNITNL is a linear peptidic epitope (epitope ID 70718) tested in 10 T cell assays and 16 MHC ligand assays.	IEDB	70718	327	335	VRFPNITNL	ECO:0000213	PubMed	35389886
P0DTC2	VVFLHVTYV is a linear peptidic epitope (epitope ID 71663) tested in 37 T cell assays and 20 MHC ligand assays.	IEDB	71663	1060	1068	VVFLHVTYV	ECO:0000213	PubMed	34793243
P0DTC2	VVFLHVTYV is a linear peptidic epitope (epitope ID 71663) tested in 37 T cell assays and 20 MHC ligand assays.	IEDB	71663	1060	1068	VVFLHVTYV	ECO:0000213	PubMed	34968416
P0DTC2	VVFLHVTYV is a linear peptidic epitope (epitope ID 71663) tested in 37 T cell assays and 20 MHC ligand assays.	IEDB	71663	1060	1068	VVFLHVTYV	ECO:0000213	PubMed	35116022
P0DTC2	VVFLHVTYV is a linear peptidic epitope (epitope ID 71663) tested in 37 T cell assays and 20 MHC ligand assays.	IEDB	71663	1060	1068	VVFLHVTYV	ECO:0000213	PubMed	35139340
P0DTC2	VVFLHVTYV is a linear peptidic epitope (epitope ID 71663) tested in 37 T cell assays and 20 MHC ligand assays.	IEDB	71663	1060	1068	VVFLHVTYV	ECO:0000213	PubMed	35389886
P0DTC2	VVFLHVTYV is a linear peptidic epitope (epitope ID 71663) tested in 37 T cell assays and 20 MHC ligand assays.	IEDB	71663	1060	1068	VVFLHVTYV	ECO:0000213	PubMed	35937077
P0DTC2	VVFLHVTYV is a linear peptidic epitope (epitope ID 71663) tested in 37 T cell assays and 20 MHC ligand assays.	IEDB	71663	1060	1068	VVFLHVTYV	ECO:0000213	PubMed	38105139
P0DTC2	VVFLHVTYV is a linear peptidic epitope (epitope ID 71663) tested in 37 T cell assays and 20 MHC ligand assays.	IEDB	71663	1060	1068	VVFLHVTYV	ECO:0000213	PubMed	38608022
P0DTC2	VVFLHVTYV is a linear peptidic epitope (epitope ID 71663) tested in 37 T cell assays and 20 MHC ligand assays.	IEDB	71663	1060	1068	VVFLHVTYV	ECO:0000213	PubMed	38781962
P0DTC2	VVFLHVTYV is a linear peptidic epitope (epitope ID 71663) tested in 37 T cell assays and 20 MHC ligand assays.	IEDB	71663	1060	1068	VVFLHVTYV	ECO:0000213	PubMed	38866784
P0DTC2	VVFLHVTYV is a linear peptidic epitope (epitope ID 71663) tested in 37 T cell assays and 20 MHC ligand assays.	IEDB	71663	1060	1068	VVFLHVTYV	ECO:0000213	PubMed	33427749
P0DTC2	VVFLHVTYV is a linear peptidic epitope (epitope ID 71663) tested in 37 T cell assays and 20 MHC ligand assays.	IEDB	71663	1060	1068	VVFLHVTYV	ECO:0000213	PubMed	33853928
P0DTC2	VVNIQKEIDRLNEV is a linear peptidic epitope (epitope ID 71771) tested in 1 T cell assay, 1 B cell assay and 1 MHC ligand assay.	IEDB	71771	1176	1189	VVNIQKEIDRLNEV	ECO:0000213	PubMed	33220791
P0DTC2	VYDPLQPEL is a linear peptidic epitope (epitope ID 71996) tested in 4 T cell assays and 16 MHC ligand assays.	IEDB	71996	1137	1145	VYDPLQPEL	ECO:0000213	PubMed	34222571
P0DTC2	ASVVNIQKEIDRLNE is a linear peptidic epitope (epitope ID 530936) tested in 1 T cell assay, 6 B cell assays and 8 MHC ligand assays.	IEDB	530936	1174	1188	ASVVNIQKEIDRLNE	ECO:0000213	PubMed	33220791
P0DTC2	KEELDKYFKNHTSPD is a linear peptidic epitope (epitope ID 532384) tested in 6 T cell assays, 11 B cell assays and 7 MHC ligand assays.	IEDB	532384	1149	1163	KEELDKYFKNHTSPD	ECO:0000213	PubMed	36646780
P0DTC2	KEELDKYFKNHTSPD is a linear peptidic epitope (epitope ID 532384) tested in 6 T cell assays, 11 B cell assays and 7 MHC ligand assays.	IEDB	532384	1149	1163	KEELDKYFKNHTSPD	ECO:0000213	PubMed	34061349
P0DTC2	LQIPFAMQMAYRFNG is a linear peptidic epitope (epitope ID 532839) tested in 1 T cell assay and 8 MHC ligand assays.	IEDB	532839	894	908	LQIPFAMQMAYRFNG	ECO:0000213	PubMed	38117652
P0DTC2	NFGAISSVLNDILSR is a linear peptidic epitope (epitope ID 533050) tested in 8 T cell assays, 9 B cell assays and 10 MHC ligand assays.	IEDB	533050	969	983	NFGAISSVLNDILSR	ECO:0000213	PubMed	34465633
P0DTC2	RAAEIRASANLAATK is a linear peptidic epitope (epitope ID 533447) tested in 1 T cell assay and 11 MHC ligand assays.	IEDB	533447	1014	1028	RAAEIRASANLAATK	ECO:0000213	PubMed	33220791
P0DTC2	SCGSCCKFDEDDSEP is a linear peptidic epitope (epitope ID 533643) tested in 6 T cell assays, 17 B cell assays and 7 MHC ligand assays.	IEDB	533643	1249	1263	SCGSCCKFDEDDSEP	ECO:0000213	PubMed	36646780
P0DTC2	TQQLIRAAEIRASAN is a linear peptidic epitope (epitope ID 534141) tested in 6 T cell assays, 15 B cell assays and 11 MHC ligand assays.	IEDB	534141	1009	1023	TQQLIRAAEIRASAN	ECO:0000213	PubMed	38117652
P0DTC2	ADSFVIRGDEVRQIA is a linear peptidic epitope (epitope ID 1068879) tested in 7 T cell assays, 20 B cell assays and 9 MHC ligand assays.	IEDB	1068879	397	411	ADSFVIRGDEVRQIA	ECO:0000213	PubMed	34756082
P0DTC2	AQYTSALLAGTITSG is a linear peptidic epitope (epitope ID 1069137) tested in 19 T cell assays, 24 B cell assays and 7 MHC ligand assays.	IEDB	1069137	871	885	AQYTSALLAGTITSG	ECO:0000213	PubMed	35139340
P0DTC2	AQYTSALLAGTITSG is a linear peptidic epitope (epitope ID 1069137) tested in 19 T cell assays, 24 B cell assays and 7 MHC ligand assays.	IEDB	1069137	871	885	AQYTSALLAGTITSG	ECO:0000213	PubMed	35957961
P0DTC2	AQYTSALLAGTITSG is a linear peptidic epitope (epitope ID 1069137) tested in 19 T cell assays, 24 B cell assays and 7 MHC ligand assays.	IEDB	1069137	871	885	AQYTSALLAGTITSG	ECO:0000213	PubMed	38781962
P0DTC2	CTLKSFTVEKGIYQT is a linear peptidic epitope (epitope ID 1069290) tested in 16 T cell assays, 31 B cell assays and 8 MHC ligand assays.	IEDB	1069290	301	315	CTLKSFTVEKGIYQT	ECO:0000213	PubMed	35957961
P0DTC2	CTLKSFTVEKGIYQT is a linear peptidic epitope (epitope ID 1069290) tested in 16 T cell assays, 31 B cell assays and 8 MHC ligand assays.	IEDB	1069290	301	315	CTLKSFTVEKGIYQT	ECO:0000213	PubMed	38781962
P0DTC2	CVADYSVLYNSASFS is a linear peptidic epitope (epitope ID 1069291) tested in 24 T cell assays, 34 B cell assays and 9 MHC ligand assays.	IEDB	1069291	361	375	CVADYSVLYNSASFS	ECO:0000213	PubMed	35957961
P0DTC2	CVADYSVLYNSASFS is a linear peptidic epitope (epitope ID 1069291) tested in 24 T cell assays, 34 B cell assays and 9 MHC ligand assays.	IEDB	1069291	361	375	CVADYSVLYNSASFS	ECO:0000213	PubMed	38781962
P0DTC2	DSTECSNLLLQYGSF is a linear peptidic epitope (epitope ID 1069347) tested in 7 T cell assays, 15 B cell assays and 9 MHC ligand assays.	IEDB	1069347	745	759	DSTECSNLLLQYGSF	ECO:0000213	PubMed	34805136
P0DTC2	DTTDAVRDPQTLEIL is a linear peptidic epitope (epitope ID 1069350) tested in 11 T cell assays, 28 B cell assays and 7 MHC ligand assays.	IEDB	1069350	571	585	DTTDAVRDPQTLEIL	ECO:0000213	PubMed	35957961
P0DTC2	ECDIPIGAGICASYQ is a linear peptidic epitope (epitope ID 1069378) tested in 19 T cell assays, 36 B cell assays and 7 MHC ligand assays.	IEDB	1069378	661	675	ECDIPIGAGICASYQ	ECO:0000213	PubMed	35957961
P0DTC2	ECDIPIGAGICASYQ is a linear peptidic epitope (epitope ID 1069378) tested in 19 T cell assays, 36 B cell assays and 7 MHC ligand assays.	IEDB	1069378	661	675	ECDIPIGAGICASYQ	ECO:0000213	PubMed	36646780
P0DTC2	ECDIPIGAGICASYQ is a linear peptidic epitope (epitope ID 1069378) tested in 19 T cell assays, 36 B cell assays and 7 MHC ligand assays.	IEDB	1069378	661	675	ECDIPIGAGICASYQ	ECO:0000213	PubMed	38781962
P0DTC2	ECDIPIGAGICASYQ is a linear peptidic epitope (epitope ID 1069378) tested in 19 T cell assays, 36 B cell assays and 7 MHC ligand assays.	IEDB	1069378	661	675	ECDIPIGAGICASYQ	ECO:0000213	PubMed	34061349
P0DTC2	EPQIITTDNTFVSGN is a linear peptidic epitope (epitope ID 1069445) tested in 13 T cell assays, 24 B cell assays and 13 MHC ligand assays.	IEDB	1069445	1111	1125	EPQIITTDNTFVSGN	ECO:0000213	PubMed	35139340
P0DTC2	EPQIITTDNTFVSGN is a linear peptidic epitope (epitope ID 1069445) tested in 13 T cell assays, 24 B cell assays and 13 MHC ligand assays.	IEDB	1069445	1111	1125	EPQIITTDNTFVSGN	ECO:0000213	PubMed	35957961
P0DTC2	EPQIITTDNTFVSGN is a linear peptidic epitope (epitope ID 1069445) tested in 13 T cell assays, 24 B cell assays and 13 MHC ligand assays.	IEDB	1069445	1111	1125	EPQIITTDNTFVSGN	ECO:0000213	PubMed	38117652
P0DTC2	EPQIITTDNTFVSGN is a linear peptidic epitope (epitope ID 1069445) tested in 13 T cell assays, 24 B cell assays and 13 MHC ligand assays.	IEDB	1069445	1111	1125	EPQIITTDNTFVSGN	ECO:0000213	PubMed	38781962
P0DTC2	EPQIITTDNTFVSGN is a linear peptidic epitope (epitope ID 1069445) tested in 13 T cell assays, 24 B cell assays and 13 MHC ligand assays.	IEDB	1069445	1111	1125	EPQIITTDNTFVSGN	ECO:0000213	PubMed	33220791
P0DTC2	FIEDLLFNKVTLADA is a linear peptidic epitope (epitope ID 1069521) tested in 8 T cell assays, 18 B cell assays and 7 MHC ligand assays.	IEDB	1069521	817	831	FIEDLLFNKVTLADA	ECO:0000213	PubMed	34465633
P0DTC2	FIEDLLFNKVTLADA is a linear peptidic epitope (epitope ID 1069521) tested in 8 T cell assays, 18 B cell assays and 7 MHC ligand assays.	IEDB	1069521	817	831	FIEDLLFNKVTLADA	ECO:0000213	PubMed	36646780
P0DTC2	FIEDLLFNKVTLADA is a linear peptidic epitope (epitope ID 1069521) tested in 8 T cell assays, 18 B cell assays and 7 MHC ligand assays.	IEDB	1069521	817	831	FIEDLLFNKVTLADA	ECO:0000213	PubMed	38716629
P0DTC2	FNFNGLTGTGVLTES is a linear peptidic epitope (epitope ID 1069550) tested in 20 T cell assays, 29 B cell assays and 9 MHC ligand assays.	IEDB	1069550	541	555	FNFNGLTGTGVLTES	ECO:0000213	PubMed	35139340
P0DTC2	FNFNGLTGTGVLTES is a linear peptidic epitope (epitope ID 1069550) tested in 20 T cell assays, 29 B cell assays and 9 MHC ligand assays.	IEDB	1069550	541	555	FNFNGLTGTGVLTES	ECO:0000213	PubMed	35957961
P0DTC2	FNFNGLTGTGVLTES is a linear peptidic epitope (epitope ID 1069550) tested in 20 T cell assays, 29 B cell assays and 9 MHC ligand assays.	IEDB	1069550	541	555	FNFNGLTGTGVLTES	ECO:0000213	PubMed	34061349
P0DTC2	GINASVVNIQKEIDR is a linear peptidic epitope (epitope ID 1069816) tested in 20 T cell assays, 24 B cell assays and 10 MHC ligand assays.	IEDB	1069816	1171	1185	GINASVVNIQKEIDR	ECO:0000213	PubMed	35957961
P0DTC2	GINASVVNIQKEIDR is a linear peptidic epitope (epitope ID 1069816) tested in 20 T cell assays, 24 B cell assays and 10 MHC ligand assays.	IEDB	1069816	1171	1185	GINASVVNIQKEIDR	ECO:0000213	PubMed	33220791
P0DTC2	GKQGNFKNLREFVFK is a linear peptidic epitope (epitope ID 1069822) tested in 18 T cell assays, 30 B cell assays and 8 MHC ligand assays.	IEDB	1069822	181	195	GKQGNFKNLREFVFK	ECO:0000213	PubMed	34004174
P0DTC2	GKQGNFKNLREFVFK is a linear peptidic epitope (epitope ID 1069822) tested in 18 T cell assays, 30 B cell assays and 8 MHC ligand assays.	IEDB	1069822	181	195	GKQGNFKNLREFVFK	ECO:0000213	PubMed	35957961
P0DTC2	GTNTSNQVAVLYQDV is a linear peptidic epitope (epitope ID 1070035) tested in 13 T cell assays, 29 B cell assays and 10 MHC ligand assays.	IEDB	1070035	601	615	GTNTSNQVAVLYQDV	ECO:0000213	PubMed	38781962
P0DTC2	IAIVMVTIMLCCMTS is a linear peptidic epitope (epitope ID 1070307) tested in 6 T cell assays, 15 B cell assays and 7 MHC ligand assays.	IEDB	1070307	1225	1239	IAIVMVTIMLCCMTS	ECO:0000213	PubMed	34329696
P0DTC2	ICHDGKAHFPREGVF is a linear peptidic epitope (epitope ID 1070308) tested in 18 T cell assays, 29 B cell assays and 7 MHC ligand assays.	IEDB	1070308	1081	1095	ICHDGKAHFPREGVF	ECO:0000213	PubMed	38781962
P0DTC2	IGKIQDSLSSTASAL is a linear peptidic epitope (epitope ID 1070353) tested in 14 T cell assays, 24 B cell assays and 10 MHC ligand assays.	IEDB	1070353	931	945	IGKIQDSLSSTASAL	ECO:0000213	PubMed	35957961
P0DTC2	IGKIQDSLSSTASAL is a linear peptidic epitope (epitope ID 1070353) tested in 14 T cell assays, 24 B cell assays and 10 MHC ligand assays.	IEDB	1070353	931	945	IGKIQDSLSSTASAL	ECO:0000213	PubMed	38781962
P0DTC2	KPSKRSFIEDLLFNK is a linear peptidic epitope (epitope ID 1070803) tested in 25 T cell assays, 200 B cell assays, 18 MHC ligand assays and has 3D structure(s) 7skz, 7u0a, 7u0e, 7u09 and 7sl5.	IEDB	1070803	811	825	KPSKRSFIEDLLFNK	ECO:0000213	PubMed	35957961
P0DTC2	KSNIIRGWIFGTTLD is a linear peptidic epitope (epitope ID 1070815) tested in 6 T cell assays, 15 B cell assays and 7 MHC ligand assays.	IEDB	1070815	97	111	KSNIIRGWIFGTTLD	ECO:0000213	PubMed	38716629
P0DTC2	LGDIAARDLICAQKF is a linear peptidic epitope (epitope ID 1071133) tested in 19 T cell assays, 29 B cell assays and 8 MHC ligand assays.	IEDB	1071133	841	855	LGDIAARDLICAQKF	ECO:0000213	PubMed	35957961
P0DTC2	LGDIAARDLICAQKF is a linear peptidic epitope (epitope ID 1071133) tested in 19 T cell assays, 29 B cell assays and 8 MHC ligand assays.	IEDB	1071133	841	855	LGDIAARDLICAQKF	ECO:0000213	PubMed	38716629
P0DTC2	LLHAPATVCGPKKST is a linear peptidic epitope (epitope ID 1071268) tested in 6 T cell assays, 20 B cell assays and 7 MHC ligand assays.	IEDB	1071268	517	531	LLHAPATVCGPKKST	ECO:0000213	PubMed	34756082
P0DTC2	LTDEMIAQYTSALLA is a linear peptidic epitope (epitope ID 1071338) tested in 9 T cell assays, 15 B cell assays and 9 MHC ligand assays.	IEDB	1071338	865	879	LTDEMIAQYTSALLA	ECO:0000213	PubMed	34805136
P0DTC2	LTDEMIAQYTSALLA is a linear peptidic epitope (epitope ID 1071338) tested in 9 T cell assays, 15 B cell assays and 9 MHC ligand assays.	IEDB	1071338	865	879	LTDEMIAQYTSALLA	ECO:0000213	PubMed	35157735
P0DTC2	LTDEMIAQYTSALLA is a linear peptidic epitope (epitope ID 1071338) tested in 9 T cell assays, 15 B cell assays and 9 MHC ligand assays.	IEDB	1071338	865	879	LTDEMIAQYTSALLA	ECO:0000213	PubMed	38105139
P0DTC2	LTDEMIAQYTSALLA is a linear peptidic epitope (epitope ID 1071338) tested in 9 T cell assays, 15 B cell assays and 9 MHC ligand assays.	IEDB	1071338	865	879	LTDEMIAQYTSALLA	ECO:0000213	PubMed	38117652
P0DTC2	NCYFPLQSYGFQPTN is a linear peptidic epitope (epitope ID 1071518) tested in 2 T cell assays, 15 B cell assays and 10 MHC ligand assays.	IEDB	1071518	487	501	NCYFPLQSYGFQPTN	ECO:0000213	PubMed	34630356
P0DTC2	NGVEGFNCYFPLQSY is a linear peptidic epitope (epitope ID 1071575) tested in 24 T cell assays, 41 B cell assays and 9 MHC ligand assays.	IEDB	1071575	481	495	NGVEGFNCYFPLQSY	ECO:0000213	PubMed	34162945
P0DTC2	NGVEGFNCYFPLQSY is a linear peptidic epitope (epitope ID 1071575) tested in 24 T cell assays, 41 B cell assays and 9 MHC ligand assays.	IEDB	1071575	481	495	NGVEGFNCYFPLQSY	ECO:0000213	PubMed	35957961
P0DTC2	NLLLQYGSFCTQLNR is a linear peptidic epitope (epitope ID 1071580) tested in 26 T cell assays, 24 B cell assays and 26 MHC ligand assays.	IEDB	1071580	751	765	NLLLQYGSFCTQLNR	ECO:0000213	PubMed	34729465
P0DTC2	NLLLQYGSFCTQLNR is a linear peptidic epitope (epitope ID 1071580) tested in 26 T cell assays, 24 B cell assays and 26 MHC ligand assays.	IEDB	1071580	751	765	NLLLQYGSFCTQLNR	ECO:0000213	PubMed	35139340
P0DTC2	NLLLQYGSFCTQLNR is a linear peptidic epitope (epitope ID 1071580) tested in 26 T cell assays, 24 B cell assays and 26 MHC ligand assays.	IEDB	1071580	751	765	NLLLQYGSFCTQLNR	ECO:0000213	PubMed	35484232
P0DTC2	NLLLQYGSFCTQLNR is a linear peptidic epitope (epitope ID 1071580) tested in 26 T cell assays, 24 B cell assays and 26 MHC ligand assays.	IEDB	1071580	751	765	NLLLQYGSFCTQLNR	ECO:0000213	PubMed	35957961
P0DTC2	NLLLQYGSFCTQLNR is a linear peptidic epitope (epitope ID 1071580) tested in 26 T cell assays, 24 B cell assays and 26 MHC ligand assays.	IEDB	1071580	751	765	NLLLQYGSFCTQLNR	ECO:0000213	PubMed	38105139
P0DTC2	NLLLQYGSFCTQLNR is a linear peptidic epitope (epitope ID 1071580) tested in 26 T cell assays, 24 B cell assays and 26 MHC ligand assays.	IEDB	1071580	751	765	NLLLQYGSFCTQLNR	ECO:0000213	PubMed	33220791
P0DTC2	NLVRDLPQGFSALEP is a linear peptidic epitope (epitope ID 1071585) tested in 20 T cell assays, 24 B cell assays and 22 MHC ligand assays.	IEDB	1071585	211	225	NLVRDLPQGFSALEP	ECO:0000213	PubMed	35484232
P0DTC2	NLVRDLPQGFSALEP is a linear peptidic epitope (epitope ID 1071585) tested in 20 T cell assays, 24 B cell assays and 22 MHC ligand assays.	IEDB	1071585	211	225	NLVRDLPQGFSALEP	ECO:0000213	PubMed	35957961
P0DTC2	NNATNVVIKVCEFQF is a linear peptidic epitope (epitope ID 1071586) tested in 18 T cell assays, 30 B cell assays and 8 MHC ligand assays.	IEDB	1071586	121	135	NNATNVVIKVCEFQF	ECO:0000213	PubMed	35957961
P0DTC2	NNATNVVIKVCEFQF is a linear peptidic epitope (epitope ID 1071586) tested in 18 T cell assays, 30 B cell assays and 8 MHC ligand assays.	IEDB	1071586	121	135	NNATNVVIKVCEFQF	ECO:0000213	PubMed	38781962
P0DTC2	PPAYTNSFTRGVYYP is a linear peptidic epitope (epitope ID 1071788) tested in 11 T cell assays, 19 B cell assays and 7 MHC ligand assays.	IEDB	1071788	25	39	PPAYTNSFTRGVYYP	ECO:0000213	PubMed	36646780
P0DTC2	PPAYTNSFTRGVYYP is a linear peptidic epitope (epitope ID 1071788) tested in 11 T cell assays, 19 B cell assays and 7 MHC ligand assays.	IEDB	1071788	25	39	PPAYTNSFTRGVYYP	ECO:0000213	PubMed	38716629
P0DTC2	PPAYTNSFTRGVYYP is a linear peptidic epitope (epitope ID 1071788) tested in 11 T cell assays, 19 B cell assays and 7 MHC ligand assays.	IEDB	1071788	25	39	PPAYTNSFTRGVYYP	ECO:0000213	PubMed	34061349
P0DTC2	PTWRVYSTGSNVFQT is a linear peptidic epitope (epitope ID 1071818) tested in 13 T cell assays, 25 B cell assays and 7 MHC ligand assays.	IEDB	1071818	631	645	PTWRVYSTGSNVFQT	ECO:0000213	PubMed	35957961
P0DTC2	PWYIWLGFIAGLIAI is a linear peptidic epitope (epitope ID 1071825) tested in 6 T cell assays, 15 B cell assays and 7 MHC ligand assays.	IEDB	1071825	1213	1227	PWYIWLGFIAGLIAI	ECO:0000213	PubMed	34329696
P0DTC2	QMAYRFNGIGVTQNV is a linear peptidic epitope (epitope ID 1071978) tested in 21 T cell assays, 29 B cell assays and 9 MHC ligand assays.	IEDB	1071978	901	915	QMAYRFNGIGVTQNV	ECO:0000213	PubMed	35139340
P0DTC2	QMAYRFNGIGVTQNV is a linear peptidic epitope (epitope ID 1071978) tested in 21 T cell assays, 29 B cell assays and 9 MHC ligand assays.	IEDB	1071978	901	915	QMAYRFNGIGVTQNV	ECO:0000213	PubMed	35957961
P0DTC2	QMAYRFNGIGVTQNV is a linear peptidic epitope (epitope ID 1071978) tested in 21 T cell assays, 29 B cell assays and 9 MHC ligand assays.	IEDB	1071978	901	915	QMAYRFNGIGVTQNV	ECO:0000213	PubMed	38781962
P0DTC2	RDPQTLEILDITPCS is a linear peptidic epitope (epitope ID 1072118) tested in 5 T cell assays, 17 B cell assays and 10 MHC ligand assays.	IEDB	1072118	577	591	RDPQTLEILDITPCS	ECO:0000213	PubMed	36646780
P0DTC2	RKSNLKPFERDISTE is a linear peptidic epitope (epitope ID 1072366) tested in 6 T cell assays, 20 B cell assays and 8 MHC ligand assays.	IEDB	1072366	457	471	RKSNLKPFERDISTE	ECO:0000213	PubMed	34756082
P0DTC2	SANLAATKMSECVLG is a linear peptidic epitope (epitope ID 1072541) tested in 18 T cell assays, 29 B cell assays and 7 MHC ligand assays.	IEDB	1072541	1021	1035	SANLAATKMSECVLG	ECO:0000213	PubMed	35957961
P0DTC2	SFPQSAPHGVVFLHV is a linear peptidic epitope (epitope ID 1072604) tested in 14 T cell assays, 24 B cell assays and 7 MHC ligand assays.	IEDB	1072604	1051	1065	SFPQSAPHGVVFLHV	ECO:0000213	PubMed	35957961
P0DTC2	SFTRGVYYPDKVFRS is a linear peptidic epitope (epitope ID 1072624) tested in 13 T cell assays, 25 B cell assays and 8 MHC ligand assays.	IEDB	1072624	31	45	SFTRGVYYPDKVFRS	ECO:0000213	PubMed	35139340
P0DTC2	SFTRGVYYPDKVFRS is a linear peptidic epitope (epitope ID 1072624) tested in 13 T cell assays, 25 B cell assays and 8 MHC ligand assays.	IEDB	1072624	31	45	SFTRGVYYPDKVFRS	ECO:0000213	PubMed	35957961
P0DTC2	SFTRGVYYPDKVFRS is a linear peptidic epitope (epitope ID 1072624) tested in 13 T cell assays, 25 B cell assays and 8 MHC ligand assays.	IEDB	1072624	31	45	SFTRGVYYPDKVFRS	ECO:0000213	PubMed	38781962
P0DTC2	TDNTFVSGNCDVVIG is a linear peptidic epitope (epitope ID 1073276) tested in 7 T cell assays, 15 B cell assays and 11 MHC ligand assays.	IEDB	1073276	1117	1131	TDNTFVSGNCDVVIG	ECO:0000213	PubMed	38716629
P0DTC2	TDNTFVSGNCDVVIG is a linear peptidic epitope (epitope ID 1073276) tested in 7 T cell assays, 15 B cell assays and 11 MHC ligand assays.	IEDB	1073276	1117	1131	TDNTFVSGNCDVVIG	ECO:0000213	PubMed	34061349
P0DTC2	TDNTFVSGNCDVVIG is a linear peptidic epitope (epitope ID 1073276) tested in 7 T cell assays, 15 B cell assays and 11 MHC ligand assays.	IEDB	1073276	1117	1131	TDNTFVSGNCDVVIG	ECO:0000213	PubMed	33220791
P0DTC2	TESNKKFLPFQQFGR is a linear peptidic epitope (epitope ID 1073280) tested in 5 T cell assays, 19 B cell assays and 7 MHC ligand assays.	IEDB	1073280	553	567	TESNKKFLPFQQFGR	ECO:0000213	PubMed	36646780
P0DTC2	TKLNDLCFTNVYADS is a linear peptidic epitope (epitope ID 1073438) tested in 7 T cell assays, 20 B cell assays and 8 MHC ligand assays.	IEDB	1073438	385	399	TKLNDLCFTNVYADS	ECO:0000213	PubMed	34061349
P0DTC2	VGGNYNYLYRLFRKS is a linear peptidic epitope (epitope ID 1073698) tested in 25 T cell assays, 20 B cell assays and 9 MHC ligand assays.	IEDB	1073698	445	459	VGGNYNYLYRLFRKS	ECO:0000213	PubMed	34004174
P0DTC2	VGGNYNYLYRLFRKS is a linear peptidic epitope (epitope ID 1073698) tested in 25 T cell assays, 20 B cell assays and 9 MHC ligand assays.	IEDB	1073698	445	459	VGGNYNYLYRLFRKS	ECO:0000213	PubMed	35891550
P0DTC2	VGGNYNYLYRLFRKS is a linear peptidic epitope (epitope ID 1073698) tested in 25 T cell assays, 20 B cell assays and 9 MHC ligand assays.	IEDB	1073698	445	459	VGGNYNYLYRLFRKS	ECO:0000213	PubMed	36680141
P0DTC2	VGGNYNYLYRLFRKS is a linear peptidic epitope (epitope ID 1073698) tested in 25 T cell assays, 20 B cell assays and 9 MHC ligand assays.	IEDB	1073698	445	459	VGGNYNYLYRLFRKS	ECO:0000213	PubMed	34061349
P0DTC2	VGGNYNYLYRLFRKS is a linear peptidic epitope (epitope ID 1073698) tested in 25 T cell assays, 20 B cell assays and 9 MHC ligand assays.	IEDB	1073698	445	459	VGGNYNYLYRLFRKS	ECO:0000213	PubMed	33220791
P0DTC2	VQIDRLITGRLQSLQ is a linear peptidic epitope (epitope ID 1073938) tested in 19 T cell assays, 24 B cell assays and 9 MHC ligand assays.	IEDB	1073938	991	1005	VQIDRLITGRLQSLQ	ECO:0000213	PubMed	35139340
P0DTC2	VQIDRLITGRLQSLQ is a linear peptidic epitope (epitope ID 1073938) tested in 19 T cell assays, 24 B cell assays and 9 MHC ligand assays.	IEDB	1073938	991	1005	VQIDRLITGRLQSLQ	ECO:0000213	PubMed	35957961
P0DTC2	VQIDRLITGRLQSLQ is a linear peptidic epitope (epitope ID 1073938) tested in 19 T cell assays, 24 B cell assays and 9 MHC ligand assays.	IEDB	1073938	991	1005	VQIDRLITGRLQSLQ	ECO:0000213	PubMed	38781962
P0DTC2	VVLSFELLHAPATVC is a linear peptidic epitope (epitope ID 1073956) tested in 20 T cell assays, 26 B cell assays and 8 MHC ligand assays.	IEDB	1073956	511	525	VVLSFELLHAPATVC	ECO:0000213	PubMed	35957961
P0DTC2	YFASTEKSNIIRGWI is a linear peptidic epitope (epitope ID 1074069) tested in 13 T cell assays, 24 B cell assays and 8 MHC ligand assays.	IEDB	1074069	91	105	YFASTEKSNIIRGWI	ECO:0000213	PubMed	35957961
P0DTC2	YLYRLFRKSNLKPFE is a linear peptidic epitope (epitope ID 1074201) tested in 46 T cell assays, 38 B cell assays and 19 MHC ligand assays.	IEDB	1074201	451	465	YLYRLFRKSNLKPFE	ECO:0000213	PubMed	34162945
P0DTC2	YLYRLFRKSNLKPFE is a linear peptidic epitope (epitope ID 1074201) tested in 46 T cell assays, 38 B cell assays and 19 MHC ligand assays.	IEDB	1074201	451	465	YLYRLFRKSNLKPFE	ECO:0000213	PubMed	35957961
P0DTC2	YLYRLFRKSNLKPFE is a linear peptidic epitope (epitope ID 1074201) tested in 46 T cell assays, 38 B cell assays and 19 MHC ligand assays.	IEDB	1074201	451	465	YLYRLFRKSNLKPFE	ECO:0000213	PubMed	38781962
P0DTC2	YLYRLFRKSNLKPFE is a linear peptidic epitope (epitope ID 1074201) tested in 46 T cell assays, 38 B cell assays and 19 MHC ligand assays.	IEDB	1074201	451	465	YLYRLFRKSNLKPFE	ECO:0000213	PubMed	33220791
P0DTC2	YNYKLPDDFTGCVIA is a linear peptidic epitope (epitope ID 1074214) tested in 23 T cell assays, 40 B cell assays and 7 MHC ligand assays.	IEDB	1074214	421	435	YNYKLPDDFTGCVIA	ECO:0000213	PubMed	34162945
P0DTC2	CTFEYVSQPFLM is a linear peptidic epitope (epitope ID 1074869) tested in 6 T cell assays.	IEDB	1074869	166	177	CTFEYVSQPFLM	ECO:0000213	PubMed	35857584
P0DTC2	EILDITPCSF is a linear peptidic epitope (epitope ID 1074876) tested in 8 T cell assays and 10 MHC ligand assays.	IEDB	1074876	583	592	EILDITPCSF	ECO:0000213	PubMed	34171305
P0DTC2	FCNDPFLGVYY is a linear peptidic epitope (epitope ID 1074884) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1074884	135	145	FCNDPFLGVYY	ECO:0000213	PubMed	33220791
P0DTC2	FCNDPFLGVYY is a linear peptidic epitope (epitope ID 1074884) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1074884	135	145	FCNDPFLGVYY	ECO:0000213	PubMed	33853928
P0DTC2	FPQSAPHGVVF is a linear peptidic epitope (epitope ID 1074891) tested in 11 T cell assays and 2 MHC ligand assays.	IEDB	1074891	1052	1062	FPQSAPHGVVF	ECO:0000213	PubMed	37193826
P0DTC2	FPQSAPHGVVF is a linear peptidic epitope (epitope ID 1074891) tested in 11 T cell assays and 2 MHC ligand assays.	IEDB	1074891	1052	1062	FPQSAPHGVVF	ECO:0000213	PubMed	33853928
P0DTC2	FTISVTTEIL is a linear peptidic epitope (epitope ID 1074898) tested in 3 T cell assays.	IEDB	1074898	718	727	FTISVTTEIL	ECO:0000213	PubMed	37193826
P0DTC2	FVFKNIDGY is a linear peptidic epitope (epitope ID 1074900) tested in 8 T cell assays.	IEDB	1074900	192	200	FVFKNIDGY	ECO:0000213	PubMed	38781962
P0DTC2	FVFKNIDGY is a linear peptidic epitope (epitope ID 1074900) tested in 8 T cell assays.	IEDB	1074900	192	200	FVFKNIDGY	ECO:0000213	PubMed	38045681
P0DTC2	GTHWFVTQR is a linear peptidic epitope (epitope ID 1074915) tested in 11 T cell assays and 2 MHC ligand assays.	IEDB	1074915	1099	1107	GTHWFVTQR	ECO:0000213	PubMed	34728796
P0DTC2	GTHWFVTQR is a linear peptidic epitope (epitope ID 1074915) tested in 11 T cell assays and 2 MHC ligand assays.	IEDB	1074915	1099	1107	GTHWFVTQR	ECO:0000213	PubMed	35139340
P0DTC2	GTHWFVTQR is a linear peptidic epitope (epitope ID 1074915) tested in 11 T cell assays and 2 MHC ligand assays.	IEDB	1074915	1099	1107	GTHWFVTQR	ECO:0000213	PubMed	38045681
P0DTC2	GTHWFVTQR is a linear peptidic epitope (epitope ID 1074915) tested in 11 T cell assays and 2 MHC ligand assays.	IEDB	1074915	1099	1107	GTHWFVTQR	ECO:0000213	PubMed	33427749
P0DTC2	GTITSGWTF is a linear peptidic epitope (epitope ID 1074916) tested in 9 T cell assays.	IEDB	1074916	880	888	GTITSGWTF	ECO:0000213	PubMed	35484232
P0DTC2	GTITSGWTF is a linear peptidic epitope (epitope ID 1074916) tested in 9 T cell assays.	IEDB	1074916	880	888	GTITSGWTF	ECO:0000213	PubMed	33853928
P0DTC2	KLPDDFTGCV is a linear peptidic epitope (epitope ID 1074952) tested in 15 T cell assays and 3 MHC ligand assays.	IEDB	1074952	424	433	KLPDDFTGCV	ECO:0000213	PubMed	34725257
P0DTC2	KLPDDFTGCV is a linear peptidic epitope (epitope ID 1074952) tested in 15 T cell assays and 3 MHC ligand assays.	IEDB	1074952	424	433	KLPDDFTGCV	ECO:0000213	PubMed	34793243
P0DTC2	KLPDDFTGCV is a linear peptidic epitope (epitope ID 1074952) tested in 15 T cell assays and 3 MHC ligand assays.	IEDB	1074952	424	433	KLPDDFTGCV	ECO:0000213	PubMed	35297693
P0DTC2	KLPDDFTGCV is a linear peptidic epitope (epitope ID 1074952) tested in 15 T cell assays and 3 MHC ligand assays.	IEDB	1074952	424	433	KLPDDFTGCV	ECO:0000213	PubMed	33853928
P0DTC2	LLALHRSYL is a linear peptidic epitope (epitope ID 1074974) tested in 5 T cell assays.	IEDB	1074974	241	249	LLALHRSYL	ECO:0000213	PubMed	34793243
P0DTC2	LLALHRSYL is a linear peptidic epitope (epitope ID 1074974) tested in 5 T cell assays.	IEDB	1074974	241	249	LLALHRSYL	ECO:0000213	PubMed	34814158
P0DTC2	LPPAYTNSF is a linear peptidic epitope (epitope ID 1074980) tested in 16 T cell assays.	IEDB	1074980	24	32	LPPAYTNSF	ECO:0000213	PubMed	36603583
P0DTC2	LPPAYTNSF is a linear peptidic epitope (epitope ID 1074980) tested in 16 T cell assays.	IEDB	1074980	24	32	LPPAYTNSF	ECO:0000213	PubMed	37193826
P0DTC2	LPPAYTNSF is a linear peptidic epitope (epitope ID 1074980) tested in 16 T cell assays.	IEDB	1074980	24	32	LPPAYTNSF	ECO:0000213	PubMed	38045681
P0DTC2	LPQGFSAL is a linear peptidic epitope (epitope ID 1074981) tested in 13 T cell assays.	IEDB	1074981	216	223	LPQGFSAL	ECO:0000213	PubMed	33853928
P0DTC2	NQKLIANQF is a linear peptidic epitope (epitope ID 1075005) tested in 42 T cell assays, 2 MHC ligand assays and has 3D structure(s) 8elh.	IEDB	1075005	919	927	NQKLIANQF	ECO:0000213	PubMed	35139340
P0DTC2	NQKLIANQF is a linear peptidic epitope (epitope ID 1075005) tested in 42 T cell assays, 2 MHC ligand assays and has 3D structure(s) 8elh.	IEDB	1075005	919	927	NQKLIANQF	ECO:0000213	PubMed	35383307
P0DTC2	NQKLIANQF is a linear peptidic epitope (epitope ID 1075005) tested in 42 T cell assays, 2 MHC ligand assays and has 3D structure(s) 8elh.	IEDB	1075005	919	927	NQKLIANQF	ECO:0000213	PubMed	37468623
P0DTC2	NQKLIANQF is a linear peptidic epitope (epitope ID 1075005) tested in 42 T cell assays, 2 MHC ligand assays and has 3D structure(s) 8elh.	IEDB	1075005	919	927	NQKLIANQF	ECO:0000213	PubMed	38458195
P0DTC2	NQKLIANQF is a linear peptidic epitope (epitope ID 1075005) tested in 42 T cell assays, 2 MHC ligand assays and has 3D structure(s) 8elh.	IEDB	1075005	919	927	NQKLIANQF	ECO:0000213	PubMed	39284068
P0DTC2	QEVFAQVKQIYK is a linear peptidic epitope (epitope ID 1075019) tested in 2 T cell assays, 5 B cell assays and 1 MHC ligand assay.	IEDB	1075019	779	790	QEVFAQVKQIYK	ECO:0000213	PubMed	33220791
P0DTC2	RLFRKSNLK is a linear peptidic epitope (epitope ID 1075031) tested in 20 T cell assays and 3 MHC ligand assays.	IEDB	1075031	454	462	RLFRKSNLK	ECO:0000213	PubMed	34968416
P0DTC2	STQDLFLPFF is a linear peptidic epitope (epitope ID 1075065) tested in 5 T cell assays.	IEDB	1075065	50	59	STQDLFLPFF	ECO:0000213	PubMed	33853928
P0DTC2	TEKSNIIRGW is a linear peptidic epitope (epitope ID 1075071) tested in 9 T cell assays.	IEDB	1075071	95	104	TEKSNIIRGW	ECO:0000213	PubMed	35484232
P0DTC2	TLDSKTQSL is a linear peptidic epitope (epitope ID 1075075) tested in 17 T cell assays and 4 MHC ligand assays.	IEDB	1075075	109	117	TLDSKTQSL	ECO:0000213	PubMed	32979941
P0DTC2	TLDSKTQSL is a linear peptidic epitope (epitope ID 1075075) tested in 17 T cell assays and 4 MHC ligand assays.	IEDB	1075075	109	117	TLDSKTQSL	ECO:0000213	PubMed	34793243
P0DTC2	TLDSKTQSL is a linear peptidic epitope (epitope ID 1075075) tested in 17 T cell assays and 4 MHC ligand assays.	IEDB	1075075	109	117	TLDSKTQSL	ECO:0000213	PubMed	39456150
P0DTC2	TLDSKTQSL is a linear peptidic epitope (epitope ID 1075075) tested in 17 T cell assays and 4 MHC ligand assays.	IEDB	1075075	109	117	TLDSKTQSL	ECO:0000213	PubMed	33853928
P0DTC2	TPINLVRDL is a linear peptidic epitope (epitope ID 1075079) tested in 12 T cell assays.	IEDB	1075079	208	216	TPINLVRDL	ECO:0000213	PubMed	34793243
P0DTC2	TPINLVRDL is a linear peptidic epitope (epitope ID 1075079) tested in 12 T cell assays.	IEDB	1075079	208	216	TPINLVRDL	ECO:0000213	PubMed	37193826
P0DTC2	TPINLVRDL is a linear peptidic epitope (epitope ID 1075079) tested in 12 T cell assays.	IEDB	1075079	208	216	TPINLVRDL	ECO:0000213	PubMed	38045681
P0DTC2	TPINLVRDL is a linear peptidic epitope (epitope ID 1075079) tested in 12 T cell assays.	IEDB	1075079	208	216	TPINLVRDL	ECO:0000213	PubMed	33853928
P0DTC2	YEQYIKWPWYI is a linear peptidic epitope (epitope ID 1075120) tested in 6 T cell assays.	IEDB	1075120	1206	1216	YEQYIKWPWYI	ECO:0000213	PubMed	33853928
P0DTC2	YFPLQSYGF is a linear peptidic epitope (epitope ID 1075121) tested in 32 T cell assays, 2 MHC ligand assays and has 3D structure(s) 7tlt.	IEDB	1075121	489	497	YFPLQSYGF	ECO:0000213	PubMed	34506741
P0DTC2	YFPLQSYGF is a linear peptidic epitope (epitope ID 1075121) tested in 32 T cell assays, 2 MHC ligand assays and has 3D structure(s) 7tlt.	IEDB	1075121	489	497	YFPLQSYGF	ECO:0000213	PubMed	34968416
P0DTC2	YFPLQSYGF is a linear peptidic epitope (epitope ID 1075121) tested in 32 T cell assays, 2 MHC ligand assays and has 3D structure(s) 7tlt.	IEDB	1075121	489	497	YFPLQSYGF	ECO:0000213	PubMed	35157735
P0DTC2	YFPLQSYGF is a linear peptidic epitope (epitope ID 1075121) tested in 32 T cell assays, 2 MHC ligand assays and has 3D structure(s) 7tlt.	IEDB	1075121	489	497	YFPLQSYGF	ECO:0000213	PubMed	35196796
P0DTC2	YFPLQSYGF is a linear peptidic epitope (epitope ID 1075121) tested in 32 T cell assays, 2 MHC ligand assays and has 3D structure(s) 7tlt.	IEDB	1075121	489	497	YFPLQSYGF	ECO:0000213	PubMed	36302758
P0DTC2	YFPLQSYGF is a linear peptidic epitope (epitope ID 1075121) tested in 32 T cell assays, 2 MHC ligand assays and has 3D structure(s) 7tlt.	IEDB	1075121	489	497	YFPLQSYGF	ECO:0000213	PubMed	36603583
P0DTC2	YFPLQSYGF is a linear peptidic epitope (epitope ID 1075121) tested in 32 T cell assays, 2 MHC ligand assays and has 3D structure(s) 7tlt.	IEDB	1075121	489	497	YFPLQSYGF	ECO:0000213	PubMed	33853928
P0DTC2	FQPTNGVGY is a linear peptidic epitope (epitope ID 1087346) tested in 7 T cell assays.	IEDB	1087346	497	505	FQPTNGVGY	ECO:0000213	PubMed	35389886
P0DTC2	RFDNPVLPF is a linear peptidic epitope (epitope ID 1087399) tested in 11 T cell assays and 3 MHC ligand assays.	IEDB	1087399	78	86	RFDNPVLPF	ECO:0000213	PubMed	36068240
P0DTC2	RFDNPVLPF is a linear peptidic epitope (epitope ID 1087399) tested in 11 T cell assays and 3 MHC ligand assays.	IEDB	1087399	78	86	RFDNPVLPF	ECO:0000213	PubMed	33427749
P0DTC2	RFDNPVLPF is a linear peptidic epitope (epitope ID 1087399) tested in 11 T cell assays and 3 MHC ligand assays.	IEDB	1087399	78	86	RFDNPVLPF	ECO:0000213	PubMed	33853928
P0DTC2	TSNQVAVLY is a linear peptidic epitope (epitope ID 1087414) tested in 17 T cell assays and 1 MHC ligand assay.	IEDB	1087414	604	612	TSNQVAVLY	ECO:0000213	PubMed	34793243
P0DTC2	TSNQVAVLY is a linear peptidic epitope (epitope ID 1087414) tested in 17 T cell assays and 1 MHC ligand assay.	IEDB	1087414	604	612	TSNQVAVLY	ECO:0000213	PubMed	35484232
P0DTC2	GLTVLPPLL is a linear peptidic epitope (epitope ID 1125063) tested in 7 T cell assays and 1 MHC ligand assay.	IEDB	1125063	857	865	GLTVLPPLL	ECO:0000213	PubMed	34793243
P0DTC2	GLTVLPPLL is a linear peptidic epitope (epitope ID 1125063) tested in 7 T cell assays and 1 MHC ligand assay.	IEDB	1125063	857	865	GLTVLPPLL	ECO:0000213	PubMed	38608022
P0DTC2	GLTVLPPLL is a linear peptidic epitope (epitope ID 1125063) tested in 7 T cell assays and 1 MHC ligand assay.	IEDB	1125063	857	865	GLTVLPPLL	ECO:0000213	PubMed	39456150
P0DTC2	GLTVLPPLL is a linear peptidic epitope (epitope ID 1125063) tested in 7 T cell assays and 1 MHC ligand assay.	IEDB	1125063	857	865	GLTVLPPLL	ECO:0000213	PubMed	32791978
P0DTC2	KLNDLCFTNV is a linear peptidic epitope (epitope ID 1125080) tested in 11 T cell assays and 6 MHC ligand assays.	IEDB	1125080	386	395	KLNDLCFTNV	ECO:0000213	PubMed	34728796
P0DTC2	KLNDLCFTNV is a linear peptidic epitope (epitope ID 1125080) tested in 11 T cell assays and 6 MHC ligand assays.	IEDB	1125080	386	395	KLNDLCFTNV	ECO:0000213	PubMed	35937077
P0DTC2	KLNDLCFTNV is a linear peptidic epitope (epitope ID 1125080) tested in 11 T cell assays and 6 MHC ligand assays.	IEDB	1125080	386	395	KLNDLCFTNV	ECO:0000213	PubMed	38105139
P0DTC2	KLNDLCFTNV is a linear peptidic epitope (epitope ID 1125080) tested in 11 T cell assays and 6 MHC ligand assays.	IEDB	1125080	386	395	KLNDLCFTNV	ECO:0000213	PubMed	38608022
P0DTC2	KLNDLCFTNV is a linear peptidic epitope (epitope ID 1125080) tested in 11 T cell assays and 6 MHC ligand assays.	IEDB	1125080	386	395	KLNDLCFTNV	ECO:0000213	PubMed	39456150
P0DTC2	KLNDLCFTNV is a linear peptidic epitope (epitope ID 1125080) tested in 11 T cell assays and 6 MHC ligand assays.	IEDB	1125080	386	395	KLNDLCFTNV	ECO:0000213	PubMed	32791978
P0DTC2	SLIDLQEL is a linear peptidic epitope (epitope ID 1125138) tested in 2 T cell assays.	IEDB	1125138	1196	1203	SLIDLQEL	ECO:0000213	PubMed	33853928
P0DTC2	CTFEYVSQPFLMDLE is a linear peptidic epitope (epitope ID 1309110) tested in 54 T cell assays, 10 B cell assays and 34 MHC ligand assays.	IEDB	1309110	166	180	CTFEYVSQPFLMDLE	ECO:0000213	PubMed	33646265
P0DTC2	CTFEYVSQPFLMDLE is a linear peptidic epitope (epitope ID 1309110) tested in 54 T cell assays, 10 B cell assays and 34 MHC ligand assays.	IEDB	1309110	166	180	CTFEYVSQPFLMDLE	ECO:0000213	PubMed	34729465
P0DTC2	CTFEYVSQPFLMDLE is a linear peptidic epitope (epitope ID 1309110) tested in 54 T cell assays, 10 B cell assays and 34 MHC ligand assays.	IEDB	1309110	166	180	CTFEYVSQPFLMDLE	ECO:0000213	PubMed	35139340
P0DTC2	CTFEYVSQPFLMDLE is a linear peptidic epitope (epitope ID 1309110) tested in 54 T cell assays, 10 B cell assays and 34 MHC ligand assays.	IEDB	1309110	166	180	CTFEYVSQPFLMDLE	ECO:0000213	PubMed	35484232
P0DTC2	CTFEYVSQPFLMDLE is a linear peptidic epitope (epitope ID 1309110) tested in 54 T cell assays, 10 B cell assays and 34 MHC ligand assays.	IEDB	1309110	166	180	CTFEYVSQPFLMDLE	ECO:0000213	PubMed	35957961
P0DTC2	CTFEYVSQPFLMDLE is a linear peptidic epitope (epitope ID 1309110) tested in 54 T cell assays, 10 B cell assays and 34 MHC ligand assays.	IEDB	1309110	166	180	CTFEYVSQPFLMDLE	ECO:0000213	PubMed	38105139
P0DTC2	CTFEYVSQPFLMDLE is a linear peptidic epitope (epitope ID 1309110) tested in 54 T cell assays, 10 B cell assays and 34 MHC ligand assays.	IEDB	1309110	166	180	CTFEYVSQPFLMDLE	ECO:0000213	PubMed	38781962
P0DTC2	CTFEYVSQPFLMDLE is a linear peptidic epitope (epitope ID 1309110) tested in 54 T cell assays, 10 B cell assays and 34 MHC ligand assays.	IEDB	1309110	166	180	CTFEYVSQPFLMDLE	ECO:0000213	PubMed	35857619
P0DTC2	EFVFKNIDGYFKIYS is a linear peptidic epitope (epitope ID 1309113) tested in 37 T cell assays, 18 B cell assays and 9 MHC ligand assays.	IEDB	1309113	191	205	EFVFKNIDGYFKIYS	ECO:0000213	PubMed	35139340
P0DTC2	EFVFKNIDGYFKIYS is a linear peptidic epitope (epitope ID 1309113) tested in 37 T cell assays, 18 B cell assays and 9 MHC ligand assays.	IEDB	1309113	191	205	EFVFKNIDGYFKIYS	ECO:0000213	PubMed	35484232
P0DTC2	EFVFKNIDGYFKIYS is a linear peptidic epitope (epitope ID 1309113) tested in 37 T cell assays, 18 B cell assays and 9 MHC ligand assays.	IEDB	1309113	191	205	EFVFKNIDGYFKIYS	ECO:0000213	PubMed	35957961
P0DTC2	EFVFKNIDGYFKIYS is a linear peptidic epitope (epitope ID 1309113) tested in 37 T cell assays, 18 B cell assays and 9 MHC ligand assays.	IEDB	1309113	191	205	EFVFKNIDGYFKIYS	ECO:0000213	PubMed	38117652
P0DTC2	EFVFKNIDGYFKIYS is a linear peptidic epitope (epitope ID 1309113) tested in 37 T cell assays, 18 B cell assays and 9 MHC ligand assays.	IEDB	1309113	191	205	EFVFKNIDGYFKIYS	ECO:0000213	PubMed	38781962
P0DTC2	EFVFKNIDGYFKIYS is a linear peptidic epitope (epitope ID 1309113) tested in 37 T cell assays, 18 B cell assays and 9 MHC ligand assays.	IEDB	1309113	191	205	EFVFKNIDGYFKIYS	ECO:0000213	PubMed	33220791
P0DTC2	GGNYNYLYRLFRKSN is a linear peptidic epitope (epitope ID 1309117) tested in 24 T cell assays, 14 B cell assays and 7 MHC ligand assays.	IEDB	1309117	446	460	GGNYNYLYRLFRKSN	ECO:0000213	PubMed	34162945
P0DTC2	GGNYNYLYRLFRKSN is a linear peptidic epitope (epitope ID 1309117) tested in 24 T cell assays, 14 B cell assays and 7 MHC ligand assays.	IEDB	1309117	446	460	GGNYNYLYRLFRKSN	ECO:0000213	PubMed	35474581
P0DTC2	GGNYNYLYRLFRKSN is a linear peptidic epitope (epitope ID 1309117) tested in 24 T cell assays, 14 B cell assays and 7 MHC ligand assays.	IEDB	1309117	446	460	GGNYNYLYRLFRKSN	ECO:0000213	PubMed	35957961
P0DTC2	GGNYNYLYRLFRKSN is a linear peptidic epitope (epitope ID 1309117) tested in 24 T cell assays, 14 B cell assays and 7 MHC ligand assays.	IEDB	1309117	446	460	GGNYNYLYRLFRKSN	ECO:0000213	PubMed	38781962
P0DTC2	GGNYNYLYRLFRKSN is a linear peptidic epitope (epitope ID 1309117) tested in 24 T cell assays, 14 B cell assays and 7 MHC ligand assays.	IEDB	1309117	446	460	GGNYNYLYRLFRKSN	ECO:0000213	PubMed	34538222
P0DTC2	GPKKSTNLVKNKCVN is a linear peptidic epitope (epitope ID 1309118) tested in 13 T cell assays, 12 B cell assays and 8 MHC ligand assays.	IEDB	1309118	526	540	GPKKSTNLVKNKCVN	ECO:0000213	PubMed	34756082
P0DTC2	GPKKSTNLVKNKCVN is a linear peptidic epitope (epitope ID 1309118) tested in 13 T cell assays, 12 B cell assays and 8 MHC ligand assays.	IEDB	1309118	526	540	GPKKSTNLVKNKCVN	ECO:0000213	PubMed	35957961
P0DTC2	GVSPTKLNDLCFTNV is a linear peptidic epitope (epitope ID 1309120) tested in 19 T cell assays, 26 B cell assays and 7 MHC ligand assays.	IEDB	1309120	381	395	GVSPTKLNDLCFTNV	ECO:0000213	PubMed	35957961
P0DTC2	GVSPTKLNDLCFTNV is a linear peptidic epitope (epitope ID 1309120) tested in 19 T cell assays, 26 B cell assays and 7 MHC ligand assays.	IEDB	1309120	381	395	GVSPTKLNDLCFTNV	ECO:0000213	PubMed	38781962
P0DTC2	KHTPINLVRDLPQGF is a linear peptidic epitope (epitope ID 1309123) tested in 16 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1309123	206	220	KHTPINLVRDLPQGF	ECO:0000213	PubMed	35484232
P0DTC2	KHTPINLVRDLPQGF is a linear peptidic epitope (epitope ID 1309123) tested in 16 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1309123	206	220	KHTPINLVRDLPQGF	ECO:0000213	PubMed	35957961
P0DTC2	KHTPINLVRDLPQGF is a linear peptidic epitope (epitope ID 1309123) tested in 16 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1309123	206	220	KHTPINLVRDLPQGF	ECO:0000213	PubMed	38781962
P0DTC2	NFSQILPDPSKPSKR is a linear peptidic epitope (epitope ID 1309132) tested in 30 T cell assays, 25 B cell assays and 25 MHC ligand assays.	IEDB	1309132	801	815	NFSQILPDPSKPSKR	ECO:0000213	PubMed	34329696
P0DTC2	NFSQILPDPSKPSKR is a linear peptidic epitope (epitope ID 1309132) tested in 30 T cell assays, 25 B cell assays and 25 MHC ligand assays.	IEDB	1309132	801	815	NFSQILPDPSKPSKR	ECO:0000213	PubMed	34465633
P0DTC2	NFSQILPDPSKPSKR is a linear peptidic epitope (epitope ID 1309132) tested in 30 T cell assays, 25 B cell assays and 25 MHC ligand assays.	IEDB	1309132	801	815	NFSQILPDPSKPSKR	ECO:0000213	PubMed	35484232
P0DTC2	NFSQILPDPSKPSKR is a linear peptidic epitope (epitope ID 1309132) tested in 30 T cell assays, 25 B cell assays and 25 MHC ligand assays.	IEDB	1309132	801	815	NFSQILPDPSKPSKR	ECO:0000213	PubMed	35957961
P0DTC2	NFSQILPDPSKPSKR is a linear peptidic epitope (epitope ID 1309132) tested in 30 T cell assays, 25 B cell assays and 25 MHC ligand assays.	IEDB	1309132	801	815	NFSQILPDPSKPSKR	ECO:0000213	PubMed	38781962
P0DTC2	NFSQILPDPSKPSKR is a linear peptidic epitope (epitope ID 1309132) tested in 30 T cell assays, 25 B cell assays and 25 MHC ligand assays.	IEDB	1309132	801	815	NFSQILPDPSKPSKR	ECO:0000213	PubMed	34061349
P0DTC2	SIIAYTMSL is a linear peptidic epitope (epitope ID 1309137) tested in 69 T cell assays, 1 B cell assay and 11 MHC ligand assays.	IEDB	1309137	691	699	SIIAYTMSL	ECO:0000213	PubMed	33664060
P0DTC2	SIIAYTMSL is a linear peptidic epitope (epitope ID 1309137) tested in 69 T cell assays, 1 B cell assay and 11 MHC ligand assays.	IEDB	1309137	691	699	SIIAYTMSL	ECO:0000213	PubMed	34210785
P0DTC2	SIIAYTMSL is a linear peptidic epitope (epitope ID 1309137) tested in 69 T cell assays, 1 B cell assay and 11 MHC ligand assays.	IEDB	1309137	691	699	SIIAYTMSL	ECO:0000213	PubMed	34627082
P0DTC2	SIIAYTMSL is a linear peptidic epitope (epitope ID 1309137) tested in 69 T cell assays, 1 B cell assay and 11 MHC ligand assays.	IEDB	1309137	691	699	SIIAYTMSL	ECO:0000213	PubMed	34793243
P0DTC2	SIIAYTMSL is a linear peptidic epitope (epitope ID 1309137) tested in 69 T cell assays, 1 B cell assay and 11 MHC ligand assays.	IEDB	1309137	691	699	SIIAYTMSL	ECO:0000213	PubMed	35104433
P0DTC2	SIIAYTMSL is a linear peptidic epitope (epitope ID 1309137) tested in 69 T cell assays, 1 B cell assay and 11 MHC ligand assays.	IEDB	1309137	691	699	SIIAYTMSL	ECO:0000213	PubMed	35484232
P0DTC2	SIIAYTMSL is a linear peptidic epitope (epitope ID 1309137) tested in 69 T cell assays, 1 B cell assay and 11 MHC ligand assays.	IEDB	1309137	691	699	SIIAYTMSL	ECO:0000213	PubMed	37193826
P0DTC2	SIIAYTMSL is a linear peptidic epitope (epitope ID 1309137) tested in 69 T cell assays, 1 B cell assay and 11 MHC ligand assays.	IEDB	1309137	691	699	SIIAYTMSL	ECO:0000213	PubMed	38539271
P0DTC2	SIIAYTMSL is a linear peptidic epitope (epitope ID 1309137) tested in 69 T cell assays, 1 B cell assay and 11 MHC ligand assays.	IEDB	1309137	691	699	SIIAYTMSL	ECO:0000213	PubMed	38605956
P0DTC2	SIIAYTMSL is a linear peptidic epitope (epitope ID 1309137) tested in 69 T cell assays, 1 B cell assay and 11 MHC ligand assays.	IEDB	1309137	691	699	SIIAYTMSL	ECO:0000213	PubMed	33911008
P0DTC2	SIIAYTMSL is a linear peptidic epitope (epitope ID 1309137) tested in 69 T cell assays, 1 B cell assay and 11 MHC ligand assays.	IEDB	1309137	691	699	SIIAYTMSL	ECO:0000213	PubMed	38045681
P0DTC2	SIIAYTMSL is a linear peptidic epitope (epitope ID 1309137) tested in 69 T cell assays, 1 B cell assay and 11 MHC ligand assays.	IEDB	1309137	691	699	SIIAYTMSL	ECO:0000213	PubMed	32913053
P0DTC2	SIIAYTMSL is a linear peptidic epitope (epitope ID 1309137) tested in 69 T cell assays, 1 B cell assay and 11 MHC ligand assays.	IEDB	1309137	691	699	SIIAYTMSL	ECO:0000213	PubMed	33134398
P0DTC2	STECSNLLLQYGSFC is a linear peptidic epitope (epitope ID 1309139) tested in 16 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1309139	746	760	STECSNLLLQYGSFC	ECO:0000213	PubMed	35139340
P0DTC2	STECSNLLLQYGSFC is a linear peptidic epitope (epitope ID 1309139) tested in 16 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1309139	746	760	STECSNLLLQYGSFC	ECO:0000213	PubMed	35484232
P0DTC2	STECSNLLLQYGSFC is a linear peptidic epitope (epitope ID 1309139) tested in 16 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1309139	746	760	STECSNLLLQYGSFC	ECO:0000213	PubMed	35957961
P0DTC2	TDEMIAQYTSALLAG is a linear peptidic epitope (epitope ID 1309140) tested in 21 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1309140	866	880	TDEMIAQYTSALLAG	ECO:0000213	PubMed	35139340
P0DTC2	TDEMIAQYTSALLAG is a linear peptidic epitope (epitope ID 1309140) tested in 21 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1309140	866	880	TDEMIAQYTSALLAG	ECO:0000213	PubMed	35389886
P0DTC2	TDEMIAQYTSALLAG is a linear peptidic epitope (epitope ID 1309140) tested in 21 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1309140	866	880	TDEMIAQYTSALLAG	ECO:0000213	PubMed	35957961
P0DTC2	TDEMIAQYTSALLAG is a linear peptidic epitope (epitope ID 1309140) tested in 21 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1309140	866	880	TDEMIAQYTSALLAG	ECO:0000213	PubMed	38105139
P0DTC2	TDEMIAQYTSALLAG is a linear peptidic epitope (epitope ID 1309140) tested in 21 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1309140	866	880	TDEMIAQYTSALLAG	ECO:0000213	PubMed	38117652
P0DTC2	TDEMIAQYTSALLAG is a linear peptidic epitope (epitope ID 1309140) tested in 21 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1309140	866	880	TDEMIAQYTSALLAG	ECO:0000213	PubMed	33220791
P0DTC2	YAWNRKRISNCVADY is a linear peptidic epitope (epitope ID 1309143) tested in 31 T cell assays, 23 B cell assays and 18 MHC ligand assays.	IEDB	1309143	351	365	YAWNRKRISNCVADY	ECO:0000213	PubMed	35139340
P0DTC2	YAWNRKRISNCVADY is a linear peptidic epitope (epitope ID 1309143) tested in 31 T cell assays, 23 B cell assays and 18 MHC ligand assays.	IEDB	1309143	351	365	YAWNRKRISNCVADY	ECO:0000213	PubMed	35484232
P0DTC2	YAWNRKRISNCVADY is a linear peptidic epitope (epitope ID 1309143) tested in 31 T cell assays, 23 B cell assays and 18 MHC ligand assays.	IEDB	1309143	351	365	YAWNRKRISNCVADY	ECO:0000213	PubMed	35957961
P0DTC2	YAWNRKRISNCVADY is a linear peptidic epitope (epitope ID 1309143) tested in 31 T cell assays, 23 B cell assays and 18 MHC ligand assays.	IEDB	1309143	351	365	YAWNRKRISNCVADY	ECO:0000213	PubMed	38781962
P0DTC2	YEQYIKWPWYIWLGF is a linear peptidic epitope (epitope ID 1309144) tested in 15 T cell assays and 7 MHC ligand assays.	IEDB	1309144	1206	1220	YEQYIKWPWYIWLGF	ECO:0000213	PubMed	35957961
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	32979941
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	33338412
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	33664060
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	33972535
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	34098342
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	34210785
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	34506741
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	34627082
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	34793243
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	34968416
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	35013235
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	35104433
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	35157735
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	35171086
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	35196796
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	35383307
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	35389886
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	35484232
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	35750048
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	36134660
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	36254196
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	36302758
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	36494499
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	36969239
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	37193826
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	37390223
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	38214610
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	38257752
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	38458195
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	38539271
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	38781962
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	38932408
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	39284068
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	39456150
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	34320609
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	37275886
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	38045681
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	32913053
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	33427749
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	33853928
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	34044428
P0DTC2	YLQPRTFLL is a linear peptidic epitope (epitope ID 1309147) tested in 200 T cell assays, 23 MHC ligand assays and has 3D structure(s) 7n1f, 7pbe, 7n6e, 7n1a, 7p3d and 7n6d.	IEDB	1309147	269	277	YLQPRTFLL	ECO:0000213	PubMed	34384783
P0DTC2	AAYYVGYL is a linear peptidic epitope (epitope ID 1309656) tested in 5 T cell assays and 3 MHC ligand assays.	IEDB	1309656	263	270	AAYYVGYL	ECO:0000213	PubMed	37886945
P0DTC2	GKYEQYIKW is a linear peptidic epitope (epitope ID 1309756) tested in 4 T cell assays and 2 MHC ligand assays.	IEDB	1309756	1204	1212	GKYEQYIKW	ECO:0000213	PubMed	34857854
P0DTC2	IIAYTMSL is a linear peptidic epitope (epitope ID 1309779) tested in 1 T cell assay, 1 B cell assay and 2 MHC ligand assays.	IEDB	1309779	692	699	IIAYTMSL	ECO:0000213	PubMed	35371042
P0DTC2	KYEQYIKWP is a linear peptidic epitope (epitope ID 1309829) tested in 3 T cell assays and 3 MHC ligand assays.	IEDB	1309829	1205	1213	KYEQYIKWP	ECO:0000213	PubMed	33220791
P0DTC2	KYEQYIKWP is a linear peptidic epitope (epitope ID 1309829) tested in 3 T cell assays and 3 MHC ligand assays.	IEDB	1309829	1205	1213	KYEQYIKWP	ECO:0000213	PubMed	34857854
P0DTC2	PFAMQMAYRFNGIGV is a linear peptidic epitope (epitope ID 1309913) tested in 6 T cell assays, 9 B cell assays and 9 MHC ligand assays.	IEDB	1309913	897	911	PFAMQMAYRFNGIGV	ECO:0000213	PubMed	34061349
P0DTC2	AEIRASANLAATKMS is a linear peptidic epitope (epitope ID 1310253) tested in 11 T cell assays, 4 B cell assays and 12 MHC ligand assays.	IEDB	1310253	1016	1030	AEIRASANLAATKMS	ECO:0000213	PubMed	35957961
P0DTC2	AGFIKQYGDCLGDIA is a linear peptidic epitope (epitope ID 1310259) tested in 30 T cell assays, 18 B cell assays and 36 MHC ligand assays.	IEDB	1310259	831	845	AGFIKQYGDCLGDIA	ECO:0000213	PubMed	35139340
P0DTC2	AGFIKQYGDCLGDIA is a linear peptidic epitope (epitope ID 1310259) tested in 30 T cell assays, 18 B cell assays and 36 MHC ligand assays.	IEDB	1310259	831	845	AGFIKQYGDCLGDIA	ECO:0000213	PubMed	35957961
P0DTC2	AGFIKQYGDCLGDIA is a linear peptidic epitope (epitope ID 1310259) tested in 30 T cell assays, 18 B cell assays and 36 MHC ligand assays.	IEDB	1310259	831	845	AGFIKQYGDCLGDIA	ECO:0000213	PubMed	38781962
P0DTC2	AGFIKQYGDCLGDIA is a linear peptidic epitope (epitope ID 1310259) tested in 30 T cell assays, 18 B cell assays and 36 MHC ligand assays.	IEDB	1310259	831	845	AGFIKQYGDCLGDIA	ECO:0000213	PubMed	35154095
P0DTC2	AIVMVTIMLCCMTSC is a linear peptidic epitope (epitope ID 1310266) tested in 9 T cell assays and 7 MHC ligand assays.	IEDB	1310266	1226	1240	AIVMVTIMLCCMTSC	ECO:0000213	PubMed	38781962
P0DTC2	ALLAGTITSGWTFGA is a linear peptidic epitope (epitope ID 1310271) tested in 13 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310271	876	890	ALLAGTITSGWTFGA	ECO:0000213	PubMed	35957961
P0DTC2	ALTGIAVEQDKNTQE is a linear peptidic epitope (epitope ID 1310274) tested in 11 T cell assays, 12 B cell assays and 7 MHC ligand assays.	IEDB	1310274	766	780	ALTGIAVEQDKNTQE	ECO:0000213	PubMed	35957961
P0DTC2	ALTGIAVEQDKNTQE is a linear peptidic epitope (epitope ID 1310274) tested in 11 T cell assays, 12 B cell assays and 7 MHC ligand assays.	IEDB	1310274	766	780	ALTGIAVEQDKNTQE	ECO:0000213	PubMed	37251407
P0DTC2	ALTGIAVEQDKNTQE is a linear peptidic epitope (epitope ID 1310274) tested in 11 T cell assays, 12 B cell assays and 7 MHC ligand assays.	IEDB	1310274	766	780	ALTGIAVEQDKNTQE	ECO:0000213	PubMed	38781962
P0DTC2	APHGVVFLHVTYVPA is a linear peptidic epitope (epitope ID 1310281) tested in 14 T cell assays, 5 B cell assays and 7 MHC ligand assays.	IEDB	1310281	1056	1070	APHGVVFLHVTYVPA	ECO:0000213	PubMed	35957961
P0DTC2	APHGVVFLHVTYVPA is a linear peptidic epitope (epitope ID 1310281) tested in 14 T cell assays, 5 B cell assays and 7 MHC ligand assays.	IEDB	1310281	1056	1070	APHGVVFLHVTYVPA	ECO:0000213	PubMed	38781962
P0DTC2	AQALNTLVKQLSSNF is a linear peptidic epitope (epitope ID 1310282) tested in 9 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1310282	956	970	AQALNTLVKQLSSNF	ECO:0000213	PubMed	35139340
P0DTC2	AQALNTLVKQLSSNF is a linear peptidic epitope (epitope ID 1310282) tested in 9 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1310282	956	970	AQALNTLVKQLSSNF	ECO:0000213	PubMed	35957961
P0DTC2	AQALNTLVKQLSSNF is a linear peptidic epitope (epitope ID 1310282) tested in 9 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1310282	956	970	AQALNTLVKQLSSNF	ECO:0000213	PubMed	33220791
P0DTC2	ARDLICAQKFNGLTV is a linear peptidic epitope (epitope ID 1310284) tested in 10 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310284	846	860	ARDLICAQKFNGLTV	ECO:0000213	PubMed	35957961
P0DTC2	ARDLICAQKFNGLTV is a linear peptidic epitope (epitope ID 1310284) tested in 10 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310284	846	860	ARDLICAQKFNGLTV	ECO:0000213	PubMed	38781962
P0DTC2	ATKMSECVLGQSKRV is a linear peptidic epitope (epitope ID 1310294) tested in 8 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310294	1026	1040	ATKMSECVLGQSKRV	ECO:0000213	PubMed	35957961
P0DTC2	AVEQDKNTQEVFAQV is a linear peptidic epitope (epitope ID 1310295) tested in 10 T cell assays, 18 B cell assays and 7 MHC ligand assays.	IEDB	1310295	771	785	AVEQDKNTQEVFAQV	ECO:0000213	PubMed	35957961
P0DTC2	AYSNNSIAIPTNFTI is a linear peptidic epitope (epitope ID 1310300) tested in 17 T cell assays, 10 B cell assays and 9 MHC ligand assays.	IEDB	1310300	706	720	AYSNNSIAIPTNFTI	ECO:0000213	PubMed	35139340
P0DTC2	CASYQTQTNSPRRAR is a linear peptidic epitope (epitope ID 1310304) tested in 12 T cell assays, 25 B cell assays and 9 MHC ligand assays.	IEDB	1310304	671	685	CASYQTQTNSPRRAR	ECO:0000213	PubMed	35474581
P0DTC2	CASYQTQTNSPRRAR is a linear peptidic epitope (epitope ID 1310304) tested in 12 T cell assays, 25 B cell assays and 9 MHC ligand assays.	IEDB	1310304	671	685	CASYQTQTNSPRRAR	ECO:0000213	PubMed	35957961
P0DTC2	CASYQTQTNSPRRAR is a linear peptidic epitope (epitope ID 1310304) tested in 12 T cell assays, 25 B cell assays and 9 MHC ligand assays.	IEDB	1310304	671	685	CASYQTQTNSPRRAR	ECO:0000213	PubMed	38781962
P0DTC2	CASYQTQTNSPRRAR is a linear peptidic epitope (epitope ID 1310304) tested in 12 T cell assays, 25 B cell assays and 9 MHC ligand assays.	IEDB	1310304	671	685	CASYQTQTNSPRRAR	ECO:0000213	PubMed	33890550
P0DTC2	CEFQFCNDPFLGVYY is a linear peptidic epitope (epitope ID 1310306) tested in 26 T cell assays, 18 B cell assays and 38 MHC ligand assays.	IEDB	1310306	131	145	CEFQFCNDPFLGVYY	ECO:0000213	PubMed	35139340
P0DTC2	CEFQFCNDPFLGVYY is a linear peptidic epitope (epitope ID 1310306) tested in 26 T cell assays, 18 B cell assays and 38 MHC ligand assays.	IEDB	1310306	131	145	CEFQFCNDPFLGVYY	ECO:0000213	PubMed	35957961
P0DTC2	CEFQFCNDPFLGVYY is a linear peptidic epitope (epitope ID 1310306) tested in 26 T cell assays, 18 B cell assays and 38 MHC ligand assays.	IEDB	1310306	131	145	CEFQFCNDPFLGVYY	ECO:0000213	PubMed	38781962
P0DTC2	CEFQFCNDPFLGVYY is a linear peptidic epitope (epitope ID 1310306) tested in 26 T cell assays, 18 B cell assays and 38 MHC ligand assays.	IEDB	1310306	131	145	CEFQFCNDPFLGVYY	ECO:0000213	PubMed	35154095
P0DTC2	CMTSCCSCLKGCCSC is a linear peptidic epitope (epitope ID 1310309) tested in 11 T cell assays and 7 MHC ligand assays.	IEDB	1310309	1236	1250	CMTSCCSCLKGCCSC	ECO:0000213	PubMed	35957961
P0DTC2	CNDPFLGVYYHKNNK is a linear peptidic epitope (epitope ID 1310311) tested in 8 T cell assays, 10 B cell assays and 10 MHC ligand assays.	IEDB	1310311	136	150	CNDPFLGVYYHKNNK	ECO:0000213	PubMed	35957961
P0DTC2	CPFGEVFNATRFASV is a linear peptidic epitope (epitope ID 1310312) tested in 18 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310312	336	350	CPFGEVFNATRFASV	ECO:0000213	PubMed	35957961
P0DTC2	CPFGEVFNATRFASV is a linear peptidic epitope (epitope ID 1310312) tested in 18 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310312	336	350	CPFGEVFNATRFASV	ECO:0000213	PubMed	35857619
P0DTC2	DFCGKGYHLMSFPQS is a linear peptidic epitope (epitope ID 1310326) tested in 14 T cell assays, 24 B cell assays and 7 MHC ligand assays.	IEDB	1310326	1041	1055	DFCGKGYHLMSFPQS	ECO:0000213	PubMed	35957961
P0DTC2	DFGGFNFSQILPDPS is a linear peptidic epitope (epitope ID 1310327) tested in 27 T cell assays, 11 B cell assays and 9 MHC ligand assays.	IEDB	1310327	796	810	DFGGFNFSQILPDPS	ECO:0000213	PubMed	35891550
P0DTC2	DFGGFNFSQILPDPS is a linear peptidic epitope (epitope ID 1310327) tested in 27 T cell assays, 11 B cell assays and 9 MHC ligand assays.	IEDB	1310327	796	810	DFGGFNFSQILPDPS	ECO:0000213	PubMed	35957961
P0DTC2	DFGGFNFSQILPDPS is a linear peptidic epitope (epitope ID 1310327) tested in 27 T cell assays, 11 B cell assays and 9 MHC ligand assays.	IEDB	1310327	796	810	DFGGFNFSQILPDPS	ECO:0000213	PubMed	36680141
P0DTC2	DITPCSFGGVSVITP is a linear peptidic epitope (epitope ID 1310330) tested in 11 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1310330	586	600	DITPCSFGGVSVITP	ECO:0000213	PubMed	35957961
P0DTC2	DITPCSFGGVSVITP is a linear peptidic epitope (epitope ID 1310330) tested in 11 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1310330	586	600	DITPCSFGGVSVITP	ECO:0000213	PubMed	38781962
P0DTC2	DSFKEELDKYFKNHT is a linear peptidic epitope (epitope ID 1310335) tested in 10 T cell assays, 6 B cell assays and 7 MHC ligand assays.	IEDB	1310335	1146	1160	DSFKEELDKYFKNHT	ECO:0000213	PubMed	35139340
P0DTC2	DSFKEELDKYFKNHT is a linear peptidic epitope (epitope ID 1310335) tested in 10 T cell assays, 6 B cell assays and 7 MHC ligand assays.	IEDB	1310335	1146	1160	DSFKEELDKYFKNHT	ECO:0000213	PubMed	38781962
P0DTC2	DSLSSTASALGKLQD is a linear peptidic epitope (epitope ID 1310337) tested in 11 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1310337	936	950	DSLSSTASALGKLQD	ECO:0000213	PubMed	35957961
P0DTC2	ECVLGQSKRVDFCGK is a linear peptidic epitope (epitope ID 1310345) tested in 10 T cell assays, 18 B cell assays and 7 MHC ligand assays.	IEDB	1310345	1031	1045	ECVLGQSKRVDFCGK	ECO:0000213	PubMed	35957961
P0DTC2	EFRVYSSANNCTFEY is a linear peptidic epitope (epitope ID 1310352) tested in 8 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310352	156	170	EFRVYSSANNCTFEY	ECO:0000213	PubMed	35957961
P0DTC2	EIYQAGSTPCNGVEG is a linear peptidic epitope (epitope ID 1310360) tested in 17 T cell assays, 28 B cell assays and 11 MHC ligand assays.	IEDB	1310360	471	485	EIYQAGSTPCNGVEG	ECO:0000213	PubMed	35957961
P0DTC2	EIYQAGSTPCNGVEG is a linear peptidic epitope (epitope ID 1310360) tested in 17 T cell assays, 28 B cell assays and 11 MHC ligand assays.	IEDB	1310360	471	485	EIYQAGSTPCNGVEG	ECO:0000213	PubMed	38117652
P0DTC2	EIYQAGSTPCNGVEG is a linear peptidic epitope (epitope ID 1310360) tested in 17 T cell assays, 28 B cell assays and 11 MHC ligand assays.	IEDB	1310360	471	485	EIYQAGSTPCNGVEG	ECO:0000213	PubMed	38781962
P0DTC2	EIYQAGSTPCNGVEG is a linear peptidic epitope (epitope ID 1310360) tested in 17 T cell assays, 28 B cell assays and 11 MHC ligand assays.	IEDB	1310360	471	485	EIYQAGSTPCNGVEG	ECO:0000213	PubMed	35154095
P0DTC2	EKSNIIRGWIFGTTL is a linear peptidic epitope (epitope ID 1310361) tested in 13 T cell assays, 4 B cell assays and 8 MHC ligand assays.	IEDB	1310361	96	110	EKSNIIRGWIFGTTL	ECO:0000213	PubMed	35484232
P0DTC2	EKSNIIRGWIFGTTL is a linear peptidic epitope (epitope ID 1310361) tested in 13 T cell assays, 4 B cell assays and 8 MHC ligand assays.	IEDB	1310361	96	110	EKSNIIRGWIFGTTL	ECO:0000213	PubMed	35957961
P0DTC2	ELDKYFKNHTSPDVD is a linear peptidic epitope (epitope ID 1310362) tested in 16 T cell assays, 18 B cell assays and 8 MHC ligand assays.	IEDB	1310362	1151	1165	ELDKYFKNHTSPDVD	ECO:0000213	PubMed	35857619
P0DTC2	ENGTITDAVDCALDP is a linear peptidic epitope (epitope ID 1310367) tested in 14 T cell assays, 23 B cell assays and 9 MHC ligand assays.	IEDB	1310367	281	295	ENGTITDAVDCALDP	ECO:0000213	PubMed	35957961
P0DTC2	EPVLKGVKL is a linear peptidic epitope (epitope ID 1310371) tested in 4 T cell assays.	IEDB	1310371	1262	1270	EPVLKGVKL	ECO:0000213	PubMed	33853928
P0DTC2	EVRQIAPGQTGKIAD is a linear peptidic epitope (epitope ID 1310377) tested in 10 T cell assays, 24 B cell assays and 8 MHC ligand assays.	IEDB	1310377	406	420	EVRQIAPGQTGKIAD	ECO:0000213	PubMed	38781962
P0DTC2	FDEDDSEPVLKGVKL is a linear peptidic epitope (epitope ID 1310384) tested in 12 T cell assays and 7 MHC ligand assays.	IEDB	1310384	1256	1270	FDEDDSEPVLKGVKL	ECO:0000213	PubMed	38781962
P0DTC2	FGTTLDSKTQSLLIV is a linear peptidic epitope (epitope ID 1310392) tested in 10 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1310392	106	120	FGTTLDSKTQSLLIV	ECO:0000213	PubMed	35957961
P0DTC2	FGTTLDSKTQSLLIV is a linear peptidic epitope (epitope ID 1310392) tested in 10 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1310392	106	120	FGTTLDSKTQSLLIV	ECO:0000213	PubMed	38781962
P0DTC2	FKIYSKHTPINLVRD is a linear peptidic epitope (epitope ID 1310401) tested in 37 T cell assays, 23 B cell assays and 18 MHC ligand assays.	IEDB	1310401	201	215	FKIYSKHTPINLVRD	ECO:0000213	PubMed	34329696
P0DTC2	FKIYSKHTPINLVRD is a linear peptidic epitope (epitope ID 1310401) tested in 37 T cell assays, 23 B cell assays and 18 MHC ligand assays.	IEDB	1310401	201	215	FKIYSKHTPINLVRD	ECO:0000213	PubMed	35957961
P0DTC2	FKNLREFVFKNIDGY is a linear peptidic epitope (epitope ID 1310403) tested in 11 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310403	186	200	FKNLREFVFKNIDGY	ECO:0000213	PubMed	35957961
P0DTC2	FNCYFPLQSYGFQPT is a linear peptidic epitope (epitope ID 1310412) tested in 13 T cell assays, 10 B cell assays and 8 MHC ligand assays.	IEDB	1310412	486	500	FNCYFPLQSYGFQPT	ECO:0000213	PubMed	35957961
P0DTC2	FNCYFPLQSYGFQPT is a linear peptidic epitope (epitope ID 1310412) tested in 13 T cell assays, 10 B cell assays and 8 MHC ligand assays.	IEDB	1310412	486	500	FNCYFPLQSYGFQPT	ECO:0000213	PubMed	38105139
P0DTC2	FNCYFPLQSYGFQPT is a linear peptidic epitope (epitope ID 1310412) tested in 13 T cell assays, 10 B cell assays and 8 MHC ligand assays.	IEDB	1310412	486	500	FNCYFPLQSYGFQPT	ECO:0000213	PubMed	33220791
P0DTC2	FNDGVYFASTEKSNI is a linear peptidic epitope (epitope ID 1310413) tested in 8 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1310413	86	100	FNDGVYFASTEKSNI	ECO:0000213	PubMed	35957961
P0DTC2	FNGLTVLPPLLTDEM is a linear peptidic epitope (epitope ID 1310415) tested in 3 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310415	855	869	FNGLTVLPPLLTDEM	ECO:0000213	PubMed	32999467
P0DTC2	FRKSNLKPFERDIST is a linear peptidic epitope (epitope ID 1310418) tested in 14 T cell assays, 13 B cell assays and 7 MHC ligand assays.	IEDB	1310418	456	470	FRKSNLKPFERDIST	ECO:0000213	PubMed	38781962
P0DTC2	FTVEKGIYQTSNFRV is a linear peptidic epitope (epitope ID 1310423) tested in 11 T cell assays, 4 B cell assays and 8 MHC ligand assays.	IEDB	1310423	306	320	FTVEKGIYQTSNFRV	ECO:0000213	PubMed	35957961
P0DTC2	FTVEKGIYQTSNFRV is a linear peptidic epitope (epitope ID 1310423) tested in 11 T cell assays, 4 B cell assays and 8 MHC ligand assays.	IEDB	1310423	306	320	FTVEKGIYQTSNFRV	ECO:0000213	PubMed	38781962
P0DTC2	FVSGNCDVVIGIVNN is a linear peptidic epitope (epitope ID 1310426) tested in 16 T cell assays, 24 B cell assays and 10 MHC ligand assays.	IEDB	1310426	1121	1135	FVSGNCDVVIGIVNN	ECO:0000213	PubMed	38781962
P0DTC2	GAAAYYVGYLQPRTF is a linear peptidic epitope (epitope ID 1310431) tested in 15 T cell assays, 24 B cell assays and 7 MHC ligand assays.	IEDB	1310431	261	275	GAAAYYVGYLQPRTF	ECO:0000213	PubMed	35139340
P0DTC2	GAAAYYVGYLQPRTF is a linear peptidic epitope (epitope ID 1310431) tested in 15 T cell assays, 24 B cell assays and 7 MHC ligand assays.	IEDB	1310431	261	275	GAAAYYVGYLQPRTF	ECO:0000213	PubMed	35957961
P0DTC2	GCVIAWNSNNLDSKV is a linear peptidic epitope (epitope ID 1310437) tested in 37 T cell assays, 27 B cell assays and 8 MHC ligand assays.	IEDB	1310437	431	445	GCVIAWNSNNLDSKV	ECO:0000213	PubMed	34162945
P0DTC2	GCVIAWNSNNLDSKV is a linear peptidic epitope (epitope ID 1310437) tested in 37 T cell assays, 27 B cell assays and 8 MHC ligand assays.	IEDB	1310437	431	445	GCVIAWNSNNLDSKV	ECO:0000213	PubMed	35139340
P0DTC2	GCVIAWNSNNLDSKV is a linear peptidic epitope (epitope ID 1310437) tested in 37 T cell assays, 27 B cell assays and 8 MHC ligand assays.	IEDB	1310437	431	445	GCVIAWNSNNLDSKV	ECO:0000213	PubMed	35474581
P0DTC2	GCVIAWNSNNLDSKV is a linear peptidic epitope (epitope ID 1310437) tested in 37 T cell assays, 27 B cell assays and 8 MHC ligand assays.	IEDB	1310437	431	445	GCVIAWNSNNLDSKV	ECO:0000213	PubMed	35891550
P0DTC2	GCVIAWNSNNLDSKV is a linear peptidic epitope (epitope ID 1310437) tested in 37 T cell assays, 27 B cell assays and 8 MHC ligand assays.	IEDB	1310437	431	445	GCVIAWNSNNLDSKV	ECO:0000213	PubMed	36680141
P0DTC2	GCVIAWNSNNLDSKV is a linear peptidic epitope (epitope ID 1310437) tested in 37 T cell assays, 27 B cell assays and 8 MHC ligand assays.	IEDB	1310437	431	445	GCVIAWNSNNLDSKV	ECO:0000213	PubMed	38781962
P0DTC2	GFQPTNGVGYQPYRV is a linear peptidic epitope (epitope ID 1310441) tested in 12 T cell assays, 18 B cell assays and 9 MHC ligand assays.	IEDB	1310441	496	510	GFQPTNGVGYQPYRV	ECO:0000213	PubMed	35957961
P0DTC2	GFQPTNGVGYQPYRV is a linear peptidic epitope (epitope ID 1310441) tested in 12 T cell assays, 18 B cell assays and 9 MHC ligand assays.	IEDB	1310441	496	510	GFQPTNGVGYQPYRV	ECO:0000213	PubMed	38781962
P0DTC2	GIVNNTVYDPLQPEL is a linear peptidic epitope (epitope ID 1310444) tested in 14 T cell assays, 18 B cell assays and 8 MHC ligand assays.	IEDB	1310444	1131	1145	GIVNNTVYDPLQPEL	ECO:0000213	PubMed	35957961
P0DTC2	GIVNNTVYDPLQPEL is a linear peptidic epitope (epitope ID 1310444) tested in 14 T cell assays, 18 B cell assays and 8 MHC ligand assays.	IEDB	1310444	1131	1145	GIVNNTVYDPLQPEL	ECO:0000213	PubMed	38781962
P0DTC2	GIYQTSNFRVQPTES is a linear peptidic epitope (epitope ID 1310445) tested in 26 T cell assays, 18 B cell assays and 18 MHC ligand assays.	IEDB	1310445	311	325	GIYQTSNFRVQPTES	ECO:0000213	PubMed	35139340
P0DTC2	GIYQTSNFRVQPTES is a linear peptidic epitope (epitope ID 1310445) tested in 26 T cell assays, 18 B cell assays and 18 MHC ligand assays.	IEDB	1310445	311	325	GIYQTSNFRVQPTES	ECO:0000213	PubMed	35957961
P0DTC2	GKIADYNYKLPDDFT is a linear peptidic epitope (epitope ID 1310447) tested in 10 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1310447	416	430	GKIADYNYKLPDDFT	ECO:0000213	PubMed	35474581
P0DTC2	GKIADYNYKLPDDFT is a linear peptidic epitope (epitope ID 1310447) tested in 10 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1310447	416	430	GKIADYNYKLPDDFT	ECO:0000213	PubMed	38781962
P0DTC2	GKLQDVVNQNAQALN is a linear peptidic epitope (epitope ID 1310448) tested in 14 T cell assays, 10 B cell assays and 9 MHC ligand assays.	IEDB	1310448	946	960	GKLQDVVNQNAQALN	ECO:0000213	PubMed	34162945
P0DTC2	GKLQDVVNQNAQALN is a linear peptidic epitope (epitope ID 1310448) tested in 14 T cell assays, 10 B cell assays and 9 MHC ligand assays.	IEDB	1310448	946	960	GKLQDVVNQNAQALN	ECO:0000213	PubMed	35957961
P0DTC2	GRDIADTTDAVRDPQ is a linear peptidic epitope (epitope ID 1310457) tested in 9 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1310457	566	580	GRDIADTTDAVRDPQ	ECO:0000213	PubMed	35957961
P0DTC2	GRDIADTTDAVRDPQ is a linear peptidic epitope (epitope ID 1310457) tested in 9 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1310457	566	580	GRDIADTTDAVRDPQ	ECO:0000213	PubMed	38781962
P0DTC2	GRDIADTTDAVRDPQ is a linear peptidic epitope (epitope ID 1310457) tested in 9 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1310457	566	580	GRDIADTTDAVRDPQ	ECO:0000213	PubMed	33220791
P0DTC2	GSCCKFDEDDSEPVL is a linear peptidic epitope (epitope ID 1310459) tested in 11 T cell assays, 16 B cell assays and 8 MHC ligand assays.	IEDB	1310459	1251	1265	GSCCKFDEDDSEPVL	ECO:0000213	PubMed	35957961
P0DTC2	GSCCKFDEDDSEPVL is a linear peptidic epitope (epitope ID 1310459) tested in 11 T cell assays, 16 B cell assays and 8 MHC ligand assays.	IEDB	1310459	1251	1265	GSCCKFDEDDSEPVL	ECO:0000213	PubMed	38781962
P0DTC2	HKNNKSWMESEFRVY is a linear peptidic epitope (epitope ID 1310474) tested in 14 T cell assays, 7 B cell assays and 7 MHC ligand assays.	IEDB	1310474	146	160	HKNNKSWMESEFRVY	ECO:0000213	PubMed	35957961
P0DTC2	HKNNKSWMESEFRVY is a linear peptidic epitope (epitope ID 1310474) tested in 14 T cell assays, 7 B cell assays and 7 MHC ligand assays.	IEDB	1310474	146	160	HKNNKSWMESEFRVY	ECO:0000213	PubMed	38781962
P0DTC2	HWFVTQRNFYEPQII is a linear peptidic epitope (epitope ID 1310476) tested in 24 T cell assays, 24 B cell assays and 8 MHC ligand assays.	IEDB	1310476	1101	1115	HWFVTQRNFYEPQII	ECO:0000213	PubMed	35139340
P0DTC2	HWFVTQRNFYEPQII is a linear peptidic epitope (epitope ID 1310476) tested in 24 T cell assays, 24 B cell assays and 8 MHC ligand assays.	IEDB	1310476	1101	1115	HWFVTQRNFYEPQII	ECO:0000213	PubMed	35484232
P0DTC2	HWFVTQRNFYEPQII is a linear peptidic epitope (epitope ID 1310476) tested in 24 T cell assays, 24 B cell assays and 8 MHC ligand assays.	IEDB	1310476	1101	1115	HWFVTQRNFYEPQII	ECO:0000213	PubMed	35957961
P0DTC2	HWFVTQRNFYEPQII is a linear peptidic epitope (epitope ID 1310476) tested in 24 T cell assays, 24 B cell assays and 8 MHC ligand assays.	IEDB	1310476	1101	1115	HWFVTQRNFYEPQII	ECO:0000213	PubMed	38781962
P0DTC2	HWFVTQRNFYEPQII is a linear peptidic epitope (epitope ID 1310476) tested in 24 T cell assays, 24 B cell assays and 8 MHC ligand assays.	IEDB	1310476	1101	1115	HWFVTQRNFYEPQII	ECO:0000213	PubMed	34061349
P0DTC2	IGAEHVNNSYECDIP is a linear peptidic epitope (epitope ID 1310484) tested in 11 T cell assays, 18 B cell assays and 8 MHC ligand assays.	IEDB	1310484	651	665	IGAEHVNNSYECDIP	ECO:0000213	PubMed	38781962
P0DTC2	IGAGICASYQTQTNS is a linear peptidic epitope (epitope ID 1310485) tested in 10 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310485	666	680	IGAGICASYQTQTNS	ECO:0000213	PubMed	35139340
P0DTC2	IGAGICASYQTQTNS is a linear peptidic epitope (epitope ID 1310485) tested in 10 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310485	666	680	IGAGICASYQTQTNS	ECO:0000213	PubMed	35957961
P0DTC2	IGAGICASYQTQTNS is a linear peptidic epitope (epitope ID 1310485) tested in 10 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310485	666	680	IGAGICASYQTQTNS	ECO:0000213	PubMed	38781962
P0DTC2	IGINITRFQTLLALH is a linear peptidic epitope (epitope ID 1310487) tested in 24 T cell assays, 18 B cell assays and 9 MHC ligand assays.	IEDB	1310487	231	245	IGINITRFQTLLALH	ECO:0000213	PubMed	35139340
P0DTC2	IGINITRFQTLLALH is a linear peptidic epitope (epitope ID 1310487) tested in 24 T cell assays, 18 B cell assays and 9 MHC ligand assays.	IEDB	1310487	231	245	IGINITRFQTLLALH	ECO:0000213	PubMed	35957961
P0DTC2	IGINITRFQTLLALH is a linear peptidic epitope (epitope ID 1310487) tested in 24 T cell assays, 18 B cell assays and 9 MHC ligand assays.	IEDB	1310487	231	245	IGINITRFQTLLALH	ECO:0000213	PubMed	38781962
P0DTC2	IGINITRFQTLLALH is a linear peptidic epitope (epitope ID 1310487) tested in 24 T cell assays, 18 B cell assays and 9 MHC ligand assays.	IEDB	1310487	231	245	IGINITRFQTLLALH	ECO:0000213	PubMed	35154095
P0DTC2	ILPVSMTKTSVDCTM is a linear peptidic epitope (epitope ID 1310497) tested in 9 T cell assays, 4 B cell assays and 8 MHC ligand assays.	IEDB	1310497	726	740	ILPVSMTKTSVDCTM	ECO:0000213	PubMed	35139340
P0DTC2	IPFAMQMAYRFNGIG is a linear peptidic epitope (epitope ID 1310503) tested in 50 T cell assays, 4 B cell assays and 20 MHC ligand assays.	IEDB	1310503	896	910	IPFAMQMAYRFNGIG	ECO:0000213	PubMed	34162945
P0DTC2	IPFAMQMAYRFNGIG is a linear peptidic epitope (epitope ID 1310503) tested in 50 T cell assays, 4 B cell assays and 20 MHC ligand assays.	IEDB	1310503	896	910	IPFAMQMAYRFNGIG	ECO:0000213	PubMed	35139340
P0DTC2	IPFAMQMAYRFNGIG is a linear peptidic epitope (epitope ID 1310503) tested in 50 T cell assays, 4 B cell assays and 20 MHC ligand assays.	IEDB	1310503	896	910	IPFAMQMAYRFNGIG	ECO:0000213	PubMed	35957961
P0DTC2	IPFAMQMAYRFNGIG is a linear peptidic epitope (epitope ID 1310503) tested in 50 T cell assays, 4 B cell assays and 20 MHC ligand assays.	IEDB	1310503	896	910	IPFAMQMAYRFNGIG	ECO:0000213	PubMed	38117652
P0DTC2	IPFAMQMAYRFNGIG is a linear peptidic epitope (epitope ID 1310503) tested in 50 T cell assays, 4 B cell assays and 20 MHC ligand assays.	IEDB	1310503	896	910	IPFAMQMAYRFNGIG	ECO:0000213	PubMed	33220791
P0DTC2	IRGWIFGTTLDSKTQ is a linear peptidic epitope (epitope ID 1310506) tested in 15 T cell assays, 23 B cell assays and 7 MHC ligand assays.	IEDB	1310506	101	115	IRGWIFGTTLDSKTQ	ECO:0000213	PubMed	35957961
P0DTC2	ITRFQTLLALHRSYL is a linear peptidic epitope (epitope ID 1310513) tested in 18 T cell assays, 10 B cell assays and 9 MHC ligand assays.	IEDB	1310513	235	249	ITRFQTLLALHRSYL	ECO:0000213	PubMed	34814158
P0DTC2	ITRFQTLLALHRSYL is a linear peptidic epitope (epitope ID 1310513) tested in 18 T cell assays, 10 B cell assays and 9 MHC ligand assays.	IEDB	1310513	235	249	ITRFQTLLALHRSYL	ECO:0000213	PubMed	37596280
P0DTC2	ITRFQTLLALHRSYL is a linear peptidic epitope (epitope ID 1310513) tested in 18 T cell assays, 10 B cell assays and 9 MHC ligand assays.	IEDB	1310513	235	249	ITRFQTLLALHRSYL	ECO:0000213	PubMed	32999467
P0DTC2	ITRFQTLLALHRSYL is a linear peptidic epitope (epitope ID 1310513) tested in 18 T cell assays, 10 B cell assays and 9 MHC ligand assays.	IEDB	1310513	235	249	ITRFQTLLALHRSYL	ECO:0000213	PubMed	33220791
P0DTC2	IVRFPNITNLCPFGE is a linear peptidic epitope (epitope ID 1310515) tested in 19 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310515	326	340	IVRFPNITNLCPFGE	ECO:0000213	PubMed	35474581
P0DTC2	IVRFPNITNLCPFGE is a linear peptidic epitope (epitope ID 1310515) tested in 19 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310515	326	340	IVRFPNITNLCPFGE	ECO:0000213	PubMed	35957961
P0DTC2	IVRFPNITNLCPFGE is a linear peptidic epitope (epitope ID 1310515) tested in 19 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310515	326	340	IVRFPNITNLCPFGE	ECO:0000213	PubMed	35857619
P0DTC2	KEIDRLNEVAKNLNE is a linear peptidic epitope (epitope ID 1310528) tested in 14 T cell assays, 24 B cell assays and 7 MHC ligand assays.	IEDB	1310528	1181	1195	KEIDRLNEVAKNLNE	ECO:0000213	PubMed	35957961
P0DTC2	KLIANQFNSAIGKIQ is a linear peptidic epitope (epitope ID 1310542) tested in 17 T cell assays, 24 B cell assays and 10 MHC ligand assays.	IEDB	1310542	921	935	KLIANQFNSAIGKIQ	ECO:0000213	PubMed	35139340
P0DTC2	KLIANQFNSAIGKIQ is a linear peptidic epitope (epitope ID 1310542) tested in 17 T cell assays, 24 B cell assays and 10 MHC ligand assays.	IEDB	1310542	921	935	KLIANQFNSAIGKIQ	ECO:0000213	PubMed	35957961
P0DTC2	KLIANQFNSAIGKIQ is a linear peptidic epitope (epitope ID 1310542) tested in 17 T cell assays, 24 B cell assays and 10 MHC ligand assays.	IEDB	1310542	921	935	KLIANQFNSAIGKIQ	ECO:0000213	PubMed	38781962
P0DTC2	KLIANQFNSAIGKIQ is a linear peptidic epitope (epitope ID 1310542) tested in 17 T cell assays, 24 B cell assays and 10 MHC ligand assays.	IEDB	1310542	921	935	KLIANQFNSAIGKIQ	ECO:0000213	PubMed	34061349
P0DTC2	KLNDLCFTNVYADSF is a linear peptidic epitope (epitope ID 1310545) tested in 14 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310545	386	400	KLNDLCFTNVYADSF	ECO:0000213	PubMed	35139340
P0DTC2	KNTQEVFAQVKQIYK is a linear peptidic epitope (epitope ID 1310548) tested in 13 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310548	776	790	KNTQEVFAQVKQIYK	ECO:0000213	PubMed	35957961
P0DTC2	KNTQEVFAQVKQIYK is a linear peptidic epitope (epitope ID 1310548) tested in 13 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310548	776	790	KNTQEVFAQVKQIYK	ECO:0000213	PubMed	38781962
P0DTC2	KQIYKTPPIKDFGGF is a linear peptidic epitope (epitope ID 1310550) tested in 8 T cell assays, 6 B cell assays and 7 MHC ligand assays.	IEDB	1310550	786	800	KQIYKTPPIKDFGGF	ECO:0000213	PubMed	35957961
P0DTC2	KRISNCVADYSVLYN is a linear peptidic epitope (epitope ID 1310551) tested in 24 T cell assays, 4 B cell assays and 12 MHC ligand assays.	IEDB	1310551	356	370	KRISNCVADYSVLYN	ECO:0000213	PubMed	35139340
P0DTC2	KRISNCVADYSVLYN is a linear peptidic epitope (epitope ID 1310551) tested in 24 T cell assays, 4 B cell assays and 12 MHC ligand assays.	IEDB	1310551	356	370	KRISNCVADYSVLYN	ECO:0000213	PubMed	35484232
P0DTC2	KRISNCVADYSVLYN is a linear peptidic epitope (epitope ID 1310551) tested in 24 T cell assays, 4 B cell assays and 12 MHC ligand assays.	IEDB	1310551	356	370	KRISNCVADYSVLYN	ECO:0000213	PubMed	35957961
P0DTC2	KRISNCVADYSVLYN is a linear peptidic epitope (epitope ID 1310551) tested in 24 T cell assays, 4 B cell assays and 12 MHC ligand assays.	IEDB	1310551	356	370	KRISNCVADYSVLYN	ECO:0000213	PubMed	38781962
P0DTC2	KVEAEVQIDRLITGR is a linear peptidic epitope (epitope ID 1310554) tested in 9 T cell assays, 4 B cell assays and 8 MHC ligand assays.	IEDB	1310554	986	1000	KVEAEVQIDRLITGR	ECO:0000213	PubMed	35957961
P0DTC2	KVEAEVQIDRLITGR is a linear peptidic epitope (epitope ID 1310554) tested in 9 T cell assays, 4 B cell assays and 8 MHC ligand assays.	IEDB	1310554	986	1000	KVEAEVQIDRLITGR	ECO:0000213	PubMed	38781962
P0DTC2	KVFRSSVLHSTQDLF is a linear peptidic epitope (epitope ID 1310555) tested in 19 T cell assays, 23 B cell assays and 10 MHC ligand assays.	IEDB	1310555	41	55	KVFRSSVLHSTQDLF	ECO:0000213	PubMed	35139340
P0DTC2	KVFRSSVLHSTQDLF is a linear peptidic epitope (epitope ID 1310555) tested in 19 T cell assays, 23 B cell assays and 10 MHC ligand assays.	IEDB	1310555	41	55	KVFRSSVLHSTQDLF	ECO:0000213	PubMed	35957961
P0DTC2	KVFRSSVLHSTQDLF is a linear peptidic epitope (epitope ID 1310555) tested in 19 T cell assays, 23 B cell assays and 10 MHC ligand assays.	IEDB	1310555	41	55	KVFRSSVLHSTQDLF	ECO:0000213	PubMed	38781962
P0DTC2	LDSKVGGNYNYLYRL is a linear peptidic epitope (epitope ID 1310565) tested in 19 T cell assays, 32 B cell assays and 7 MHC ligand assays.	IEDB	1310565	441	455	LDSKVGGNYNYLYRL	ECO:0000213	PubMed	38781962
P0DTC2	LGVYYHKNNKSWMES is a linear peptidic epitope (epitope ID 1310575) tested in 34 T cell assays, 24 B cell assays and 9 MHC ligand assays.	IEDB	1310575	141	155	LGVYYHKNNKSWMES	ECO:0000213	PubMed	35891550
P0DTC2	LGVYYHKNNKSWMES is a linear peptidic epitope (epitope ID 1310575) tested in 34 T cell assays, 24 B cell assays and 9 MHC ligand assays.	IEDB	1310575	141	155	LGVYYHKNNKSWMES	ECO:0000213	PubMed	36680141
P0DTC2	LGVYYHKNNKSWMES is a linear peptidic epitope (epitope ID 1310575) tested in 34 T cell assays, 24 B cell assays and 9 MHC ligand assays.	IEDB	1310575	141	155	LGVYYHKNNKSWMES	ECO:0000213	PubMed	38781962
P0DTC2	LITGRLQSLQTYVTQ is a linear peptidic epitope (epitope ID 1310586) tested in 11 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310586	996	1010	LITGRLQSLQTYVTQ	ECO:0000213	PubMed	35957961
P0DTC2	LKPFERDISTEIYQA is a linear peptidic epitope (epitope ID 1310589) tested in 28 T cell assays, 34 B cell assays and 9 MHC ligand assays.	IEDB	1310589	461	475	LKPFERDISTEIYQA	ECO:0000213	PubMed	34004174
P0DTC2	LKPFERDISTEIYQA is a linear peptidic epitope (epitope ID 1310589) tested in 28 T cell assays, 34 B cell assays and 9 MHC ligand assays.	IEDB	1310589	461	475	LKPFERDISTEIYQA	ECO:0000213	PubMed	35957961
P0DTC2	LKPFERDISTEIYQA is a linear peptidic epitope (epitope ID 1310589) tested in 28 T cell assays, 34 B cell assays and 9 MHC ligand assays.	IEDB	1310589	461	475	LKPFERDISTEIYQA	ECO:0000213	PubMed	38781962
P0DTC2	LKPFERDISTEIYQA is a linear peptidic epitope (epitope ID 1310589) tested in 28 T cell assays, 34 B cell assays and 9 MHC ligand assays.	IEDB	1310589	461	475	LKPFERDISTEIYQA	ECO:0000213	PubMed	33911008
P0DTC2	LKPFERDISTEIYQA is a linear peptidic epitope (epitope ID 1310589) tested in 28 T cell assays, 34 B cell assays and 9 MHC ligand assays.	IEDB	1310589	461	475	LKPFERDISTEIYQA	ECO:0000213	PubMed	34061349
P0DTC2	LLALHRSYLTPGDSS is a linear peptidic epitope (epitope ID 1310592) tested in 19 T cell assays, 31 B cell assays and 8 MHC ligand assays.	IEDB	1310592	241	255	LLALHRSYLTPGDSS	ECO:0000213	PubMed	35957961
P0DTC2	LLFNKVTLADAGFIK is a linear peptidic epitope (epitope ID 1310593) tested in 16 T cell assays, 26 B cell assays and 7 MHC ligand assays.	IEDB	1310593	821	835	LLFNKVTLADAGFIK	ECO:0000213	PubMed	35957961
P0DTC2	LLFNKVTLADAGFIK is a linear peptidic epitope (epitope ID 1310593) tested in 16 T cell assays, 26 B cell assays and 7 MHC ligand assays.	IEDB	1310593	821	835	LLFNKVTLADAGFIK	ECO:0000213	PubMed	36646780
P0DTC2	LLKYNENGTITDAVD is a linear peptidic epitope (epitope ID 1310597) tested in 11 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310597	276	290	LLKYNENGTITDAVD	ECO:0000213	PubMed	35957961
P0DTC2	LMDLEGKQGNFKNLR is a linear peptidic epitope (epitope ID 1310603) tested in 10 T cell assays, 11 B cell assays and 22 MHC ligand assays.	IEDB	1310603	176	190	LMDLEGKQGNFKNLR	ECO:0000213	PubMed	35139340
P0DTC2	LNEVAKNLNESLIDL is a linear peptidic epitope (epitope ID 1310606) tested in 12 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1310606	1186	1200	LNEVAKNLNESLIDL	ECO:0000213	PubMed	35957961
P0DTC2	LPDPSKPSKRSFIED is a linear peptidic epitope (epitope ID 1310609) tested in 10 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310609	806	820	LPDPSKPSKRSFIED	ECO:0000213	PubMed	38781962
P0DTC2	LPFFSNVTWFHAIHV is a linear peptidic epitope (epitope ID 1310610) tested in 26 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1310610	56	70	LPFFSNVTWFHAIHV	ECO:0000213	PubMed	35139340
P0DTC2	LPFFSNVTWFHAIHV is a linear peptidic epitope (epitope ID 1310610) tested in 26 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1310610	56	70	LPFFSNVTWFHAIHV	ECO:0000213	PubMed	35957961
P0DTC2	LPPLLTDEMIAQYTS is a linear peptidic epitope (epitope ID 1310611) tested in 17 T cell assays, 23 B cell assays and 9 MHC ligand assays.	IEDB	1310611	861	875	LPPLLTDEMIAQYTS	ECO:0000213	PubMed	35957961
P0DTC2	LPPLLTDEMIAQYTS is a linear peptidic epitope (epitope ID 1310611) tested in 17 T cell assays, 23 B cell assays and 9 MHC ligand assays.	IEDB	1310611	861	875	LPPLLTDEMIAQYTS	ECO:0000213	PubMed	38781962
P0DTC2	LPQGFSALEPLVDLP is a linear peptidic epitope (epitope ID 1310612) tested in 15 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1310612	216	230	LPQGFSALEPLVDLP	ECO:0000213	PubMed	35957961
P0DTC2	LPQGFSALEPLVDLP is a linear peptidic epitope (epitope ID 1310612) tested in 15 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1310612	216	230	LPQGFSALEPLVDLP	ECO:0000213	PubMed	33220791
P0DTC2	LQPELDSFKEELDKY is a linear peptidic epitope (epitope ID 1310614) tested in 23 T cell assays, 29 B cell assays and 7 MHC ligand assays.	IEDB	1310614	1141	1155	LQPELDSFKEELDKY	ECO:0000213	PubMed	34805136
P0DTC2	LQPELDSFKEELDKY is a linear peptidic epitope (epitope ID 1310614) tested in 23 T cell assays, 29 B cell assays and 7 MHC ligand assays.	IEDB	1310614	1141	1155	LQPELDSFKEELDKY	ECO:0000213	PubMed	35139340
P0DTC2	LQPELDSFKEELDKY is a linear peptidic epitope (epitope ID 1310614) tested in 23 T cell assays, 29 B cell assays and 7 MHC ligand assays.	IEDB	1310614	1141	1155	LQPELDSFKEELDKY	ECO:0000213	PubMed	35957961
P0DTC2	LQPELDSFKEELDKY is a linear peptidic epitope (epitope ID 1310614) tested in 23 T cell assays, 29 B cell assays and 7 MHC ligand assays.	IEDB	1310614	1141	1155	LQPELDSFKEELDKY	ECO:0000213	PubMed	38781962
P0DTC2	LQPELDSFKEELDKY is a linear peptidic epitope (epitope ID 1310614) tested in 23 T cell assays, 29 B cell assays and 7 MHC ligand assays.	IEDB	1310614	1141	1155	LQPELDSFKEELDKY	ECO:0000213	PubMed	34061349
P0DTC2	LSETKCTLKSFTVEK is a linear peptidic epitope (epitope ID 1310618) tested in 12 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1310618	296	310	LSETKCTLKSFTVEK	ECO:0000213	PubMed	35957961
P0DTC2	LSETKCTLKSFTVEK is a linear peptidic epitope (epitope ID 1310618) tested in 12 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1310618	296	310	LSETKCTLKSFTVEK	ECO:0000213	PubMed	38781962
P0DTC2	LSRLDKVEAEVQIDR is a linear peptidic epitope (epitope ID 1310620) tested in 21 T cell assays, 23 B cell assays and 9 MHC ligand assays.	IEDB	1310620	981	995	LSRLDKVEAEVQIDR	ECO:0000213	PubMed	34006597
P0DTC2	LSRLDKVEAEVQIDR is a linear peptidic epitope (epitope ID 1310620) tested in 21 T cell assays, 23 B cell assays and 9 MHC ligand assays.	IEDB	1310620	981	995	LSRLDKVEAEVQIDR	ECO:0000213	PubMed	35957961
P0DTC2	LSRLDKVEAEVQIDR is a linear peptidic epitope (epitope ID 1310620) tested in 21 T cell assays, 23 B cell assays and 9 MHC ligand assays.	IEDB	1310620	981	995	LSRLDKVEAEVQIDR	ECO:0000213	PubMed	38781962
P0DTC2	LTDEMIAQY is a linear peptidic epitope (epitope ID 1310623) tested in 56 T cell assays and 3 MHC ligand assays.	IEDB	1310623	865	873	LTDEMIAQY	ECO:0000213	PubMed	33972535
P0DTC2	LTDEMIAQY is a linear peptidic epitope (epitope ID 1310623) tested in 56 T cell assays and 3 MHC ligand assays.	IEDB	1310623	865	873	LTDEMIAQY	ECO:0000213	PubMed	34793243
P0DTC2	LTDEMIAQY is a linear peptidic epitope (epitope ID 1310623) tested in 56 T cell assays and 3 MHC ligand assays.	IEDB	1310623	865	873	LTDEMIAQY	ECO:0000213	PubMed	34968416
P0DTC2	LTDEMIAQY is a linear peptidic epitope (epitope ID 1310623) tested in 56 T cell assays and 3 MHC ligand assays.	IEDB	1310623	865	873	LTDEMIAQY	ECO:0000213	PubMed	35383307
P0DTC2	LTDEMIAQY is a linear peptidic epitope (epitope ID 1310623) tested in 56 T cell assays and 3 MHC ligand assays.	IEDB	1310623	865	873	LTDEMIAQY	ECO:0000213	PubMed	35389886
P0DTC2	LTDEMIAQY is a linear peptidic epitope (epitope ID 1310623) tested in 56 T cell assays and 3 MHC ligand assays.	IEDB	1310623	865	873	LTDEMIAQY	ECO:0000213	PubMed	35484232
P0DTC2	LTDEMIAQY is a linear peptidic epitope (epitope ID 1310623) tested in 56 T cell assays and 3 MHC ligand assays.	IEDB	1310623	865	873	LTDEMIAQY	ECO:0000213	PubMed	36254196
P0DTC2	LTDEMIAQY is a linear peptidic epitope (epitope ID 1310623) tested in 56 T cell assays and 3 MHC ligand assays.	IEDB	1310623	865	873	LTDEMIAQY	ECO:0000213	PubMed	36302758
P0DTC2	LTDEMIAQY is a linear peptidic epitope (epitope ID 1310623) tested in 56 T cell assays and 3 MHC ligand assays.	IEDB	1310623	865	873	LTDEMIAQY	ECO:0000213	PubMed	38932408
P0DTC2	LTDEMIAQY is a linear peptidic epitope (epitope ID 1310623) tested in 56 T cell assays and 3 MHC ligand assays.	IEDB	1310623	865	873	LTDEMIAQY	ECO:0000213	PubMed	39284068
P0DTC2	LTDEMIAQY is a linear peptidic epitope (epitope ID 1310623) tested in 56 T cell assays and 3 MHC ligand assays.	IEDB	1310623	865	873	LTDEMIAQY	ECO:0000213	PubMed	32999467
P0DTC2	LTDEMIAQY is a linear peptidic epitope (epitope ID 1310623) tested in 56 T cell assays and 3 MHC ligand assays.	IEDB	1310623	865	873	LTDEMIAQY	ECO:0000213	PubMed	33184509
P0DTC2	LTDEMIAQY is a linear peptidic epitope (epitope ID 1310623) tested in 56 T cell assays and 3 MHC ligand assays.	IEDB	1310623	865	873	LTDEMIAQY	ECO:0000213	PubMed	34320609
P0DTC2	LTDEMIAQY is a linear peptidic epitope (epitope ID 1310623) tested in 56 T cell assays and 3 MHC ligand assays.	IEDB	1310623	865	873	LTDEMIAQY	ECO:0000213	PubMed	37275886
P0DTC2	LTDEMIAQY is a linear peptidic epitope (epitope ID 1310623) tested in 56 T cell assays and 3 MHC ligand assays.	IEDB	1310623	865	873	LTDEMIAQY	ECO:0000213	PubMed	33427749
P0DTC2	LTDEMIAQY is a linear peptidic epitope (epitope ID 1310623) tested in 56 T cell assays and 3 MHC ligand assays.	IEDB	1310623	865	873	LTDEMIAQY	ECO:0000213	PubMed	33853928
P0DTC2	LTGTGVLTESNKKFL is a linear peptidic epitope (epitope ID 1310624) tested in 10 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310624	546	560	LTGTGVLTESNKKFL	ECO:0000213	PubMed	35139340
P0DTC2	LTGTGVLTESNKKFL is a linear peptidic epitope (epitope ID 1310624) tested in 10 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310624	546	560	LTGTGVLTESNKKFL	ECO:0000213	PubMed	35957961
P0DTC2	LYENQKLIANQFNSA is a linear peptidic epitope (epitope ID 1310633) tested in 17 T cell assays, 10 B cell assays and 10 MHC ligand assays.	IEDB	1310633	916	930	LYENQKLIANQFNSA	ECO:0000213	PubMed	35957961
P0DTC2	LYENQKLIANQFNSA is a linear peptidic epitope (epitope ID 1310633) tested in 17 T cell assays, 10 B cell assays and 10 MHC ligand assays.	IEDB	1310633	916	930	LYENQKLIANQFNSA	ECO:0000213	PubMed	38781962
P0DTC2	LYQDVNCTEVPVAIH is a linear peptidic epitope (epitope ID 1310635) tested in 5 T cell assays, 18 B cell assays and 8 MHC ligand assays.	IEDB	1310635	611	625	LYQDVNCTEVPVAIH	ECO:0000213	PubMed	38781962
P0DTC2	MTKTSVDCTMYICGD is a linear peptidic epitope (epitope ID 1310649) tested in 14 T cell assays, 18 B cell assays and 9 MHC ligand assays.	IEDB	1310649	731	745	MTKTSVDCTMYICGD	ECO:0000213	PubMed	35957961
P0DTC2	MTKTSVDCTMYICGD is a linear peptidic epitope (epitope ID 1310649) tested in 14 T cell assays, 18 B cell assays and 9 MHC ligand assays.	IEDB	1310649	731	745	MTKTSVDCTMYICGD	ECO:0000213	PubMed	35154095
P0DTC2	NCTEVPVAIHADQLT is a linear peptidic epitope (epitope ID 1310653) tested in 14 T cell assays, 10 B cell assays and 8 MHC ligand assays.	IEDB	1310653	616	630	NCTEVPVAIHADQLT	ECO:0000213	PubMed	35957961
P0DTC2	NCTEVPVAIHADQLT is a linear peptidic epitope (epitope ID 1310653) tested in 14 T cell assays, 10 B cell assays and 8 MHC ligand assays.	IEDB	1310653	616	630	NCTEVPVAIHADQLT	ECO:0000213	PubMed	38781962
P0DTC2	NGVGYQPYRVVVLSF is a linear peptidic epitope (epitope ID 1310660) tested in 17 T cell assays, 36 B cell assays and 9 MHC ligand assays.	IEDB	1310660	501	515	NGVGYQPYRVVVLSF	ECO:0000213	PubMed	35957961
P0DTC2	NGVGYQPYRVVVLSF is a linear peptidic epitope (epitope ID 1310660) tested in 17 T cell assays, 36 B cell assays and 9 MHC ligand assays.	IEDB	1310660	501	515	NGVGYQPYRVVVLSF	ECO:0000213	PubMed	34514088
P0DTC2	NIDGYFKIYSKHTPI is a linear peptidic epitope (epitope ID 1310664) tested in 19 T cell assays, 10 B cell assays and 23 MHC ligand assays.	IEDB	1310664	196	210	NIDGYFKIYSKHTPI	ECO:0000213	PubMed	35139340
P0DTC2	NIDGYFKIYSKHTPI is a linear peptidic epitope (epitope ID 1310664) tested in 19 T cell assays, 10 B cell assays and 23 MHC ligand assays.	IEDB	1310664	196	210	NIDGYFKIYSKHTPI	ECO:0000213	PubMed	35484232
P0DTC2	NIDGYFKIYSKHTPI is a linear peptidic epitope (epitope ID 1310664) tested in 19 T cell assays, 10 B cell assays and 23 MHC ligand assays.	IEDB	1310664	196	210	NIDGYFKIYSKHTPI	ECO:0000213	PubMed	35957961
P0DTC2	NIDGYFKIYSKHTPI is a linear peptidic epitope (epitope ID 1310664) tested in 19 T cell assays, 10 B cell assays and 23 MHC ligand assays.	IEDB	1310664	196	210	NIDGYFKIYSKHTPI	ECO:0000213	PubMed	38781962
P0DTC2	NIDGYFKIYSKHTPI is a linear peptidic epitope (epitope ID 1310664) tested in 19 T cell assays, 10 B cell assays and 23 MHC ligand assays.	IEDB	1310664	196	210	NIDGYFKIYSKHTPI	ECO:0000213	PubMed	33220791
P0DTC2	NKCVNFNFNGLTGTG is a linear peptidic epitope (epitope ID 1310669) tested in 8 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310669	536	550	NKCVNFNFNGLTGTG	ECO:0000213	PubMed	35957961
P0DTC2	NKKFLPFQQFGRDIA is a linear peptidic epitope (epitope ID 1310671) tested in 12 T cell assays, 17 B cell assays and 11 MHC ligand assays.	IEDB	1310671	556	570	NKKFLPFQQFGRDIA	ECO:0000213	PubMed	35957961
P0DTC2	NKKFLPFQQFGRDIA is a linear peptidic epitope (epitope ID 1310671) tested in 12 T cell assays, 17 B cell assays and 11 MHC ligand assays.	IEDB	1310671	556	570	NKKFLPFQQFGRDIA	ECO:0000213	PubMed	38781962
P0DTC2	NKKFLPFQQFGRDIA is a linear peptidic epitope (epitope ID 1310671) tested in 12 T cell assays, 17 B cell assays and 11 MHC ligand assays.	IEDB	1310671	556	570	NKKFLPFQQFGRDIA	ECO:0000213	PubMed	33220791
P0DTC2	NVFQTRAGCLIGAEH is a linear peptidic epitope (epitope ID 1310695) tested in 15 T cell assays, 23 B cell assays and 7 MHC ligand assays.	IEDB	1310695	641	655	NVFQTRAGCLIGAEH	ECO:0000213	PubMed	35139340
P0DTC2	NVFQTRAGCLIGAEH is a linear peptidic epitope (epitope ID 1310695) tested in 15 T cell assays, 23 B cell assays and 7 MHC ligand assays.	IEDB	1310695	641	655	NVFQTRAGCLIGAEH	ECO:0000213	PubMed	35957961
P0DTC2	NVTWFHAIHVSGTNG is a linear peptidic epitope (epitope ID 1310701) tested in 24 T cell assays, 29 B cell assays and 11 MHC ligand assays.	IEDB	1310701	61	75	NVTWFHAIHVSGTNG	ECO:0000213	PubMed	35957961
P0DTC2	NVTWFHAIHVSGTNG is a linear peptidic epitope (epitope ID 1310701) tested in 24 T cell assays, 29 B cell assays and 11 MHC ligand assays.	IEDB	1310701	61	75	NVTWFHAIHVSGTNG	ECO:0000213	PubMed	38716629
P0DTC2	NVTWFHAIHVSGTNG is a linear peptidic epitope (epitope ID 1310701) tested in 24 T cell assays, 29 B cell assays and 11 MHC ligand assays.	IEDB	1310701	61	75	NVTWFHAIHVSGTNG	ECO:0000213	PubMed	34061349
P0DTC2	PAYTNSFTRGVYYPD is a linear peptidic epitope (epitope ID 1310705) tested in 9 T cell assays, 4 B cell assays and 8 MHC ligand assays.	IEDB	1310705	26	40	PAYTNSFTRGVYYPD	ECO:0000213	PubMed	35139340
P0DTC2	PAYTNSFTRGVYYPD is a linear peptidic epitope (epitope ID 1310705) tested in 9 T cell assays, 4 B cell assays and 8 MHC ligand assays.	IEDB	1310705	26	40	PAYTNSFTRGVYYPD	ECO:0000213	PubMed	35957961
P0DTC2	PDDFTGCVIAWNSNN is a linear peptidic epitope (epitope ID 1310707) tested in 11 T cell assays, 10 B cell assays and 10 MHC ligand assays.	IEDB	1310707	426	440	PDDFTGCVIAWNSNN	ECO:0000213	PubMed	35139340
P0DTC2	PDDFTGCVIAWNSNN is a linear peptidic epitope (epitope ID 1310707) tested in 11 T cell assays, 10 B cell assays and 10 MHC ligand assays.	IEDB	1310707	426	440	PDDFTGCVIAWNSNN	ECO:0000213	PubMed	35957961
P0DTC2	PDDFTGCVIAWNSNN is a linear peptidic epitope (epitope ID 1310707) tested in 11 T cell assays, 10 B cell assays and 10 MHC ligand assays.	IEDB	1310707	426	440	PDDFTGCVIAWNSNN	ECO:0000213	PubMed	38781962
P0DTC2	PFQQFGRDIADTTDA is a linear peptidic epitope (epitope ID 1310712) tested in 15 T cell assays, 27 B cell assays and 9 MHC ligand assays.	IEDB	1310712	561	575	PFQQFGRDIADTTDA	ECO:0000213	PubMed	35957961
P0DTC2	PFQQFGRDIADTTDA is a linear peptidic epitope (epitope ID 1310712) tested in 15 T cell assays, 27 B cell assays and 9 MHC ligand assays.	IEDB	1310712	561	575	PFQQFGRDIADTTDA	ECO:0000213	PubMed	36646780
P0DTC2	PFQQFGRDIADTTDA is a linear peptidic epitope (epitope ID 1310712) tested in 15 T cell assays, 27 B cell assays and 9 MHC ligand assays.	IEDB	1310712	561	575	PFQQFGRDIADTTDA	ECO:0000213	PubMed	38781962
P0DTC2	PGDSSSGWTAGAAAY is a linear peptidic epitope (epitope ID 1310714) tested in 10 T cell assays, 18 B cell assays and 7 MHC ligand assays.	IEDB	1310714	251	265	PGDSSSGWTAGAAAY	ECO:0000213	PubMed	35957961
P0DTC2	PLQSYGFQPTNGVGY is a linear peptidic epitope (epitope ID 1310721) tested in 11 T cell assays, 27 B cell assays and 9 MHC ligand assays.	IEDB	1310721	491	505	PLQSYGFQPTNGVGY	ECO:0000213	PubMed	35957961
P0DTC2	PRRARSVASQSIIAY is a linear peptidic epitope (epitope ID 1310725) tested in 32 T cell assays, 23 B cell assays and 9 MHC ligand assays.	IEDB	1310725	681	695	PRRARSVASQSIIAY	ECO:0000213	PubMed	35891550
P0DTC2	PRRARSVASQSIIAY is a linear peptidic epitope (epitope ID 1310725) tested in 32 T cell assays, 23 B cell assays and 9 MHC ligand assays.	IEDB	1310725	681	695	PRRARSVASQSIIAY	ECO:0000213	PubMed	35957961
P0DTC2	PRRARSVASQSIIAY is a linear peptidic epitope (epitope ID 1310725) tested in 32 T cell assays, 23 B cell assays and 9 MHC ligand assays.	IEDB	1310725	681	695	PRRARSVASQSIIAY	ECO:0000213	PubMed	36680141
P0DTC2	PRRARSVASQSIIAY is a linear peptidic epitope (epitope ID 1310725) tested in 32 T cell assays, 23 B cell assays and 9 MHC ligand assays.	IEDB	1310725	681	695	PRRARSVASQSIIAY	ECO:0000213	PubMed	38781962
P0DTC2	PVAIHADQLTPTWRV is a linear peptidic epitope (epitope ID 1310729) tested in 15 T cell assays, 26 B cell assays and 7 MHC ligand assays.	IEDB	1310729	621	635	PVAIHADQLTPTWRV	ECO:0000213	PubMed	38781962
P0DTC2	QEKNFTTAPAICHDG is a linear peptidic epitope (epitope ID 1310733) tested in 11 T cell assays, 18 B cell assays and 8 MHC ligand assays.	IEDB	1310733	1071	1085	QEKNFTTAPAICHDG	ECO:0000213	PubMed	35957961
P0DTC2	QEKNFTTAPAICHDG is a linear peptidic epitope (epitope ID 1310733) tested in 11 T cell assays, 18 B cell assays and 8 MHC ligand assays.	IEDB	1310733	1071	1085	QEKNFTTAPAICHDG	ECO:0000213	PubMed	38781962
P0DTC2	QFNSAIGKIQDSLSS is a linear peptidic epitope (epitope ID 1310735) tested in 9 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1310735	926	940	QFNSAIGKIQDSLSS	ECO:0000213	PubMed	38781962
P0DTC2	QLIRAAEIRASANLA is a linear peptidic epitope (epitope ID 1310739) tested in 11 T cell assays, 18 B cell assays and 10 MHC ligand assays.	IEDB	1310739	1011	1025	QLIRAAEIRASANLA	ECO:0000213	PubMed	35957961
P0DTC2	QLIRAAEIRASANLA is a linear peptidic epitope (epitope ID 1310739) tested in 11 T cell assays, 18 B cell assays and 10 MHC ligand assays.	IEDB	1310739	1011	1025	QLIRAAEIRASANLA	ECO:0000213	PubMed	38781962
P0DTC2	QPTESIVRFPNITNL is a linear peptidic epitope (epitope ID 1310745) tested in 23 T cell assays, 23 B cell assays and 7 MHC ligand assays.	IEDB	1310745	321	335	QPTESIVRFPNITNL	ECO:0000213	PubMed	34329696
P0DTC2	QPTESIVRFPNITNL is a linear peptidic epitope (epitope ID 1310745) tested in 23 T cell assays, 23 B cell assays and 7 MHC ligand assays.	IEDB	1310745	321	335	QPTESIVRFPNITNL	ECO:0000213	PubMed	35957961
P0DTC2	QPYRVVVLSFELLHA is a linear peptidic epitope (epitope ID 1310747) tested in 16 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310747	506	520	QPYRVVVLSFELLHA	ECO:0000213	PubMed	34162945
P0DTC2	QPYRVVVLSFELLHA is a linear peptidic epitope (epitope ID 1310747) tested in 16 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310747	506	520	QPYRVVVLSFELLHA	ECO:0000213	PubMed	35957961
P0DTC2	QRNFYEPQIITTDNT is a linear peptidic epitope (epitope ID 1310750) tested in 10 T cell assays, 10 B cell assays and 11 MHC ligand assays.	IEDB	1310750	1106	1120	QRNFYEPQIITTDNT	ECO:0000213	PubMed	35139340
P0DTC2	QRNFYEPQIITTDNT is a linear peptidic epitope (epitope ID 1310750) tested in 10 T cell assays, 10 B cell assays and 11 MHC ligand assays.	IEDB	1310750	1106	1120	QRNFYEPQIITTDNT	ECO:0000213	PubMed	35957961
P0DTC2	QSKRVDFCGKGYHLM is a linear peptidic epitope (epitope ID 1310752) tested in 13 T cell assays, 10 B cell assays and 8 MHC ligand assays.	IEDB	1310752	1036	1050	QSKRVDFCGKGYHLM	ECO:0000213	PubMed	35957961
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	33972535
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	34506741
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	34793243
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	34857854
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	34968416
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	35383307
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	35389886
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	35484232
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	35750048
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	36068240
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	36254196
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	37193826
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	38236134
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	38458195
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	38932408
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	39284068
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	32999467
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	34086357
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	33427749
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	33853928
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	34044428
P0DTC2	QYIKWPWYI is a linear peptidic epitope (epitope ID 1310756) tested in 107 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7ejl.	IEDB	1310756	1208	1216	QYIKWPWYI	ECO:0000213	PubMed	36526616
P0DTC2	RDISTEIYQAGSTPC is a linear peptidic epitope (epitope ID 1310761) tested in 15 T cell assays, 20 B cell assays and 11 MHC ligand assays.	IEDB	1310761	466	480	RDISTEIYQAGSTPC	ECO:0000213	PubMed	35957961
P0DTC2	RDISTEIYQAGSTPC is a linear peptidic epitope (epitope ID 1310761) tested in 15 T cell assays, 20 B cell assays and 11 MHC ligand assays.	IEDB	1310761	466	480	RDISTEIYQAGSTPC	ECO:0000213	PubMed	33220791
P0DTC2	RFASVYAWNRKRISN is a linear peptidic epitope (epitope ID 1310765) tested in 35 T cell assays, 12 B cell assays and 34 MHC ligand assays.	IEDB	1310765	346	360	RFASVYAWNRKRISN	ECO:0000213	PubMed	35139340
P0DTC2	RFASVYAWNRKRISN is a linear peptidic epitope (epitope ID 1310765) tested in 35 T cell assays, 12 B cell assays and 34 MHC ligand assays.	IEDB	1310765	346	360	RFASVYAWNRKRISN	ECO:0000213	PubMed	35484232
P0DTC2	RFASVYAWNRKRISN is a linear peptidic epitope (epitope ID 1310765) tested in 35 T cell assays, 12 B cell assays and 34 MHC ligand assays.	IEDB	1310765	346	360	RFASVYAWNRKRISN	ECO:0000213	PubMed	35957961
P0DTC2	RFASVYAWNRKRISN is a linear peptidic epitope (epitope ID 1310765) tested in 35 T cell assays, 12 B cell assays and 34 MHC ligand assays.	IEDB	1310765	346	360	RFASVYAWNRKRISN	ECO:0000213	PubMed	38105139
P0DTC2	RFASVYAWNRKRISN is a linear peptidic epitope (epitope ID 1310765) tested in 35 T cell assays, 12 B cell assays and 34 MHC ligand assays.	IEDB	1310765	346	360	RFASVYAWNRKRISN	ECO:0000213	PubMed	38781962
P0DTC2	RFASVYAWNRKRISN is a linear peptidic epitope (epitope ID 1310765) tested in 35 T cell assays, 12 B cell assays and 34 MHC ligand assays.	IEDB	1310765	346	360	RFASVYAWNRKRISN	ECO:0000213	PubMed	33220791
P0DTC2	RFASVYAWNRKRISN is a linear peptidic epitope (epitope ID 1310765) tested in 35 T cell assays, 12 B cell assays and 34 MHC ligand assays.	IEDB	1310765	346	360	RFASVYAWNRKRISN	ECO:0000213	PubMed	35699447
P0DTC2	RSYLTPGDSSSGWTA is a linear peptidic epitope (epitope ID 1310775) tested in 8 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310775	246	260	RSYLTPGDSSSGWTA	ECO:0000213	PubMed	35957961
P0DTC2	RTQLPPAYTNSFTRG is a linear peptidic epitope (epitope ID 1310777) tested in 19 T cell assays, 25 B cell assays and 7 MHC ligand assays.	IEDB	1310777	21	35	RTQLPPAYTNSFTRG	ECO:0000213	PubMed	35139340
P0DTC2	RTQLPPAYTNSFTRG is a linear peptidic epitope (epitope ID 1310777) tested in 19 T cell assays, 25 B cell assays and 7 MHC ligand assays.	IEDB	1310777	21	35	RTQLPPAYTNSFTRG	ECO:0000213	PubMed	35957961
P0DTC2	RTQLPPAYTNSFTRG is a linear peptidic epitope (epitope ID 1310777) tested in 19 T cell assays, 25 B cell assays and 7 MHC ligand assays.	IEDB	1310777	21	35	RTQLPPAYTNSFTRG	ECO:0000213	PubMed	38781962
P0DTC2	SASFSTFKCYGVSPT is a linear peptidic epitope (epitope ID 1310787) tested in 43 T cell assays, 21 B cell assays and 19 MHC ligand assays.	IEDB	1310787	371	385	SASFSTFKCYGVSPT	ECO:0000213	PubMed	34805136
P0DTC2	SASFSTFKCYGVSPT is a linear peptidic epitope (epitope ID 1310787) tested in 43 T cell assays, 21 B cell assays and 19 MHC ligand assays.	IEDB	1310787	371	385	SASFSTFKCYGVSPT	ECO:0000213	PubMed	35139340
P0DTC2	SASFSTFKCYGVSPT is a linear peptidic epitope (epitope ID 1310787) tested in 43 T cell assays, 21 B cell assays and 19 MHC ligand assays.	IEDB	1310787	371	385	SASFSTFKCYGVSPT	ECO:0000213	PubMed	35957961
P0DTC2	SASFSTFKCYGVSPT is a linear peptidic epitope (epitope ID 1310787) tested in 43 T cell assays, 21 B cell assays and 19 MHC ligand assays.	IEDB	1310787	371	385	SASFSTFKCYGVSPT	ECO:0000213	PubMed	33220791
P0DTC2	SASFSTFKCYGVSPT is a linear peptidic epitope (epitope ID 1310787) tested in 43 T cell assays, 21 B cell assays and 19 MHC ligand assays.	IEDB	1310787	371	385	SASFSTFKCYGVSPT	ECO:0000213	PubMed	35154095
P0DTC2	SFIEDLLFNKVTLAD is a linear peptidic epitope (epitope ID 1310796) tested in 43 T cell assays, 5 B cell assays and 19 MHC ligand assays.	IEDB	1310796	816	830	SFIEDLLFNKVTLAD	ECO:0000213	PubMed	34006597
P0DTC2	SFIEDLLFNKVTLAD is a linear peptidic epitope (epitope ID 1310796) tested in 43 T cell assays, 5 B cell assays and 19 MHC ligand assays.	IEDB	1310796	816	830	SFIEDLLFNKVTLAD	ECO:0000213	PubMed	34465633
P0DTC2	SFIEDLLFNKVTLAD is a linear peptidic epitope (epitope ID 1310796) tested in 43 T cell assays, 5 B cell assays and 19 MHC ligand assays.	IEDB	1310796	816	830	SFIEDLLFNKVTLAD	ECO:0000213	PubMed	35139340
P0DTC2	SFIEDLLFNKVTLAD is a linear peptidic epitope (epitope ID 1310796) tested in 43 T cell assays, 5 B cell assays and 19 MHC ligand assays.	IEDB	1310796	816	830	SFIEDLLFNKVTLAD	ECO:0000213	PubMed	35484232
P0DTC2	SFIEDLLFNKVTLAD is a linear peptidic epitope (epitope ID 1310796) tested in 43 T cell assays, 5 B cell assays and 19 MHC ligand assays.	IEDB	1310796	816	830	SFIEDLLFNKVTLAD	ECO:0000213	PubMed	35957961
P0DTC2	SFIEDLLFNKVTLAD is a linear peptidic epitope (epitope ID 1310796) tested in 43 T cell assays, 5 B cell assays and 19 MHC ligand assays.	IEDB	1310796	816	830	SFIEDLLFNKVTLAD	ECO:0000213	PubMed	38781962
P0DTC2	SGTNGTKRFDNPVLP is a linear peptidic epitope (epitope ID 1310799) tested in 13 T cell assays, 21 B cell assays and 8 MHC ligand assays.	IEDB	1310799	71	85	SGTNGTKRFDNPVLP	ECO:0000213	PubMed	35957961
P0DTC2	SGWTAGAAAYYVGYL is a linear peptidic epitope (epitope ID 1310800) tested in 14 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1310800	256	270	SGWTAGAAAYYVGYL	ECO:0000213	PubMed	35139340
P0DTC2	SIAIPTNFTISVTTE is a linear peptidic epitope (epitope ID 1310802) tested in 12 T cell assays, 18 B cell assays and 10 MHC ligand assays.	IEDB	1310802	711	725	SIAIPTNFTISVTTE	ECO:0000213	PubMed	35139340
P0DTC2	SIIAYTMSLGAENSV is a linear peptidic epitope (epitope ID 1310803) tested in 16 T cell assays, 27 B cell assays and 7 MHC ligand assays.	IEDB	1310803	691	705	SIIAYTMSLGAENSV	ECO:0000213	PubMed	35139340
P0DTC2	SIIAYTMSLGAENSV is a linear peptidic epitope (epitope ID 1310803) tested in 16 T cell assays, 27 B cell assays and 7 MHC ligand assays.	IEDB	1310803	691	705	SIIAYTMSLGAENSV	ECO:0000213	PubMed	35957961
P0DTC2	SIIAYTMSLGAENSV is a linear peptidic epitope (epitope ID 1310803) tested in 16 T cell assays, 27 B cell assays and 7 MHC ligand assays.	IEDB	1310803	691	705	SIIAYTMSLGAENSV	ECO:0000213	PubMed	38781962
P0DTC2	SLLIVNNATNVVIKV is a linear peptidic epitope (epitope ID 1310810) tested in 17 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310810	116	130	SLLIVNNATNVVIKV	ECO:0000213	PubMed	38781962
P0DTC2	SLLIVNNATNVVIKV is a linear peptidic epitope (epitope ID 1310810) tested in 17 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310810	116	130	SLLIVNNATNVVIKV	ECO:0000213	PubMed	35857619
P0DTC2	SNFRVQPTESIVRFP is a linear peptidic epitope (epitope ID 1310814) tested in 16 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1310814	316	330	SNFRVQPTESIVRFP	ECO:0000213	PubMed	35139340
P0DTC2	SNFRVQPTESIVRFP is a linear peptidic epitope (epitope ID 1310814) tested in 16 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1310814	316	330	SNFRVQPTESIVRFP	ECO:0000213	PubMed	35957961
P0DTC2	SSANNCTFEYVSQPF is a linear peptidic epitope (epitope ID 1310820) tested in 17 T cell assays, 23 B cell assays and 24 MHC ligand assays.	IEDB	1310820	161	175	SSANNCTFEYVSQPF	ECO:0000213	PubMed	34329696
P0DTC2	SSANNCTFEYVSQPF is a linear peptidic epitope (epitope ID 1310820) tested in 17 T cell assays, 23 B cell assays and 24 MHC ligand assays.	IEDB	1310820	161	175	SSANNCTFEYVSQPF	ECO:0000213	PubMed	35957961
P0DTC2	SSANNCTFEYVSQPF is a linear peptidic epitope (epitope ID 1310820) tested in 17 T cell assays, 23 B cell assays and 24 MHC ligand assays.	IEDB	1310820	161	175	SSANNCTFEYVSQPF	ECO:0000213	PubMed	38781962
P0DTC2	SVASQSIIAYTMSLG is a linear peptidic epitope (epitope ID 1310825) tested in 10 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1310825	686	700	SVASQSIIAYTMSLG	ECO:0000213	PubMed	35139340
P0DTC2	SVASQSIIAYTMSLG is a linear peptidic epitope (epitope ID 1310825) tested in 10 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1310825	686	700	SVASQSIIAYTMSLG	ECO:0000213	PubMed	35957961
P0DTC2	SVASQSIIAYTMSLG is a linear peptidic epitope (epitope ID 1310825) tested in 10 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1310825	686	700	SVASQSIIAYTMSLG	ECO:0000213	PubMed	38781962
P0DTC2	SVITPGTNTSNQVAV is a linear peptidic epitope (epitope ID 1310826) tested in 12 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310826	596	610	SVITPGTNTSNQVAV	ECO:0000213	PubMed	38781962
P0DTC2	SVLHSTQDLFLPFFS is a linear peptidic epitope (epitope ID 1310827) tested in 18 T cell assays, 10 B cell assays and 8 MHC ligand assays.	IEDB	1310827	46	60	SVLHSTQDLFLPFFS	ECO:0000213	PubMed	35139340
P0DTC2	SVLHSTQDLFLPFFS is a linear peptidic epitope (epitope ID 1310827) tested in 18 T cell assays, 10 B cell assays and 8 MHC ligand assays.	IEDB	1310827	46	60	SVLHSTQDLFLPFFS	ECO:0000213	PubMed	35484232
P0DTC2	SVLHSTQDLFLPFFS is a linear peptidic epitope (epitope ID 1310827) tested in 18 T cell assays, 10 B cell assays and 8 MHC ligand assays.	IEDB	1310827	46	60	SVLHSTQDLFLPFFS	ECO:0000213	PubMed	35957961
P0DTC2	SVLHSTQDLFLPFFS is a linear peptidic epitope (epitope ID 1310827) tested in 18 T cell assays, 10 B cell assays and 8 MHC ligand assays.	IEDB	1310827	46	60	SVLHSTQDLFLPFFS	ECO:0000213	PubMed	38781962
P0DTC2	SVLYNSASFSTFKCY is a linear peptidic epitope (epitope ID 1310828) tested in 13 T cell assays, 4 B cell assays and 8 MHC ligand assays.	IEDB	1310828	366	380	SVLYNSASFSTFKCY	ECO:0000213	PubMed	35139340
P0DTC2	SVLYNSASFSTFKCY is a linear peptidic epitope (epitope ID 1310828) tested in 13 T cell assays, 4 B cell assays and 8 MHC ligand assays.	IEDB	1310828	366	380	SVLYNSASFSTFKCY	ECO:0000213	PubMed	35957961
P0DTC2	SVLYNSASFSTFKCY is a linear peptidic epitope (epitope ID 1310828) tested in 13 T cell assays, 4 B cell assays and 8 MHC ligand assays.	IEDB	1310828	366	380	SVLYNSASFSTFKCY	ECO:0000213	PubMed	38781962
P0DTC2	SWMESEFRVYSSANN is a linear peptidic epitope (epitope ID 1310830) tested in 11 T cell assays, 24 B cell assays and 9 MHC ligand assays.	IEDB	1310830	151	165	SWMESEFRVYSSANN	ECO:0000213	PubMed	35957961
P0DTC2	SWMESEFRVYSSANN is a linear peptidic epitope (epitope ID 1310830) tested in 11 T cell assays, 24 B cell assays and 9 MHC ligand assays.	IEDB	1310830	151	165	SWMESEFRVYSSANN	ECO:0000213	PubMed	38781962
P0DTC2	TASALGKLQDVVNQN is a linear peptidic epitope (epitope ID 1310833) tested in 16 T cell assays, 23 B cell assays and 7 MHC ligand assays.	IEDB	1310833	941	955	TASALGKLQDVVNQN	ECO:0000213	PubMed	38781962
P0DTC2	TDAVDCALDPLSETK is a linear peptidic epitope (epitope ID 1310834) tested in 10 T cell assays, 10 B cell assays and 9 MHC ligand assays.	IEDB	1310834	286	300	TDAVDCALDPLSETK	ECO:0000213	PubMed	35957961
P0DTC2	TFKCYGVSPTKLNDL is a linear peptidic epitope (epitope ID 1310841) tested in 20 T cell assays, 22 B cell assays and 8 MHC ligand assays.	IEDB	1310841	376	390	TFKCYGVSPTKLNDL	ECO:0000213	PubMed	34162945
P0DTC2	TFKCYGVSPTKLNDL is a linear peptidic epitope (epitope ID 1310841) tested in 20 T cell assays, 22 B cell assays and 8 MHC ligand assays.	IEDB	1310841	376	390	TFKCYGVSPTKLNDL	ECO:0000213	PubMed	34756082
P0DTC2	TFKCYGVSPTKLNDL is a linear peptidic epitope (epitope ID 1310841) tested in 20 T cell assays, 22 B cell assays and 8 MHC ligand assays.	IEDB	1310841	376	390	TFKCYGVSPTKLNDL	ECO:0000213	PubMed	35957961
P0DTC2	TFKCYGVSPTKLNDL is a linear peptidic epitope (epitope ID 1310841) tested in 20 T cell assays, 22 B cell assays and 8 MHC ligand assays.	IEDB	1310841	376	390	TFKCYGVSPTKLNDL	ECO:0000213	PubMed	38781962
P0DTC2	TITSGWTFGAGAALQ is a linear peptidic epitope (epitope ID 1310847) tested in 18 T cell assays, 26 B cell assays and 8 MHC ligand assays.	IEDB	1310847	881	895	TITSGWTFGAGAALQ	ECO:0000213	PubMed	35139340
P0DTC2	TITSGWTFGAGAALQ is a linear peptidic epitope (epitope ID 1310847) tested in 18 T cell assays, 26 B cell assays and 8 MHC ligand assays.	IEDB	1310847	881	895	TITSGWTFGAGAALQ	ECO:0000213	PubMed	35957961
P0DTC2	TKRFDNPVLPFNDGV is a linear peptidic epitope (epitope ID 1310848) tested in 8 T cell assays, 10 B cell assays and 8 MHC ligand assays.	IEDB	1310848	76	90	TKRFDNPVLPFNDGV	ECO:0000213	PubMed	35957961
P0DTC2	TLEILDITPCSFGGV is a linear peptidic epitope (epitope ID 1310850) tested in 16 T cell assays, 26 B cell assays and 9 MHC ligand assays.	IEDB	1310850	581	595	TLEILDITPCSFGGV	ECO:0000213	PubMed	35957961
P0DTC2	TLEILDITPCSFGGV is a linear peptidic epitope (epitope ID 1310850) tested in 16 T cell assays, 26 B cell assays and 9 MHC ligand assays.	IEDB	1310850	581	595	TLEILDITPCSFGGV	ECO:0000213	PubMed	36646780
P0DTC2	TLEILDITPCSFGGV is a linear peptidic epitope (epitope ID 1310850) tested in 16 T cell assays, 26 B cell assays and 9 MHC ligand assays.	IEDB	1310850	581	595	TLEILDITPCSFGGV	ECO:0000213	PubMed	34061349
P0DTC2	TLVKQLSSNFGAISS is a linear peptidic epitope (epitope ID 1310852) tested in 18 T cell assays, 29 B cell assays and 10 MHC ligand assays.	IEDB	1310852	961	975	TLVKQLSSNFGAISS	ECO:0000213	PubMed	35157735
P0DTC2	TLVKQLSSNFGAISS is a linear peptidic epitope (epitope ID 1310852) tested in 18 T cell assays, 29 B cell assays and 10 MHC ligand assays.	IEDB	1310852	961	975	TLVKQLSSNFGAISS	ECO:0000213	PubMed	35957961
P0DTC2	TMSLGAENSVAYSNN is a linear peptidic epitope (epitope ID 1310854) tested in 11 T cell assays, 5 B cell assays and 8 MHC ligand assays.	IEDB	1310854	696	710	TMSLGAENSVAYSNN	ECO:0000213	PubMed	35957961
P0DTC2	TNFTISVTTEILPVS is a linear peptidic epitope (epitope ID 1310855) tested in 18 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1310855	716	730	TNFTISVTTEILPVS	ECO:0000213	PubMed	35139340
P0DTC2	TNFTISVTTEILPVS is a linear peptidic epitope (epitope ID 1310855) tested in 18 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1310855	716	730	TNFTISVTTEILPVS	ECO:0000213	PubMed	35957961
P0DTC2	TNFTISVTTEILPVS is a linear peptidic epitope (epitope ID 1310855) tested in 18 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1310855	716	730	TNFTISVTTEILPVS	ECO:0000213	PubMed	38781962
P0DTC2	TNLVKNKCVNFNFNG is a linear peptidic epitope (epitope ID 1310857) tested in 11 T cell assays, 18 B cell assays and 9 MHC ligand assays.	IEDB	1310857	531	545	TNLVKNKCVNFNFNG	ECO:0000213	PubMed	35139340
P0DTC2	TNLVKNKCVNFNFNG is a linear peptidic epitope (epitope ID 1310857) tested in 11 T cell assays, 18 B cell assays and 9 MHC ligand assays.	IEDB	1310857	531	545	TNLVKNKCVNFNFNG	ECO:0000213	PubMed	35957961
P0DTC2	TQDLFLPFFSNVTWF is a linear peptidic epitope (epitope ID 1310861) tested in 14 T cell assays, 18 B cell assays and 10 MHC ligand assays.	IEDB	1310861	51	65	TQDLFLPFFSNVTWF	ECO:0000213	PubMed	35957961
P0DTC2	TQLNRALTGIAVEQD is a linear peptidic epitope (epitope ID 1310863) tested in 54 T cell assays, 24 B cell assays, 14 MHC ligand assays and has 3D structure(s) 8cmd.	IEDB	1310863	761	775	TQLNRALTGIAVEQD	ECO:0000213	PubMed	35139340
P0DTC2	TQLNRALTGIAVEQD is a linear peptidic epitope (epitope ID 1310863) tested in 54 T cell assays, 24 B cell assays, 14 MHC ligand assays and has 3D structure(s) 8cmd.	IEDB	1310863	761	775	TQLNRALTGIAVEQD	ECO:0000213	PubMed	35891550
P0DTC2	TQLNRALTGIAVEQD is a linear peptidic epitope (epitope ID 1310863) tested in 54 T cell assays, 24 B cell assays, 14 MHC ligand assays and has 3D structure(s) 8cmd.	IEDB	1310863	761	775	TQLNRALTGIAVEQD	ECO:0000213	PubMed	35957961
P0DTC2	TQLNRALTGIAVEQD is a linear peptidic epitope (epitope ID 1310863) tested in 54 T cell assays, 24 B cell assays, 14 MHC ligand assays and has 3D structure(s) 8cmd.	IEDB	1310863	761	775	TQLNRALTGIAVEQD	ECO:0000213	PubMed	36680141
P0DTC2	TQLNRALTGIAVEQD is a linear peptidic epitope (epitope ID 1310863) tested in 54 T cell assays, 24 B cell assays, 14 MHC ligand assays and has 3D structure(s) 8cmd.	IEDB	1310863	761	775	TQLNRALTGIAVEQD	ECO:0000213	PubMed	38781962
P0DTC2	TQLNRALTGIAVEQD is a linear peptidic epitope (epitope ID 1310863) tested in 54 T cell assays, 24 B cell assays, 14 MHC ligand assays and has 3D structure(s) 8cmd.	IEDB	1310863	761	775	TQLNRALTGIAVEQD	ECO:0000213	PubMed	35154095
P0DTC2	TQTNSPRRARSVASQ is a linear peptidic epitope (epitope ID 1310864) tested in 11 T cell assays, 11 B cell assays and 9 MHC ligand assays.	IEDB	1310864	676	690	TQTNSPRRARSVASQ	ECO:0000213	PubMed	38781962
P0DTC2	TRFQTLLALHRSYLT is a linear peptidic epitope (epitope ID 1310865) tested in 66 T cell assays, 4 B cell assays and 22 MHC ligand assays.	IEDB	1310865	236	250	TRFQTLLALHRSYLT	ECO:0000213	PubMed	33744048
P0DTC2	TRFQTLLALHRSYLT is a linear peptidic epitope (epitope ID 1310865) tested in 66 T cell assays, 4 B cell assays and 22 MHC ligand assays.	IEDB	1310865	236	250	TRFQTLLALHRSYLT	ECO:0000213	PubMed	35314848
P0DTC2	TRFQTLLALHRSYLT is a linear peptidic epitope (epitope ID 1310865) tested in 66 T cell assays, 4 B cell assays and 22 MHC ligand assays.	IEDB	1310865	236	250	TRFQTLLALHRSYLT	ECO:0000213	PubMed	35957961
P0DTC2	TRFQTLLALHRSYLT is a linear peptidic epitope (epitope ID 1310865) tested in 66 T cell assays, 4 B cell assays and 22 MHC ligand assays.	IEDB	1310865	236	250	TRFQTLLALHRSYLT	ECO:0000213	PubMed	38781962
P0DTC2	TRFQTLLALHRSYLT is a linear peptidic epitope (epitope ID 1310865) tested in 66 T cell assays, 4 B cell assays and 22 MHC ligand assays.	IEDB	1310865	236	250	TRFQTLLALHRSYLT	ECO:0000213	PubMed	34320609
P0DTC2	TTAPAICHDGKAHFP is a linear peptidic epitope (epitope ID 1310870) tested in 13 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310870	1076	1090	TTAPAICHDGKAHFP	ECO:0000213	PubMed	35139340
P0DTC2	TTAPAICHDGKAHFP is a linear peptidic epitope (epitope ID 1310870) tested in 13 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310870	1076	1090	TTAPAICHDGKAHFP	ECO:0000213	PubMed	35957961
P0DTC2	TTAPAICHDGKAHFP is a linear peptidic epitope (epitope ID 1310870) tested in 13 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310870	1076	1090	TTAPAICHDGKAHFP	ECO:0000213	PubMed	38781962
P0DTC2	TTDNTFVSGNCDVVI is a linear peptidic epitope (epitope ID 1310871) tested in 12 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1310871	1116	1130	TTDNTFVSGNCDVVI	ECO:0000213	PubMed	35139340
P0DTC2	TTDNTFVSGNCDVVI is a linear peptidic epitope (epitope ID 1310871) tested in 12 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1310871	1116	1130	TTDNTFVSGNCDVVI	ECO:0000213	PubMed	35957961
P0DTC2	TVYDPLQPELDSFKE is a linear peptidic epitope (epitope ID 1310874) tested in 13 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310874	1136	1150	TVYDPLQPELDSFKE	ECO:0000213	PubMed	35139340
P0DTC2	TVYDPLQPELDSFKE is a linear peptidic epitope (epitope ID 1310874) tested in 13 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310874	1136	1150	TVYDPLQPELDSFKE	ECO:0000213	PubMed	35957961
P0DTC2	TVYDPLQPELDSFKE is a linear peptidic epitope (epitope ID 1310874) tested in 13 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310874	1136	1150	TVYDPLQPELDSFKE	ECO:0000213	PubMed	38781962
P0DTC2	TYVPAQEKNFTTAPA is a linear peptidic epitope (epitope ID 1310875) tested in 11 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1310875	1066	1080	TYVPAQEKNFTTAPA	ECO:0000213	PubMed	35957961
P0DTC2	TYVPAQEKNFTTAPA is a linear peptidic epitope (epitope ID 1310875) tested in 11 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1310875	1066	1080	TYVPAQEKNFTTAPA	ECO:0000213	PubMed	38781962
P0DTC2	TYVTQQLIRAAEIRA is a linear peptidic epitope (epitope ID 1310876) tested in 10 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1310876	1006	1020	TYVTQQLIRAAEIRA	ECO:0000213	PubMed	35957961
P0DTC2	VDCTMYICGDSTECS is a linear peptidic epitope (epitope ID 1310877) tested in 11 T cell assays, 10 B cell assays and 8 MHC ligand assays.	IEDB	1310877	736	750	VDCTMYICGDSTECS	ECO:0000213	PubMed	35957961
P0DTC2	VFAQVKQIYKTPPIK is a linear peptidic epitope (epitope ID 1310884) tested in 24 T cell assays, 32 B cell assays and 7 MHC ligand assays.	IEDB	1310884	781	795	VFAQVKQIYKTPPIK	ECO:0000213	PubMed	35139340
P0DTC2	VFAQVKQIYKTPPIK is a linear peptidic epitope (epitope ID 1310884) tested in 24 T cell assays, 32 B cell assays and 7 MHC ligand assays.	IEDB	1310884	781	795	VFAQVKQIYKTPPIK	ECO:0000213	PubMed	35957961
P0DTC2	VFAQVKQIYKTPPIK is a linear peptidic epitope (epitope ID 1310884) tested in 24 T cell assays, 32 B cell assays and 7 MHC ligand assays.	IEDB	1310884	781	795	VFAQVKQIYKTPPIK	ECO:0000213	PubMed	38781962
P0DTC2	VFLHVTYVPAQEKNF is a linear peptidic epitope (epitope ID 1310885) tested in 15 T cell assays, 23 B cell assays and 7 MHC ligand assays.	IEDB	1310885	1061	1075	VFLHVTYVPAQEKNF	ECO:0000213	PubMed	35957961
P0DTC2	VFLHVTYVPAQEKNF is a linear peptidic epitope (epitope ID 1310885) tested in 15 T cell assays, 23 B cell assays and 7 MHC ligand assays.	IEDB	1310885	1061	1075	VFLHVTYVPAQEKNF	ECO:0000213	PubMed	38781962
P0DTC2	VFNATRFASVYAWNR is a linear peptidic epitope (epitope ID 1310886) tested in 45 T cell assays, 26 B cell assays and 18 MHC ligand assays.	IEDB	1310886	341	355	VFNATRFASVYAWNR	ECO:0000213	PubMed	34162945
P0DTC2	VFNATRFASVYAWNR is a linear peptidic epitope (epitope ID 1310886) tested in 45 T cell assays, 26 B cell assays and 18 MHC ligand assays.	IEDB	1310886	341	355	VFNATRFASVYAWNR	ECO:0000213	PubMed	35957961
P0DTC2	VIRGDEVRQIAPGQT is a linear peptidic epitope (epitope ID 1310891) tested in 22 T cell assays, 32 B cell assays and 10 MHC ligand assays.	IEDB	1310891	401	415	VIRGDEVRQIAPGQT	ECO:0000213	PubMed	35484232
P0DTC2	VIRGDEVRQIAPGQT is a linear peptidic epitope (epitope ID 1310891) tested in 22 T cell assays, 32 B cell assays and 10 MHC ligand assays.	IEDB	1310891	401	415	VIRGDEVRQIAPGQT	ECO:0000213	PubMed	35957961
P0DTC2	VIRGDEVRQIAPGQT is a linear peptidic epitope (epitope ID 1310891) tested in 22 T cell assays, 32 B cell assays and 10 MHC ligand assays.	IEDB	1310891	401	415	VIRGDEVRQIAPGQT	ECO:0000213	PubMed	38781962
P0DTC2	VLNDILSRLDKVEAE is a linear peptidic epitope (epitope ID 1310902) tested in 10 T cell assays, 13 B cell assays and 9 MHC ligand assays.	IEDB	1310902	976	990	VLNDILSRLDKVEAE	ECO:0000213	PubMed	35957961
P0DTC2	VLTESNKKFLPFQQF is a linear peptidic epitope (epitope ID 1310904) tested in 11 T cell assays, 23 B cell assays and 7 MHC ligand assays.	IEDB	1310904	551	565	VLTESNKKFLPFQQF	ECO:0000213	PubMed	35957961
P0DTC2	VLTESNKKFLPFQQF is a linear peptidic epitope (epitope ID 1310904) tested in 11 T cell assays, 23 B cell assays and 7 MHC ligand assays.	IEDB	1310904	551	565	VLTESNKKFLPFQQF	ECO:0000213	PubMed	38781962
P0DTC2	VNNSYECDIPIGAGI is a linear peptidic epitope (epitope ID 1310910) tested in 13 T cell assays, 4 B cell assays and 8 MHC ligand assays.	IEDB	1310910	656	670	VNNSYECDIPIGAGI	ECO:0000213	PubMed	35957961
P0DTC2	VNNSYECDIPIGAGI is a linear peptidic epitope (epitope ID 1310910) tested in 13 T cell assays, 4 B cell assays and 8 MHC ligand assays.	IEDB	1310910	656	670	VNNSYECDIPIGAGI	ECO:0000213	PubMed	38781962
P0DTC2	VRDPQTLEILDITPC is a linear peptidic epitope (epitope ID 1310916) tested in 12 T cell assays, 5 B cell assays and 9 MHC ligand assays.	IEDB	1310916	576	590	VRDPQTLEILDITPC	ECO:0000213	PubMed	35957961
P0DTC2	VRDPQTLEILDITPC is a linear peptidic epitope (epitope ID 1310916) tested in 12 T cell assays, 5 B cell assays and 9 MHC ligand assays.	IEDB	1310916	576	590	VRDPQTLEILDITPC	ECO:0000213	PubMed	38781962
P0DTC2	VSNGTHWFVTQRNFY is a linear peptidic epitope (epitope ID 1310921) tested in 13 T cell assays, 10 B cell assays and 10 MHC ligand assays.	IEDB	1310921	1096	1110	VSNGTHWFVTQRNFY	ECO:0000213	PubMed	35957961
P0DTC2	VSQPFLMDLEGKQGN is a linear peptidic epitope (epitope ID 1310922) tested in 13 T cell assays, 18 B cell assays and 8 MHC ligand assays.	IEDB	1310922	171	185	VSQPFLMDLEGKQGN	ECO:0000213	PubMed	35957961
P0DTC2	VSQPFLMDLEGKQGN is a linear peptidic epitope (epitope ID 1310922) tested in 13 T cell assays, 18 B cell assays and 8 MHC ligand assays.	IEDB	1310922	171	185	VSQPFLMDLEGKQGN	ECO:0000213	PubMed	38781962
P0DTC2	VTLADAGFIKQYGDC is a linear peptidic epitope (epitope ID 1310925) tested in 12 T cell assays, 10 B cell assays and 8 MHC ligand assays.	IEDB	1310925	826	840	VTLADAGFIKQYGDC	ECO:0000213	PubMed	35957961
P0DTC2	VTLADAGFIKQYGDC is a linear peptidic epitope (epitope ID 1310925) tested in 12 T cell assays, 10 B cell assays and 8 MHC ligand assays.	IEDB	1310925	826	840	VTLADAGFIKQYGDC	ECO:0000213	PubMed	38781962
P0DTC2	VTQNVLYENQKLIAN is a linear peptidic epitope (epitope ID 1310927) tested in 13 T cell assays, 18 B cell assays and 7 MHC ligand assays.	IEDB	1310927	911	925	VTQNVLYENQKLIAN	ECO:0000213	PubMed	35957961
P0DTC2	VTYVPAQEK is a linear peptidic epitope (epitope ID 1310928) tested in 9 T cell assays and 3 MHC ligand assays.	IEDB	1310928	1065	1073	VTYVPAQEK	ECO:0000213	PubMed	34728796
P0DTC2	VVIKVCEFQFCNDPF is a linear peptidic epitope (epitope ID 1310930) tested in 11 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310930	126	140	VVIKVCEFQFCNDPF	ECO:0000213	PubMed	35139340
P0DTC2	VVIKVCEFQFCNDPF is a linear peptidic epitope (epitope ID 1310930) tested in 11 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310930	126	140	VVIKVCEFQFCNDPF	ECO:0000213	PubMed	35957961
P0DTC2	VVIKVCEFQFCNDPF is a linear peptidic epitope (epitope ID 1310930) tested in 11 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310930	126	140	VVIKVCEFQFCNDPF	ECO:0000213	PubMed	38781962
P0DTC2	VVNIQKEIDRLNEVA is a linear peptidic epitope (epitope ID 1310931) tested in 11 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310931	1176	1190	VVNIQKEIDRLNEVA	ECO:0000213	PubMed	35957961
P0DTC2	VVNQNAQALNTLVKQ is a linear peptidic epitope (epitope ID 1310932) tested in 11 T cell assays, 18 B cell assays and 7 MHC ligand assays.	IEDB	1310932	951	965	VVNQNAQALNTLVKQ	ECO:0000213	PubMed	35139340
P0DTC2	VYYPDKVFRSSVLHS is a linear peptidic epitope (epitope ID 1310935) tested in 18 T cell assays, 5 B cell assays and 9 MHC ligand assays.	IEDB	1310935	36	50	VYYPDKVFRSSVLHS	ECO:0000213	PubMed	35484232
P0DTC2	VYYPDKVFRSSVLHS is a linear peptidic epitope (epitope ID 1310935) tested in 18 T cell assays, 5 B cell assays and 9 MHC ligand assays.	IEDB	1310935	36	50	VYYPDKVFRSSVLHS	ECO:0000213	PubMed	35957961
P0DTC2	VYYPDKVFRSSVLHS is a linear peptidic epitope (epitope ID 1310935) tested in 18 T cell assays, 5 B cell assays and 9 MHC ligand assays.	IEDB	1310935	36	50	VYYPDKVFRSSVLHS	ECO:0000213	PubMed	38781962
P0DTC2	WNSNNLDSKVGGNYN is a linear peptidic epitope (epitope ID 1310945) tested in 12 T cell assays, 18 B cell assays and 7 MHC ligand assays.	IEDB	1310945	436	450	WNSNNLDSKVGGNYN	ECO:0000213	PubMed	34756082
P0DTC2	WTFGAGAALQIPFAM is a linear peptidic epitope (epitope ID 1310947) tested in 12 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1310947	886	900	WTFGAGAALQIPFAM	ECO:0000213	PubMed	35957961
P0DTC2	WTFGAGAALQIPFAM is a linear peptidic epitope (epitope ID 1310947) tested in 12 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1310947	886	900	WTFGAGAALQIPFAM	ECO:0000213	PubMed	38781962
P0DTC2	YADSFVIRGDEVRQI is a linear peptidic epitope (epitope ID 1310948) tested in 17 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1310948	396	410	YADSFVIRGDEVRQI	ECO:0000213	PubMed	35139340
P0DTC2	YADSFVIRGDEVRQI is a linear peptidic epitope (epitope ID 1310948) tested in 17 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1310948	396	410	YADSFVIRGDEVRQI	ECO:0000213	PubMed	35957961
P0DTC2	YADSFVIRGDEVRQI is a linear peptidic epitope (epitope ID 1310948) tested in 17 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1310948	396	410	YADSFVIRGDEVRQI	ECO:0000213	PubMed	38781962
P0DTC2	YGSFCTQLNRALTGI is a linear peptidic epitope (epitope ID 1310955) tested in 8 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1310955	756	770	YGSFCTQLNRALTGI	ECO:0000213	PubMed	35957961
P0DTC2	YSTGSNVFQTRAGCL is a linear peptidic epitope (epitope ID 1310978) tested in 12 T cell assays, 7 B cell assays and 7 MHC ligand assays.	IEDB	1310978	636	650	YSTGSNVFQTRAGCL	ECO:0000213	PubMed	35957961
P0DTC2	YSTGSNVFQTRAGCL is a linear peptidic epitope (epitope ID 1310978) tested in 12 T cell assays, 7 B cell assays and 7 MHC ligand assays.	IEDB	1310978	636	650	YSTGSNVFQTRAGCL	ECO:0000213	PubMed	38781962
P0DTC2	YVGYLQPRTFLLKYN is a linear peptidic epitope (epitope ID 1310979) tested in 13 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310979	266	280	YVGYLQPRTFLLKYN	ECO:0000213	PubMed	34162945
P0DTC2	YVGYLQPRTFLLKYN is a linear peptidic epitope (epitope ID 1310979) tested in 13 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310979	266	280	YVGYLQPRTFLLKYN	ECO:0000213	PubMed	35139340
P0DTC2	YVGYLQPRTFLLKYN is a linear peptidic epitope (epitope ID 1310979) tested in 13 T cell assays, 4 B cell assays and 7 MHC ligand assays.	IEDB	1310979	266	280	YVGYLQPRTFLLKYN	ECO:0000213	PubMed	35957961
P0DTC2	KCYGVSPTK is a linear peptidic epitope (epitope ID 1311170) tested in 44 T cell assays and 2 MHC ligand assays.	IEDB	1311170	378	386	KCYGVSPTK	ECO:0000213	PubMed	34729465
P0DTC2	KCYGVSPTK is a linear peptidic epitope (epitope ID 1311170) tested in 44 T cell assays and 2 MHC ligand assays.	IEDB	1311170	378	386	KCYGVSPTK	ECO:0000213	PubMed	34968416
P0DTC2	KCYGVSPTK is a linear peptidic epitope (epitope ID 1311170) tested in 44 T cell assays and 2 MHC ligand assays.	IEDB	1311170	378	386	KCYGVSPTK	ECO:0000213	PubMed	35389886
P0DTC2	KCYGVSPTK is a linear peptidic epitope (epitope ID 1311170) tested in 44 T cell assays and 2 MHC ligand assays.	IEDB	1311170	378	386	KCYGVSPTK	ECO:0000213	PubMed	35484232
P0DTC2	KCYGVSPTK is a linear peptidic epitope (epitope ID 1311170) tested in 44 T cell assays and 2 MHC ligand assays.	IEDB	1311170	378	386	KCYGVSPTK	ECO:0000213	PubMed	36254196
P0DTC2	KCYGVSPTK is a linear peptidic epitope (epitope ID 1311170) tested in 44 T cell assays and 2 MHC ligand assays.	IEDB	1311170	378	386	KCYGVSPTK	ECO:0000213	PubMed	36494499
P0DTC2	KCYGVSPTK is a linear peptidic epitope (epitope ID 1311170) tested in 44 T cell assays and 2 MHC ligand assays.	IEDB	1311170	378	386	KCYGVSPTK	ECO:0000213	PubMed	38781962
P0DTC2	KCYGVSPTK is a linear peptidic epitope (epitope ID 1311170) tested in 44 T cell assays and 2 MHC ligand assays.	IEDB	1311170	378	386	KCYGVSPTK	ECO:0000213	PubMed	38932408
P0DTC2	KCYGVSPTK is a linear peptidic epitope (epitope ID 1311170) tested in 44 T cell assays and 2 MHC ligand assays.	IEDB	1311170	378	386	KCYGVSPTK	ECO:0000213	PubMed	39284068
P0DTC2	KCYGVSPTK is a linear peptidic epitope (epitope ID 1311170) tested in 44 T cell assays and 2 MHC ligand assays.	IEDB	1311170	378	386	KCYGVSPTK	ECO:0000213	PubMed	34320609
P0DTC2	KCYGVSPTK is a linear peptidic epitope (epitope ID 1311170) tested in 44 T cell assays and 2 MHC ligand assays.	IEDB	1311170	378	386	KCYGVSPTK	ECO:0000213	PubMed	37275886
P0DTC2	KCYGVSPTK is a linear peptidic epitope (epitope ID 1311170) tested in 44 T cell assays and 2 MHC ligand assays.	IEDB	1311170	378	386	KCYGVSPTK	ECO:0000213	PubMed	33853928
P0DTC2	AIHADQL is a linear peptidic epitope (epitope ID 1311314) tested in 1 B cell assay.	IEDB	1311314	623	629	AIHADQL	ECO:0000213	PubMed	33134398
P0DTC2	DLGDISGI is a linear peptidic epitope (epitope ID 1311330) tested in 1 B cell assay.	IEDB	1311330	1165	1172	DLGDISGI	ECO:0000213	PubMed	33134398
P0DTC2	GPKKSTNL is a linear peptidic epitope (epitope ID 1311370) tested in 4 T cell assays and 2 MHC ligand assays.	IEDB	1311370	526	533	GPKKSTNL	ECO:0000213	PubMed	35171086
P0DTC2	LDPLSET is a linear peptidic epitope (epitope ID 1311393) tested in 1 B cell assay.	IEDB	1311393	293	299	LDPLSET	ECO:0000213	PubMed	33134398
P0DTC2	QIYKTPP is a linear peptidic epitope (epitope ID 1311461) tested in 1 B cell assay.	IEDB	1311461	787	793	QIYKTPP	ECO:0000213	PubMed	33134398
P0DTC2	VYAWNRKRI is a linear peptidic epitope (epitope ID 1311525) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1311525	350	358	VYAWNRKRI	ECO:0000213	PubMed	33923363
P0DTC2	VYAWNRKRI is a linear peptidic epitope (epitope ID 1311525) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1311525	350	358	VYAWNRKRI	ECO:0000213	PubMed	34728796
P0DTC2	VYAWNRKRI is a linear peptidic epitope (epitope ID 1311525) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1311525	350	358	VYAWNRKRI	ECO:0000213	PubMed	34793243
P0DTC2	KWPWYIWLGF is a linear peptidic epitope (epitope ID 1311572) tested in 7 T cell assays.	IEDB	1311572	1211	1220	KWPWYIWLGF	ECO:0000213	PubMed	34968416
P0DTC2	KWPWYIWLGF is a linear peptidic epitope (epitope ID 1311572) tested in 7 T cell assays.	IEDB	1311572	1211	1220	KWPWYIWLGF	ECO:0000213	PubMed	37193826
P0DTC2	KWPWYIWLGF is a linear peptidic epitope (epitope ID 1311572) tested in 7 T cell assays.	IEDB	1311572	1211	1220	KWPWYIWLGF	ECO:0000213	PubMed	33184509
P0DTC2	KWPWYIWLGF is a linear peptidic epitope (epitope ID 1311572) tested in 7 T cell assays.	IEDB	1311572	1211	1220	KWPWYIWLGF	ECO:0000213	PubMed	34044428
P0DTC2	SPRRARSVA is a linear peptidic epitope (epitope ID 1311590) tested in 23 T cell assays and 1 MHC ligand assay.	IEDB	1311590	680	688	SPRRARSVA	ECO:0000213	PubMed	34793243
P0DTC2	SPRRARSVA is a linear peptidic epitope (epitope ID 1311590) tested in 23 T cell assays and 1 MHC ligand assay.	IEDB	1311590	680	688	SPRRARSVA	ECO:0000213	PubMed	35484232
P0DTC2	SPRRARSVA is a linear peptidic epitope (epitope ID 1311590) tested in 23 T cell assays and 1 MHC ligand assay.	IEDB	1311590	680	688	SPRRARSVA	ECO:0000213	PubMed	36254196
P0DTC2	SPRRARSVA is a linear peptidic epitope (epitope ID 1311590) tested in 23 T cell assays and 1 MHC ligand assay.	IEDB	1311590	680	688	SPRRARSVA	ECO:0000213	PubMed	36302758
P0DTC2	SPRRARSVA is a linear peptidic epitope (epitope ID 1311590) tested in 23 T cell assays and 1 MHC ligand assay.	IEDB	1311590	680	688	SPRRARSVA	ECO:0000213	PubMed	37193826
P0DTC2	SPRRARSVA is a linear peptidic epitope (epitope ID 1311590) tested in 23 T cell assays and 1 MHC ligand assay.	IEDB	1311590	680	688	SPRRARSVA	ECO:0000213	PubMed	38077128
P0DTC2	SPRRARSVA is a linear peptidic epitope (epitope ID 1311590) tested in 23 T cell assays and 1 MHC ligand assay.	IEDB	1311590	680	688	SPRRARSVA	ECO:0000213	PubMed	38932408
P0DTC2	SPRRARSVA is a linear peptidic epitope (epitope ID 1311590) tested in 23 T cell assays and 1 MHC ligand assay.	IEDB	1311590	680	688	SPRRARSVA	ECO:0000213	PubMed	33184509
P0DTC2	SPRRARSVA is a linear peptidic epitope (epitope ID 1311590) tested in 23 T cell assays and 1 MHC ligand assay.	IEDB	1311590	680	688	SPRRARSVA	ECO:0000213	PubMed	38045681
P0DTC2	SPRRARSVA is a linear peptidic epitope (epitope ID 1311590) tested in 23 T cell assays and 1 MHC ligand assay.	IEDB	1311590	680	688	SPRRARSVA	ECO:0000213	PubMed	33853928
P0DTC2	YEQYIKWPW is a linear peptidic epitope (epitope ID 1311601) tested in 6 T cell assays.	IEDB	1311601	1206	1214	YEQYIKWPW	ECO:0000213	PubMed	33184509
P0DTC2	YEQYIKWPW is a linear peptidic epitope (epitope ID 1311601) tested in 6 T cell assays.	IEDB	1311601	1206	1214	YEQYIKWPW	ECO:0000213	PubMed	34857854
P0DTC2	RSFIEDLLFNK is a linear peptidic epitope (epitope ID 1311839) tested in 5 B cell assays.	IEDB	1311839	815	825	RSFIEDLLFNK	ECO:0000213	PubMed	37766081
P0DTC2	AARDLICAQKFNGLT is a linear peptidic epitope (epitope ID 1312101) tested in 7 T cell assays, 9 B cell assays and 7 MHC ligand assays.	IEDB	1312101	845	859	AARDLICAQKFNGLT	ECO:0000213	PubMed	38716629
P0DTC2	AEIRASANL is a linear peptidic epitope (epitope ID 1312108) tested in 15 T cell assays and 2 MHC ligand assays.	IEDB	1312108	1016	1024	AEIRASANL	ECO:0000213	PubMed	35484232
P0DTC2	AEIRASANL is a linear peptidic epitope (epitope ID 1312108) tested in 15 T cell assays and 2 MHC ligand assays.	IEDB	1312108	1016	1024	AEIRASANL	ECO:0000213	PubMed	36254196
P0DTC2	CCKFDEDDSEPVLKG is a linear peptidic epitope (epitope ID 1312257) tested in 4 T cell assays, 11 B cell assays and 7 MHC ligand assays.	IEDB	1312257	1253	1267	CCKFDEDDSEPVLKG	ECO:0000213	PubMed	36646780
P0DTC2	CSNLLLQYGSFCTQL is a linear peptidic epitope (epitope ID 1312272) tested in 11 T cell assays, 9 B cell assays and 10 MHC ligand assays.	IEDB	1312272	749	763	CSNLLLQYGSFCTQL	ECO:0000213	PubMed	34465633
P0DTC2	CSNLLLQYGSFCTQL is a linear peptidic epitope (epitope ID 1312272) tested in 11 T cell assays, 9 B cell assays and 10 MHC ligand assays.	IEDB	1312272	749	763	CSNLLLQYGSFCTQL	ECO:0000213	PubMed	34805136
P0DTC2	CSNLLLQYGSFCTQL is a linear peptidic epitope (epitope ID 1312272) tested in 11 T cell assays, 9 B cell assays and 10 MHC ligand assays.	IEDB	1312272	749	763	CSNLLLQYGSFCTQL	ECO:0000213	PubMed	35157735
P0DTC2	CSNLLLQYGSFCTQL is a linear peptidic epitope (epitope ID 1312272) tested in 11 T cell assays, 9 B cell assays and 10 MHC ligand assays.	IEDB	1312272	749	763	CSNLLLQYGSFCTQL	ECO:0000213	PubMed	38716629
P0DTC2	DCTMYICGDSTECSN is a linear peptidic epitope (epitope ID 1312282) tested in 5 T cell assays, 9 B cell assays and 9 MHC ligand assays.	IEDB	1312282	737	751	DCTMYICGDSTECSN	ECO:0000213	PubMed	34061349
P0DTC2	DEDDSEPVLKGVKLH is a linear peptidic epitope (epitope ID 1312283) tested in 5 T cell assays, 13 B cell assays and 7 MHC ligand assays.	IEDB	1312283	1257	1271	DEDDSEPVLKGVKLH	ECO:0000213	PubMed	36646780
P0DTC2	EKGIYQTSNFRVQPT is a linear peptidic epitope (epitope ID 1312359) tested in 4 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1312359	309	323	EKGIYQTSNFRVQPT	ECO:0000213	PubMed	33220791
P0DTC2	EYVSQPFLMDLEGKQ is a linear peptidic epitope (epitope ID 1312390) tested in 5 T cell assays, 15 B cell assays and 8 MHC ligand assays.	IEDB	1312390	169	183	EYVSQPFLMDLEGKQ	ECO:0000213	PubMed	34329696
P0DTC2	FEYVSQPFL is a linear peptidic epitope (epitope ID 1312410) tested in 4 T cell assays and 2 MHC ligand assays.	IEDB	1312410	168	176	FEYVSQPFL	ECO:0000213	PubMed	35196796
P0DTC2	FGGFNFSQILPDPSK is a linear peptidic epitope (epitope ID 1312421) tested in 6 T cell assays, 9 B cell assays and 7 MHC ligand assays.	IEDB	1312421	797	811	FGGFNFSQILPDPSK	ECO:0000213	PubMed	34329696
P0DTC2	FIKQYGDCLGDIAAR is a linear peptidic epitope (epitope ID 1312434) tested in 6 T cell assays, 9 B cell assays and 9 MHC ligand assays.	IEDB	1312434	833	847	FIKQYGDCLGDIAAR	ECO:0000213	PubMed	38716629
P0DTC2	FQFCNDPFLGVYYHK is a linear peptidic epitope (epitope ID 1312484) tested in 9 T cell assays, 15 B cell assays and 9 MHC ligand assays.	IEDB	1312484	133	147	FQFCNDPFLGVYYHK	ECO:0000213	PubMed	38716629
P0DTC2	FQFCNDPFLGVYYHK is a linear peptidic epitope (epitope ID 1312484) tested in 9 T cell assays, 15 B cell assays and 9 MHC ligand assays.	IEDB	1312484	133	147	FQFCNDPFLGVYYHK	ECO:0000213	PubMed	34061349
P0DTC2	GFNCYFPLQSYGFQP is a linear peptidic epitope (epitope ID 1312542) tested in 7 T cell assays, 12 B cell assays and 7 MHC ligand assays.	IEDB	1312542	485	499	GFNCYFPLQSYGFQP	ECO:0000213	PubMed	36302758
P0DTC2	GVYFASTEK is a linear peptidic epitope (epitope ID 1312627) tested in 20 T cell assays and 4 MHC ligand assays.	IEDB	1312627	89	97	GVYFASTEK	ECO:0000213	PubMed	34728796
P0DTC2	GVYFASTEK is a linear peptidic epitope (epitope ID 1312627) tested in 20 T cell assays and 4 MHC ligand assays.	IEDB	1312627	89	97	GVYFASTEK	ECO:0000213	PubMed	34968416
P0DTC2	GVYFASTEK is a linear peptidic epitope (epitope ID 1312627) tested in 20 T cell assays and 4 MHC ligand assays.	IEDB	1312627	89	97	GVYFASTEK	ECO:0000213	PubMed	35104433
P0DTC2	GVYFASTEK is a linear peptidic epitope (epitope ID 1312627) tested in 20 T cell assays and 4 MHC ligand assays.	IEDB	1312627	89	97	GVYFASTEK	ECO:0000213	PubMed	35484232
P0DTC2	GVYFASTEK is a linear peptidic epitope (epitope ID 1312627) tested in 20 T cell assays and 4 MHC ligand assays.	IEDB	1312627	89	97	GVYFASTEK	ECO:0000213	PubMed	37275886
P0DTC2	GVYFASTEK is a linear peptidic epitope (epitope ID 1312627) tested in 20 T cell assays and 4 MHC ligand assays.	IEDB	1312627	89	97	GVYFASTEK	ECO:0000213	PubMed	33427749
P0DTC2	GVYYHKNNK is a linear peptidic epitope (epitope ID 1312630) tested in 13 T cell assays and 4 MHC ligand assays.	IEDB	1312630	142	150	GVYYHKNNK	ECO:0000213	PubMed	34506741
P0DTC2	GVYYHKNNK is a linear peptidic epitope (epitope ID 1312630) tested in 13 T cell assays and 4 MHC ligand assays.	IEDB	1312630	142	150	GVYYHKNNK	ECO:0000213	PubMed	34728796
P0DTC2	GVYYPDKVFRSS is a linear peptidic epitope (epitope ID 1312631) tested in 1 T cell assay, 3 B cell assays and 2 MHC ligand assays.	IEDB	1312631	35	46	GVYYPDKVFRSS	ECO:0000213	PubMed	34004174
P0DTC2	GVYYPDKVFRSS is a linear peptidic epitope (epitope ID 1312631) tested in 1 T cell assay, 3 B cell assays and 2 MHC ligand assays.	IEDB	1312631	35	46	GVYYPDKVFRSS	ECO:0000213	PubMed	35857584
P0DTC2	GWTAGAAAYYVGYLQ is a linear peptidic epitope (epitope ID 1312633) tested in 9 T cell assays, 9 B cell assays and 7 MHC ligand assays.	IEDB	1312633	257	271	GWTAGAAAYYVGYLQ	ECO:0000213	PubMed	34805136
P0DTC2	IDGYFKIYSKHTPIN is a linear peptidic epitope (epitope ID 1312689) tested in 7 T cell assays, 12 B cell assays and 8 MHC ligand assays.	IEDB	1312689	197	211	IDGYFKIYSKHTPIN	ECO:0000213	PubMed	34329696
P0DTC2	IDGYFKIYSKHTPIN is a linear peptidic epitope (epitope ID 1312689) tested in 7 T cell assays, 12 B cell assays and 8 MHC ligand assays.	IEDB	1312689	197	211	IDGYFKIYSKHTPIN	ECO:0000213	PubMed	38716629
P0DTC2	IDGYFKIYSKHTPIN is a linear peptidic epitope (epitope ID 1312689) tested in 7 T cell assays, 12 B cell assays and 8 MHC ligand assays.	IEDB	1312689	197	211	IDGYFKIYSKHTPIN	ECO:0000213	PubMed	33220791
P0DTC2	ILPDPSKPSKRSFIE is a linear peptidic epitope (epitope ID 1312733) tested in 4 T cell assays, 17 B cell assays and 7 MHC ligand assays.	IEDB	1312733	805	819	ILPDPSKPSKRSFIE	ECO:0000213	PubMed	36646780
P0DTC2	ISSVLNDILSRLDKV is a linear peptidic epitope (epitope ID 1312775) tested in 22 T cell assays, 15 B cell assays and 9 MHC ligand assays.	IEDB	1312775	973	987	ISSVLNDILSRLDKV	ECO:0000213	PubMed	34465633
P0DTC2	ISSVLNDILSRLDKV is a linear peptidic epitope (epitope ID 1312775) tested in 22 T cell assays, 15 B cell assays and 9 MHC ligand assays.	IEDB	1312775	973	987	ISSVLNDILSRLDKV	ECO:0000213	PubMed	35891550
P0DTC2	ITDAVDCALDPLSET is a linear peptidic epitope (epitope ID 1312780) tested in 4 T cell assays, 9 B cell assays and 10 MHC ligand assays.	IEDB	1312780	285	299	ITDAVDCALDPLSET	ECO:0000213	PubMed	33220791
P0DTC2	KKFLPFQQFGRDIAD is a linear peptidic epitope (epitope ID 1312849) tested in 4 T cell assays, 16 B cell assays and 12 MHC ligand assays.	IEDB	1312849	557	571	KKFLPFQQFGRDIAD	ECO:0000213	PubMed	36646780
P0DTC2	KKFLPFQQFGRDIAD is a linear peptidic epitope (epitope ID 1312849) tested in 4 T cell assays, 16 B cell assays and 12 MHC ligand assays.	IEDB	1312849	557	571	KKFLPFQQFGRDIAD	ECO:0000213	PubMed	33220791
P0DTC2	KSTNLVKNKCVNFNF is a linear peptidic epitope (epitope ID 1312907) tested in 5 T cell assays, 15 B cell assays and 9 MHC ligand assays.	IEDB	1312907	529	543	KSTNLVKNKCVNFNF	ECO:0000213	PubMed	38716629
P0DTC2	KVCEFQFCNDPFLGV is a linear peptidic epitope (epitope ID 1312928) tested in 5 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1312928	129	143	KVCEFQFCNDPFLGV	ECO:0000213	PubMed	36646780
P0DTC2	KYEQYIKWPWYIWLG is a linear peptidic epitope (epitope ID 1312935) tested in 7 T cell assays, 9 B cell assays and 7 MHC ligand assays.	IEDB	1312935	1205	1219	KYEQYIKWPWYIWLG	ECO:0000213	PubMed	34805136
P0DTC2	LDSFKEELDKYFKNH is a linear peptidic epitope (epitope ID 1312961) tested in 4 T cell assays, 16 B cell assays and 7 MHC ligand assays.	IEDB	1312961	1145	1159	LDSFKEELDKYFKNH	ECO:0000213	PubMed	36646780
P0DTC2	LLQYGSFCTQLNRAL is a linear peptidic epitope (epitope ID 1313008) tested in 10 T cell assays, 9 B cell assays and 7 MHC ligand assays.	IEDB	1313008	753	767	LLQYGSFCTQLNRAL	ECO:0000213	PubMed	34465633
P0DTC2	LLQYGSFCTQLNRAL is a linear peptidic epitope (epitope ID 1313008) tested in 10 T cell assays, 9 B cell assays and 7 MHC ligand assays.	IEDB	1313008	753	767	LLQYGSFCTQLNRAL	ECO:0000213	PubMed	35157735
P0DTC2	LLQYGSFCTQLNRAL is a linear peptidic epitope (epitope ID 1313008) tested in 10 T cell assays, 9 B cell assays and 7 MHC ligand assays.	IEDB	1313008	753	767	LLQYGSFCTQLNRAL	ECO:0000213	PubMed	38716629
P0DTC2	LLQYGSFCTQLNRAL is a linear peptidic epitope (epitope ID 1313008) tested in 10 T cell assays, 9 B cell assays and 7 MHC ligand assays.	IEDB	1313008	753	767	LLQYGSFCTQLNRAL	ECO:0000213	PubMed	34061349
P0DTC2	LSFELLHAPATVCGP is a linear peptidic epitope (epitope ID 1313083) tested in 7 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1313083	513	527	LSFELLHAPATVCGP	ECO:0000213	PubMed	34329696
P0DTC2	LSFELLHAPATVCGP is a linear peptidic epitope (epitope ID 1313083) tested in 7 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1313083	513	527	LSFELLHAPATVCGP	ECO:0000213	PubMed	34061349
P0DTC2	LTPTWRVYSTGSNVF is a linear peptidic epitope (epitope ID 1313108) tested in 6 T cell assays, 9 B cell assays and 7 MHC ligand assays.	IEDB	1313108	629	643	LTPTWRVYSTGSNVF	ECO:0000213	PubMed	38716629
P0DTC2	MIAQYTSAL is a linear peptidic epitope (epitope ID 1313153) tested in 22 T cell assays and 12 MHC ligand assays.	IEDB	1313153	869	877	MIAQYTSAL	ECO:0000213	PubMed	34728796
P0DTC2	MIAQYTSAL is a linear peptidic epitope (epitope ID 1313153) tested in 22 T cell assays and 12 MHC ligand assays.	IEDB	1313153	869	877	MIAQYTSAL	ECO:0000213	PubMed	34793243
P0DTC2	MIAQYTSAL is a linear peptidic epitope (epitope ID 1313153) tested in 22 T cell assays and 12 MHC ligand assays.	IEDB	1313153	869	877	MIAQYTSAL	ECO:0000213	PubMed	35104433
P0DTC2	MIAQYTSAL is a linear peptidic epitope (epitope ID 1313153) tested in 22 T cell assays and 12 MHC ligand assays.	IEDB	1313153	869	877	MIAQYTSAL	ECO:0000213	PubMed	35937077
P0DTC2	MIAQYTSAL is a linear peptidic epitope (epitope ID 1313153) tested in 22 T cell assays and 12 MHC ligand assays.	IEDB	1313153	869	877	MIAQYTSAL	ECO:0000213	PubMed	37193826
P0DTC2	MIAQYTSAL is a linear peptidic epitope (epitope ID 1313153) tested in 22 T cell assays and 12 MHC ligand assays.	IEDB	1313153	869	877	MIAQYTSAL	ECO:0000213	PubMed	33853928
P0DTC2	MIAQYTSALLAGTIT is a linear peptidic epitope (epitope ID 1313154) tested in 13 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1313154	869	883	MIAQYTSALLAGTIT	ECO:0000213	PubMed	34805136
P0DTC2	MIAQYTSALLAGTIT is a linear peptidic epitope (epitope ID 1313154) tested in 13 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1313154	869	883	MIAQYTSALLAGTIT	ECO:0000213	PubMed	35157735
P0DTC2	MIAQYTSALLAGTIT is a linear peptidic epitope (epitope ID 1313154) tested in 13 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1313154	869	883	MIAQYTSALLAGTIT	ECO:0000213	PubMed	33220791
P0DTC2	NCTFEYVSQPFLMDL is a linear peptidic epitope (epitope ID 1313194) tested in 31 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1313194	165	179	NCTFEYVSQPFLMDL	ECO:0000213	PubMed	35157735
P0DTC2	NCTFEYVSQPFLMDL is a linear peptidic epitope (epitope ID 1313194) tested in 31 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1313194	165	179	NCTFEYVSQPFLMDL	ECO:0000213	PubMed	38105139
P0DTC2	NCTFEYVSQPFLMDL is a linear peptidic epitope (epitope ID 1313194) tested in 31 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1313194	165	179	NCTFEYVSQPFLMDL	ECO:0000213	PubMed	38716629
P0DTC2	NCTFEYVSQPFLMDL is a linear peptidic epitope (epitope ID 1313194) tested in 31 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1313194	165	179	NCTFEYVSQPFLMDL	ECO:0000213	PubMed	34061349
P0DTC2	NCTFEYVSQPFLMDL is a linear peptidic epitope (epitope ID 1313194) tested in 31 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1313194	165	179	NCTFEYVSQPFLMDL	ECO:0000213	PubMed	37541134
P0DTC2	NFRVQPTESIVRFPN is a linear peptidic epitope (epitope ID 1313203) tested in 9 T cell assays, 9 B cell assays and 12 MHC ligand assays.	IEDB	1313203	317	331	NFRVQPTESIVRFPN	ECO:0000213	PubMed	34329696
P0DTC2	NFRVQPTESIVRFPN is a linear peptidic epitope (epitope ID 1313203) tested in 9 T cell assays, 9 B cell assays and 12 MHC ligand assays.	IEDB	1313203	317	331	NFRVQPTESIVRFPN	ECO:0000213	PubMed	35157735
P0DTC2	NFRVQPTESIVRFPN is a linear peptidic epitope (epitope ID 1313203) tested in 9 T cell assays, 9 B cell assays and 12 MHC ligand assays.	IEDB	1313203	317	331	NFRVQPTESIVRFPN	ECO:0000213	PubMed	34061349
P0DTC2	NFTISVTTEILPVSM is a linear peptidic epitope (epitope ID 1313204) tested in 8 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1313204	717	731	NFTISVTTEILPVSM	ECO:0000213	PubMed	38716629
P0DTC2	NKSWMESEFRVYSSA is a linear peptidic epitope (epitope ID 1313211) tested in 7 T cell assays, 9 B cell assays and 7 MHC ligand assays.	IEDB	1313211	149	163	NKSWMESEFRVYSSA	ECO:0000213	PubMed	34805136
P0DTC2	NNSYECDIPIGAGIC is a linear peptidic epitope (epitope ID 1313230) tested in 5 T cell assays, 13 B cell assays and 8 MHC ligand assays.	IEDB	1313230	657	671	NNSYECDIPIGAGIC	ECO:0000213	PubMed	36646780
P0DTC2	NNSYECDIPIGAGIC is a linear peptidic epitope (epitope ID 1313230) tested in 5 T cell assays, 13 B cell assays and 8 MHC ligand assays.	IEDB	1313230	657	671	NNSYECDIPIGAGIC	ECO:0000213	PubMed	34061349
P0DTC2	NSASFSTFK is a linear peptidic epitope (epitope ID 1313244) tested in 9 T cell assays and 2 MHC ligand assays.	IEDB	1313244	370	378	NSASFSTFK	ECO:0000213	PubMed	34728796
P0DTC2	NSASFSTFK is a linear peptidic epitope (epitope ID 1313244) tested in 9 T cell assays and 2 MHC ligand assays.	IEDB	1313244	370	378	NSASFSTFK	ECO:0000213	PubMed	35484232
P0DTC2	NTQEVFAQVKQIYKT is a linear peptidic epitope (epitope ID 1313257) tested in 4 T cell assays, 11 B cell assays and 7 MHC ligand assays.	IEDB	1313257	777	791	NTQEVFAQVKQIYKT	ECO:0000213	PubMed	36646780
P0DTC2	NVVIKVCEFQFCNDP is a linear peptidic epitope (epitope ID 1313262) tested in 5 T cell assays, 9 B cell assays and 9 MHC ligand assays.	IEDB	1313262	125	139	NVVIKVCEFQFCNDP	ECO:0000213	PubMed	34061349
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	33972535
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	34222571
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	34506741
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	34728796
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	34793243
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	34950151
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	34968416
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	35383307
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	35484232
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	36068240
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	37809871
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	38236134
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	38458195
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	38866784
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	39002680
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	34086357
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	33427749
P0DTC2	NYNYLYRLF is a linear peptidic epitope (epitope ID 1313269) tested in 84 T cell assays, 8 MHC ligand assays and has 3D structure(s) 8ye4 and 7f4w.	IEDB	1313269	448	456	NYNYLYRLF	ECO:0000213	PubMed	34044428
P0DTC2	PFFSNVTWFHAIHVS is a linear peptidic epitope (epitope ID 1313276) tested in 7 T cell assays, 9 B cell assays and 10 MHC ligand assays.	IEDB	1313276	57	71	PFFSNVTWFHAIHVS	ECO:0000213	PubMed	38105139
P0DTC2	PFGEVFNATRFASVY is a linear peptidic epitope (epitope ID 1313277) tested in 27 T cell assays, 20 B cell assays and 9 MHC ligand assays.	IEDB	1313277	337	351	PFGEVFNATRFASVY	ECO:0000213	PubMed	35891550
P0DTC2	PFGEVFNATRFASVY is a linear peptidic epitope (epitope ID 1313277) tested in 27 T cell assays, 20 B cell assays and 9 MHC ligand assays.	IEDB	1313277	337	351	PFGEVFNATRFASVY	ECO:0000213	PubMed	36646780
P0DTC2	PFGEVFNATRFASVY is a linear peptidic epitope (epitope ID 1313277) tested in 27 T cell assays, 20 B cell assays and 9 MHC ligand assays.	IEDB	1313277	337	351	PFGEVFNATRFASVY	ECO:0000213	PubMed	36680141
P0DTC2	PFGEVFNATRFASVY is a linear peptidic epitope (epitope ID 1313277) tested in 27 T cell assays, 20 B cell assays and 9 MHC ligand assays.	IEDB	1313277	337	351	PFGEVFNATRFASVY	ECO:0000213	PubMed	38716629
P0DTC2	PINLVRDLPQGFSAL is a linear peptidic epitope (epitope ID 1313285) tested in 7 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1313285	209	223	PINLVRDLPQGFSAL	ECO:0000213	PubMed	34061349
P0DTC2	PSKPSKRSFIEDLLF is a linear peptidic epitope (epitope ID 1313311) tested in 5 T cell assays, 14 B cell assays and 7 MHC ligand assays.	IEDB	1313311	809	823	PSKPSKRSFIEDLLF	ECO:0000213	PubMed	34329696
P0DTC2	PSKPSKRSFIEDLLF is a linear peptidic epitope (epitope ID 1313311) tested in 5 T cell assays, 14 B cell assays and 7 MHC ligand assays.	IEDB	1313311	809	823	PSKPSKRSFIEDLLF	ECO:0000213	PubMed	36646780
P0DTC2	QALNTLVKQLSSNFG is a linear peptidic epitope (epitope ID 1313324) tested in 8 T cell assays, 9 B cell assays and 10 MHC ligand assays.	IEDB	1313324	957	971	QALNTLVKQLSSNFG	ECO:0000213	PubMed	34465633
P0DTC2	QALNTLVKQLSSNFG is a linear peptidic epitope (epitope ID 1313324) tested in 8 T cell assays, 9 B cell assays and 10 MHC ligand assays.	IEDB	1313324	957	971	QALNTLVKQLSSNFG	ECO:0000213	PubMed	38716629
P0DTC2	QLSSNFGAISSVLND is a linear peptidic epitope (epitope ID 1313359) tested in 6 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1313359	965	979	QLSSNFGAISSVLND	ECO:0000213	PubMed	34061349
P0DTC2	QNVLYENQKLIANQF is a linear peptidic epitope (epitope ID 1313363) tested in 5 T cell assays, 15 B cell assays and 9 MHC ligand assays.	IEDB	1313363	913	927	QNVLYENQKLIANQF	ECO:0000213	PubMed	34061349
P0DTC2	QNVLYENQKLIANQF is a linear peptidic epitope (epitope ID 1313363) tested in 5 T cell assays, 15 B cell assays and 9 MHC ligand assays.	IEDB	1313363	913	927	QNVLYENQKLIANQF	ECO:0000213	PubMed	33220791
P0DTC2	RALTGIAVEQDKNTQ is a linear peptidic epitope (epitope ID 1313403) tested in 6 T cell assays, 9 B cell assays and 7 MHC ligand assays.	IEDB	1313403	765	779	RALTGIAVEQDKNTQ	ECO:0000213	PubMed	34061349
P0DTC2	RTFLLKYNENGTITD is a linear peptidic epitope (epitope ID 1313495) tested in 6 T cell assays, 9 B cell assays and 7 MHC ligand assays.	IEDB	1313495	273	287	RTFLLKYNENGTITD	ECO:0000213	PubMed	38716629
P0DTC2	SFSTFKCYGVSPTKL is a linear peptidic epitope (epitope ID 1313549) tested in 8 T cell assays, 20 B cell assays and 8 MHC ligand assays.	IEDB	1313549	373	387	SFSTFKCYGVSPTKL	ECO:0000213	PubMed	34756082
P0DTC2	SFSTFKCYGVSPTKL is a linear peptidic epitope (epitope ID 1313549) tested in 8 T cell assays, 20 B cell assays and 8 MHC ligand assays.	IEDB	1313549	373	387	SFSTFKCYGVSPTKL	ECO:0000213	PubMed	38716629
P0DTC2	SIVRFPNITNLCPFG is a linear peptidic epitope (epitope ID 1313572) tested in 7 T cell assays, 17 B cell assays and 9 MHC ligand assays.	IEDB	1313572	325	339	SIVRFPNITNLCPFG	ECO:0000213	PubMed	34329696
P0DTC2	SIVRFPNITNLCPFG is a linear peptidic epitope (epitope ID 1313572) tested in 7 T cell assays, 17 B cell assays and 9 MHC ligand assays.	IEDB	1313572	325	339	SIVRFPNITNLCPFG	ECO:0000213	PubMed	34756082
P0DTC2	SKRSFIEDLLFNKVT is a linear peptidic epitope (epitope ID 1313576) tested in 14 T cell assays, 17 B cell assays and 7 MHC ligand assays.	IEDB	1313576	813	827	SKRSFIEDLLFNKVT	ECO:0000213	PubMed	34465633
P0DTC2	SKRSFIEDLLFNKVT is a linear peptidic epitope (epitope ID 1313576) tested in 14 T cell assays, 17 B cell assays and 7 MHC ligand assays.	IEDB	1313576	813	827	SKRSFIEDLLFNKVT	ECO:0000213	PubMed	35157735
P0DTC2	SKRSFIEDLLFNKVT is a linear peptidic epitope (epitope ID 1313576) tested in 14 T cell assays, 17 B cell assays and 7 MHC ligand assays.	IEDB	1313576	813	827	SKRSFIEDLLFNKVT	ECO:0000213	PubMed	36646780
P0DTC2	SKRSFIEDLLFNKVT is a linear peptidic epitope (epitope ID 1313576) tested in 14 T cell assays, 17 B cell assays and 7 MHC ligand assays.	IEDB	1313576	813	827	SKRSFIEDLLFNKVT	ECO:0000213	PubMed	38716629
P0DTC2	SSVLHSTQDLFLPFF is a linear peptidic epitope (epitope ID 1313684) tested in 7 T cell assays, 13 B cell assays and 7 MHC ligand assays.	IEDB	1313684	45	59	SSVLHSTQDLFLPFF	ECO:0000213	PubMed	36646780
P0DTC2	STEIYQAGSTPCNGV is a linear peptidic epitope (epitope ID 1313689) tested in 27 T cell assays, 20 B cell assays and 10 MHC ligand assays.	IEDB	1313689	469	483	STEIYQAGSTPCNGV	ECO:0000213	PubMed	35891550
P0DTC2	STEIYQAGSTPCNGV is a linear peptidic epitope (epitope ID 1313689) tested in 27 T cell assays, 20 B cell assays and 10 MHC ligand assays.	IEDB	1313689	469	483	STEIYQAGSTPCNGV	ECO:0000213	PubMed	36680141
P0DTC2	STEIYQAGSTPCNGV is a linear peptidic epitope (epitope ID 1313689) tested in 27 T cell assays, 20 B cell assays and 10 MHC ligand assays.	IEDB	1313689	469	483	STEIYQAGSTPCNGV	ECO:0000213	PubMed	38716629
P0DTC2	STEIYQAGSTPCNGV is a linear peptidic epitope (epitope ID 1313689) tested in 27 T cell assays, 20 B cell assays and 10 MHC ligand assays.	IEDB	1313689	469	483	STEIYQAGSTPCNGV	ECO:0000213	PubMed	34061349
P0DTC2	STPCNGVEGFNCYFP is a linear peptidic epitope (epitope ID 1313696) tested in 8 T cell assays, 12 B cell assays and 11 MHC ligand assays.	IEDB	1313696	477	491	STPCNGVEGFNCYFP	ECO:0000213	PubMed	34329696
P0DTC2	STPCNGVEGFNCYFP is a linear peptidic epitope (epitope ID 1313696) tested in 8 T cell assays, 12 B cell assays and 11 MHC ligand assays.	IEDB	1313696	477	491	STPCNGVEGFNCYFP	ECO:0000213	PubMed	36646780
P0DTC2	TAPAICHDGKAHFPR is a linear peptidic epitope (epitope ID 1313732) tested in 5 T cell assays, 9 B cell assays and 7 MHC ligand assays.	IEDB	1313732	1077	1091	TAPAICHDGKAHFPR	ECO:0000213	PubMed	34061349
P0DTC2	TDAVRDPQTLEILDI is a linear peptidic epitope (epitope ID 1313735) tested in 4 T cell assays, 11 B cell assays and 7 MHC ligand assays.	IEDB	1313735	573	587	TDAVRDPQTLEILDI	ECO:0000213	PubMed	36646780
P0DTC2	TGVLTESNKKFLPFQ is a linear peptidic epitope (epitope ID 1313741) tested in 5 T cell assays, 11 B cell assays and 7 MHC ligand assays.	IEDB	1313741	549	563	TGVLTESNKKFLPFQ	ECO:0000213	PubMed	38716629
P0DTC2	TLKSFTVEK is a linear peptidic epitope (epitope ID 1313756) tested in 8 T cell assays and 3 MHC ligand assays.	IEDB	1313756	302	310	TLKSFTVEK	ECO:0000213	PubMed	34506741
P0DTC2	TNGTKRFDNPVLPFN is a linear peptidic epitope (epitope ID 1313767) tested in 6 T cell assays, 15 B cell assays and 7 MHC ligand assays.	IEDB	1313767	73	87	TNGTKRFDNPVLPFN	ECO:0000213	PubMed	38716629
P0DTC2	TNVYADSFVIRGDEV is a linear peptidic epitope (epitope ID 1313770) tested in 5 T cell assays, 12 B cell assays and 9 MHC ligand assays.	IEDB	1313770	393	407	TNVYADSFVIRGDEV	ECO:0000213	PubMed	33220791
P0DTC2	TRFASVYAWNRKRIS is a linear peptidic epitope (epitope ID 1313796) tested in 7 T cell assays, 12 B cell assays and 7 MHC ligand assays.	IEDB	1313796	345	359	TRFASVYAWNRKRIS	ECO:0000213	PubMed	38716629
P0DTC2	TRFASVYAWNRKRIS is a linear peptidic epitope (epitope ID 1313796) tested in 7 T cell assays, 12 B cell assays and 7 MHC ligand assays.	IEDB	1313796	345	359	TRFASVYAWNRKRIS	ECO:0000213	PubMed	34061349
P0DTC2	TRGVYYPDKVFRSSV is a linear peptidic epitope (epitope ID 1313797) tested in 8 T cell assays, 9 B cell assays and 10 MHC ligand assays.	IEDB	1313797	33	47	TRGVYYPDKVFRSSV	ECO:0000213	PubMed	34004174
P0DTC2	TRGVYYPDKVFRSSV is a linear peptidic epitope (epitope ID 1313797) tested in 8 T cell assays, 9 B cell assays and 10 MHC ligand assays.	IEDB	1313797	33	47	TRGVYYPDKVFRSSV	ECO:0000213	PubMed	38117652
P0DTC2	TRGVYYPDKVFRSSV is a linear peptidic epitope (epitope ID 1313797) tested in 8 T cell assays, 9 B cell assays and 10 MHC ligand assays.	IEDB	1313797	33	47	TRGVYYPDKVFRSSV	ECO:0000213	PubMed	34061349
P0DTC2	VFKNIDGYFKIYSKH is a linear peptidic epitope (epitope ID 1313847) tested in 5 T cell assays, 15 B cell assays and 7 MHC ligand assays.	IEDB	1313847	193	207	VFKNIDGYFKIYSKH	ECO:0000213	PubMed	38716629
P0DTC2	VIAWNSNNLDSKVGG is a linear peptidic epitope (epitope ID 1313864) tested in 6 T cell assays, 20 B cell assays and 7 MHC ligand assays.	IEDB	1313864	433	447	VIAWNSNNLDSKVGG	ECO:0000213	PubMed	34756082
P0DTC2	VKQIYKTPPIKDFGG is a linear peptidic epitope (epitope ID 1313875) tested in 5 T cell assays, 11 B cell assays and 7 MHC ligand assays.	IEDB	1313875	785	799	VKQIYKTPPIKDFGG	ECO:0000213	PubMed	36646780
P0DTC2	VNNTVYDPLQPELDS is a linear peptidic epitope (epitope ID 1313901) tested in 6 T cell assays, 9 B cell assays and 7 MHC ligand assays.	IEDB	1313901	1133	1147	VNNTVYDPLQPELDS	ECO:0000213	PubMed	34465633
P0DTC2	VYSTGSNVF is a linear peptidic epitope (epitope ID 1313944) tested in 10 T cell assays and 1 MHC ligand assay.	IEDB	1313944	635	643	VYSTGSNVF	ECO:0000213	PubMed	34793243
P0DTC2	WNRKRISNCVADYSV is a linear peptidic epitope (epitope ID 1313960) tested in 9 T cell assays, 12 B cell assays and 8 MHC ligand assays.	IEDB	1313960	353	367	WNRKRISNCVADYSV	ECO:0000213	PubMed	34329696
P0DTC2	WNRKRISNCVADYSV is a linear peptidic epitope (epitope ID 1313960) tested in 9 T cell assays, 12 B cell assays and 8 MHC ligand assays.	IEDB	1313960	353	367	WNRKRISNCVADYSV	ECO:0000213	PubMed	34647971
P0DTC2	WNRKRISNCVADYSV is a linear peptidic epitope (epitope ID 1313960) tested in 9 T cell assays, 12 B cell assays and 8 MHC ligand assays.	IEDB	1313960	353	367	WNRKRISNCVADYSV	ECO:0000213	PubMed	38716629
P0DTC2	WNRKRISNCVADYSV is a linear peptidic epitope (epitope ID 1313960) tested in 9 T cell assays, 12 B cell assays and 8 MHC ligand assays.	IEDB	1313960	353	367	WNRKRISNCVADYSV	ECO:0000213	PubMed	34061349
P0DTC2	WRVYSTGSNVFQTRA is a linear peptidic epitope (epitope ID 1313967) tested in 4 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1313967	633	647	WRVYSTGSNVFQTRA	ECO:0000213	PubMed	38117652
P0DTC2	YENQKLIANQFNSAI is a linear peptidic epitope (epitope ID 1313987) tested in 5 T cell assays, 9 B cell assays and 10 MHC ligand assays.	IEDB	1313987	917	931	YENQKLIANQFNSAI	ECO:0000213	PubMed	34061349
P0DTC2	YFPLQSYGFQPTNGV is a linear peptidic epitope (epitope ID 1313990) tested in 7 T cell assays, 16 B cell assays and 9 MHC ligand assays.	IEDB	1313990	489	503	YFPLQSYGFQPTNGV	ECO:0000213	PubMed	36302758
P0DTC2	YIKWPWYIWLGFIAG is a linear peptidic epitope (epitope ID 1314002) tested in 6 T cell assays, 9 B cell assays and 7 MHC ligand assays.	IEDB	1314002	1209	1223	YIKWPWYIWLGFIAG	ECO:0000213	PubMed	38716629
P0DTC2	YKTPPIKDFGGFNFS is a linear peptidic epitope (epitope ID 1314005) tested in 6 T cell assays, 14 B cell assays and 7 MHC ligand assays.	IEDB	1314005	789	803	YKTPPIKDFGGFNFS	ECO:0000213	PubMed	36646780
P0DTC2	YNYLYRLFRKSNLKP is a linear peptidic epitope (epitope ID 1314023) tested in 7 T cell assays, 15 B cell assays and 8 MHC ligand assays.	IEDB	1314023	449	463	YNYLYRLFRKSNLKP	ECO:0000213	PubMed	34061349
P0DTC2	YNYLYRLFRKSNLKP is a linear peptidic epitope (epitope ID 1314023) tested in 7 T cell assays, 15 B cell assays and 8 MHC ligand assays.	IEDB	1314023	449	463	YNYLYRLFRKSNLKP	ECO:0000213	PubMed	33220791
P0DTC2	YSVLYNSASFSTFKC is a linear peptidic epitope (epitope ID 1314047) tested in 9 T cell assays, 12 B cell assays and 7 MHC ligand assays.	IEDB	1314047	365	379	YSVLYNSASFSTFKC	ECO:0000213	PubMed	38716629
P0DTC2	ADAGFIKQY is a linear peptidic epitope (epitope ID 1314170) tested in 10 T cell assays.	IEDB	1314170	829	837	ADAGFIKQY	ECO:0000213	PubMed	35389886
P0DTC2	ADAGFIKQY is a linear peptidic epitope (epitope ID 1314170) tested in 10 T cell assays.	IEDB	1314170	829	837	ADAGFIKQY	ECO:0000213	PubMed	38781962
P0DTC2	EYVSQPFLM is a linear peptidic epitope (epitope ID 1316287) tested in 8 T cell assays and 2 MHC ligand assays.	IEDB	1316287	169	177	EYVSQPFLM	ECO:0000213	PubMed	34222571
P0DTC2	FAMQMAYRF is a linear peptidic epitope (epitope ID 1316310) tested in 14 T cell assays.	IEDB	1316310	898	906	FAMQMAYRF	ECO:0000213	PubMed	34793243
P0DTC2	FAMQMAYRF is a linear peptidic epitope (epitope ID 1316310) tested in 14 T cell assays.	IEDB	1316310	898	906	FAMQMAYRF	ECO:0000213	PubMed	35139340
P0DTC2	FAMQMAYRF is a linear peptidic epitope (epitope ID 1316310) tested in 14 T cell assays.	IEDB	1316310	898	906	FAMQMAYRF	ECO:0000213	PubMed	35484232
P0DTC2	FAMQMAYRF is a linear peptidic epitope (epitope ID 1316310) tested in 14 T cell assays.	IEDB	1316310	898	906	FAMQMAYRF	ECO:0000213	PubMed	37193826
P0DTC2	FAMQMAYRF is a linear peptidic epitope (epitope ID 1316310) tested in 14 T cell assays.	IEDB	1316310	898	906	FAMQMAYRF	ECO:0000213	PubMed	34249101
P0DTC2	FERDISTEI is a linear peptidic epitope (epitope ID 1316352) tested in 2 T cell assays.	IEDB	1316352	464	472	FERDISTEI	ECO:0000213	PubMed	38781962
P0DTC2	FERDISTEIY is a linear peptidic epitope (epitope ID 1316353) tested in 3 T cell assays.	IEDB	1316353	464	473	FERDISTEIY	ECO:0000213	PubMed	38781962
P0DTC2	FERDISTEIY is a linear peptidic epitope (epitope ID 1316353) tested in 3 T cell assays.	IEDB	1316353	464	473	FERDISTEIY	ECO:0000213	PubMed	33853928
P0DTC2	FPREGVFV is a linear peptidic epitope (epitope ID 1316854) tested in 4 T cell assays.	IEDB	1316854	1089	1096	FPREGVFV	ECO:0000213	PubMed	33853928
P0DTC2	FTISVTTEI is a linear peptidic epitope (epitope ID 1317060) tested in 8 T cell assays and 2 MHC ligand assays.	IEDB	1317060	718	726	FTISVTTEI	ECO:0000213	PubMed	34222571
P0DTC2	FTISVTTEI is a linear peptidic epitope (epitope ID 1317060) tested in 8 T cell assays and 2 MHC ligand assays.	IEDB	1317060	718	726	FTISVTTEI	ECO:0000213	PubMed	34793243
P0DTC2	FTISVTTEI is a linear peptidic epitope (epitope ID 1317060) tested in 8 T cell assays and 2 MHC ligand assays.	IEDB	1317060	718	726	FTISVTTEI	ECO:0000213	PubMed	35116022
P0DTC2	FTISVTTEI is a linear peptidic epitope (epitope ID 1317060) tested in 8 T cell assays and 2 MHC ligand assays.	IEDB	1317060	718	726	FTISVTTEI	ECO:0000213	PubMed	35139340
P0DTC2	FVSNGTHWF is a linear peptidic epitope (epitope ID 1317137) tested in 12 T cell assays.	IEDB	1317137	1095	1103	FVSNGTHWF	ECO:0000213	PubMed	35139340
P0DTC2	FVSNGTHWF is a linear peptidic epitope (epitope ID 1317137) tested in 12 T cell assays.	IEDB	1317137	1095	1103	FVSNGTHWF	ECO:0000213	PubMed	36408799
P0DTC2	GAAAYYVGY is a linear peptidic epitope (epitope ID 1317282) tested in 3 T cell assays.	IEDB	1317282	261	269	GAAAYYVGY	ECO:0000213	PubMed	38045681
P0DTC2	GEVFNATRF is a linear peptidic epitope (epitope ID 1317333) tested in 6 T cell assays.	IEDB	1317333	339	347	GEVFNATRF	ECO:0000213	PubMed	35484232
P0DTC2	GEVFNATRF is a linear peptidic epitope (epitope ID 1317333) tested in 6 T cell assays.	IEDB	1317333	339	347	GEVFNATRF	ECO:0000213	PubMed	38781962
P0DTC2	GVYYPDKVFR is a linear peptidic epitope (epitope ID 1317887) tested in 8 T cell assays.	IEDB	1317887	35	44	GVYYPDKVFR	ECO:0000213	PubMed	35484232
P0DTC2	GVYYPDKVFR is a linear peptidic epitope (epitope ID 1317887) tested in 8 T cell assays.	IEDB	1317887	35	44	GVYYPDKVFR	ECO:0000213	PubMed	38781962
P0DTC2	GYLQPRTFLL is a linear peptidic epitope (epitope ID 1317916) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1317916	268	277	GYLQPRTFLL	ECO:0000213	PubMed	36068240
P0DTC2	GYLQPRTFLL is a linear peptidic epitope (epitope ID 1317916) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1317916	268	277	GYLQPRTFLL	ECO:0000213	PubMed	37193826
P0DTC2	HLMSFPQSA is a linear peptidic epitope (epitope ID 1318059) tested in 15 T cell assays and 3 MHC ligand assays.	IEDB	1318059	1048	1056	HLMSFPQSA	ECO:0000213	PubMed	34793243
P0DTC2	HLMSFPQSA is a linear peptidic epitope (epitope ID 1318059) tested in 15 T cell assays and 3 MHC ligand assays.	IEDB	1318059	1048	1056	HLMSFPQSA	ECO:0000213	PubMed	37193826
P0DTC2	HLMSFPQSA is a linear peptidic epitope (epitope ID 1318059) tested in 15 T cell assays and 3 MHC ligand assays.	IEDB	1318059	1048	1056	HLMSFPQSA	ECO:0000213	PubMed	33853928
P0DTC2	HWFVTQRNF is a linear peptidic epitope (epitope ID 1318219) tested in 2 T cell assays.	IEDB	1318219	1101	1109	HWFVTQRNF	ECO:0000213	PubMed	34222571
P0DTC2	IANQFNSAI is a linear peptidic epitope (epitope ID 1318302) tested in 2 T cell assays.	IEDB	1318302	923	931	IANQFNSAI	ECO:0000213	PubMed	35139340
P0DTC2	IPFAMQMAY is a linear peptidic epitope (epitope ID 1318829) tested in 15 T cell assays.	IEDB	1318829	896	904	IPFAMQMAY	ECO:0000213	PubMed	35196796
P0DTC2	IPFAMQMAY is a linear peptidic epitope (epitope ID 1318829) tested in 15 T cell assays.	IEDB	1318829	896	904	IPFAMQMAY	ECO:0000213	PubMed	35484232
P0DTC2	IPFAMQMAY is a linear peptidic epitope (epitope ID 1318829) tested in 15 T cell assays.	IEDB	1318829	896	904	IPFAMQMAY	ECO:0000213	PubMed	38077128
P0DTC2	IPFAMQMAY is a linear peptidic epitope (epitope ID 1318829) tested in 15 T cell assays.	IEDB	1318829	896	904	IPFAMQMAY	ECO:0000213	PubMed	38781962
P0DTC2	IPFAMQMAY is a linear peptidic epitope (epitope ID 1318829) tested in 15 T cell assays.	IEDB	1318829	896	904	IPFAMQMAY	ECO:0000213	PubMed	34320609
P0DTC2	IPFAMQMAY is a linear peptidic epitope (epitope ID 1318829) tested in 15 T cell assays.	IEDB	1318829	896	904	IPFAMQMAY	ECO:0000213	PubMed	34044428
P0DTC2	IPTNFTISV is a linear peptidic epitope (epitope ID 1318845) tested in 12 T cell assays.	IEDB	1318845	714	722	IPTNFTISV	ECO:0000213	PubMed	33972535
P0DTC2	IPTNFTISV is a linear peptidic epitope (epitope ID 1318845) tested in 12 T cell assays.	IEDB	1318845	714	722	IPTNFTISV	ECO:0000213	PubMed	34793243
P0DTC2	IPTNFTISV is a linear peptidic epitope (epitope ID 1318845) tested in 12 T cell assays.	IEDB	1318845	714	722	IPTNFTISV	ECO:0000213	PubMed	38045681
P0DTC2	IYQTSNFRV is a linear peptidic epitope (epitope ID 1319328) tested in 6 T cell assays and 2 MHC ligand assays.	IEDB	1319328	312	320	IYQTSNFRV	ECO:0000213	PubMed	34222571
P0DTC2	KIADYNYKL is a linear peptidic epitope (epitope ID 1319519) tested in 28 T cell assays, 11 MHC ligand assays and has 3D structure(s) 7eu2.	IEDB	1319519	417	425	KIADYNYKL	ECO:0000213	PubMed	33325143
P0DTC2	KIADYNYKL is a linear peptidic epitope (epitope ID 1319519) tested in 28 T cell assays, 11 MHC ligand assays and has 3D structure(s) 7eu2.	IEDB	1319519	417	425	KIADYNYKL	ECO:0000213	PubMed	34210785
P0DTC2	KIADYNYKL is a linear peptidic epitope (epitope ID 1319519) tested in 28 T cell assays, 11 MHC ligand assays and has 3D structure(s) 7eu2.	IEDB	1319519	417	425	KIADYNYKL	ECO:0000213	PubMed	34506741
P0DTC2	KIADYNYKL is a linear peptidic epitope (epitope ID 1319519) tested in 28 T cell assays, 11 MHC ligand assays and has 3D structure(s) 7eu2.	IEDB	1319519	417	425	KIADYNYKL	ECO:0000213	PubMed	34968416
P0DTC2	KIADYNYKL is a linear peptidic epitope (epitope ID 1319519) tested in 28 T cell assays, 11 MHC ligand assays and has 3D structure(s) 7eu2.	IEDB	1319519	417	425	KIADYNYKL	ECO:0000213	PubMed	39456150
P0DTC2	KIADYNYKL is a linear peptidic epitope (epitope ID 1319519) tested in 28 T cell assays, 11 MHC ligand assays and has 3D structure(s) 7eu2.	IEDB	1319519	417	425	KIADYNYKL	ECO:0000213	PubMed	33853928
P0DTC2	KIYSKHTPI is a linear peptidic epitope (epitope ID 1319559) tested in 6 T cell assays and 2 MHC ligand assays.	IEDB	1319559	202	210	KIYSKHTPI	ECO:0000213	PubMed	37193826
P0DTC2	KPFERDISTEI is a linear peptidic epitope (epitope ID 1319894) tested in 9 T cell assays.	IEDB	1319894	462	472	KPFERDISTEI	ECO:0000213	PubMed	35484232
P0DTC2	KPFERDISTEI is a linear peptidic epitope (epitope ID 1319894) tested in 9 T cell assays.	IEDB	1319894	462	472	KPFERDISTEI	ECO:0000213	PubMed	35857584
P0DTC2	KVFRSSVLH is a linear peptidic epitope (epitope ID 1320006) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1320006	41	49	KVFRSSVLH	ECO:0000213	PubMed	35484232
P0DTC2	KVGGNYNYLY is a linear peptidic epitope (epitope ID 1320009) tested in 3 T cell assays.	IEDB	1320009	444	453	KVGGNYNYLY	ECO:0000213	PubMed	38045681
P0DTC2	LGAENSVAY is a linear peptidic epitope (epitope ID 1320443) tested in 2 T cell assays.	IEDB	1320443	699	707	LGAENSVAY	ECO:0000213	PubMed	35139340
P0DTC2	LPFNDGVYF is a linear peptidic epitope (epitope ID 1321049) tested in 18 T cell assays.	IEDB	1321049	84	92	LPFNDGVYF	ECO:0000213	PubMed	34968416
P0DTC2	LPFNDGVYF is a linear peptidic epitope (epitope ID 1321049) tested in 18 T cell assays.	IEDB	1321049	84	92	LPFNDGVYF	ECO:0000213	PubMed	35484232
P0DTC2	LPFNDGVYF is a linear peptidic epitope (epitope ID 1321049) tested in 18 T cell assays.	IEDB	1321049	84	92	LPFNDGVYF	ECO:0000213	PubMed	38077128
P0DTC2	LPFNDGVYF is a linear peptidic epitope (epitope ID 1321049) tested in 18 T cell assays.	IEDB	1321049	84	92	LPFNDGVYF	ECO:0000213	PubMed	34320609
P0DTC2	LPFNDGVYF is a linear peptidic epitope (epitope ID 1321049) tested in 18 T cell assays.	IEDB	1321049	84	92	LPFNDGVYF	ECO:0000213	PubMed	34044428
P0DTC2	LPIGINITRF is a linear peptidic epitope (epitope ID 1321058) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1321058	229	238	LPIGINITRF	ECO:0000213	PubMed	36254196
P0DTC2	LPIGINITRF is a linear peptidic epitope (epitope ID 1321058) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1321058	229	238	LPIGINITRF	ECO:0000213	PubMed	38045681
P0DTC2	LPPLLTDEM is a linear peptidic epitope (epitope ID 1321084) tested in 2 T cell assays.	IEDB	1321084	861	869	LPPLLTDEM	ECO:0000213	PubMed	35139340
P0DTC2	NSFTRGVYY is a linear peptidic epitope (epitope ID 1322611) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1322611	30	38	NSFTRGVYY	ECO:0000213	PubMed	38045681
P0DTC2	NSIAIPTNF is a linear peptidic epitope (epitope ID 1322613) tested in 3 T cell assays.	IEDB	1322613	710	718	NSIAIPTNF	ECO:0000213	PubMed	35139340
P0DTC2	NSIAIPTNF is a linear peptidic epitope (epitope ID 1322613) tested in 3 T cell assays.	IEDB	1322613	710	718	NSIAIPTNF	ECO:0000213	PubMed	38781962
P0DTC2	NVYADSFVIR is a linear peptidic epitope (epitope ID 1322744) tested in 2 T cell assays and 4 MHC ligand assays.	IEDB	1322744	394	403	NVYADSFVIR	ECO:0000213	PubMed	34728796
P0DTC2	QEVFAQVKQIY is a linear peptidic epitope (epitope ID 1323207) tested in 5 T cell assays.	IEDB	1323207	779	789	QEVFAQVKQIY	ECO:0000213	PubMed	35484232
P0DTC2	QLTPTWRVY is a linear peptidic epitope (epitope ID 1323406) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1323406	628	636	QLTPTWRVY	ECO:0000213	PubMed	34171305
P0DTC2	QLTPTWRVY is a linear peptidic epitope (epitope ID 1323406) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1323406	628	636	QLTPTWRVY	ECO:0000213	PubMed	35139340
P0DTC2	QPTESIVRF is a linear peptidic epitope (epitope ID 1323461) tested in 16 T cell assays and 2 MHC ligand assays.	IEDB	1323461	321	329	QPTESIVRF	ECO:0000213	PubMed	34968416
P0DTC2	QPTESIVRF is a linear peptidic epitope (epitope ID 1323461) tested in 16 T cell assays and 2 MHC ligand assays.	IEDB	1323461	321	329	QPTESIVRF	ECO:0000213	PubMed	35484232
P0DTC2	QPTESIVRF is a linear peptidic epitope (epitope ID 1323461) tested in 16 T cell assays and 2 MHC ligand assays.	IEDB	1323461	321	329	QPTESIVRF	ECO:0000213	PubMed	38781962
P0DTC2	QPTESIVRF is a linear peptidic epitope (epitope ID 1323461) tested in 16 T cell assays and 2 MHC ligand assays.	IEDB	1323461	321	329	QPTESIVRF	ECO:0000213	PubMed	39284068
P0DTC2	QPTESIVRF is a linear peptidic epitope (epitope ID 1323461) tested in 16 T cell assays and 2 MHC ligand assays.	IEDB	1323461	321	329	QPTESIVRF	ECO:0000213	PubMed	34320609
P0DTC2	QPTESIVRF is a linear peptidic epitope (epitope ID 1323461) tested in 16 T cell assays and 2 MHC ligand assays.	IEDB	1323461	321	329	QPTESIVRF	ECO:0000213	PubMed	34044428
P0DTC2	QTNSPRRAR is a linear peptidic epitope (epitope ID 1323599) tested in 4 T cell assays and 3 MHC ligand assays.	IEDB	1323599	677	685	QTNSPRRAR	ECO:0000213	PubMed	34728796
P0DTC2	QYIKWPWYIW is a linear peptidic epitope (epitope ID 1323673) tested in 12 T cell assays.	IEDB	1323673	1208	1217	QYIKWPWYIW	ECO:0000213	PubMed	36603583
P0DTC2	RASANLAATK is a linear peptidic epitope (epitope ID 1323750) tested in 3 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	1323750	1019	1028	RASANLAATK	ECO:0000213	PubMed	35484232
P0DTC2	RASANLAATK is a linear peptidic epitope (epitope ID 1323750) tested in 3 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	1323750	1019	1028	RASANLAATK	ECO:0000213	PubMed	35371042
P0DTC2	RFPNITNLCPF is a linear peptidic epitope (epitope ID 1323786) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1323786	328	338	RFPNITNLCPF	ECO:0000213	PubMed	36068240
P0DTC2	RVYSTGSNVF is a linear peptidic epitope (epitope ID 1324117) tested in 8 T cell assays and 1 MHC ligand assay.	IEDB	1324117	634	643	RVYSTGSNVF	ECO:0000213	PubMed	35484232
P0DTC2	RVYSTGSNVF is a linear peptidic epitope (epitope ID 1324117) tested in 8 T cell assays and 1 MHC ligand assay.	IEDB	1324117	634	643	RVYSTGSNVF	ECO:0000213	PubMed	36068240
P0DTC2	RVYSTGSNVF is a linear peptidic epitope (epitope ID 1324117) tested in 8 T cell assays and 1 MHC ligand assay.	IEDB	1324117	634	643	RVYSTGSNVF	ECO:0000213	PubMed	33853928
P0DTC2	SANNCTFEY is a linear peptidic epitope (epitope ID 1324274) tested in 8 T cell assays.	IEDB	1324274	162	170	SANNCTFEY	ECO:0000213	PubMed	34793243
P0DTC2	SANNCTFEY is a linear peptidic epitope (epitope ID 1324274) tested in 8 T cell assays.	IEDB	1324274	162	170	SANNCTFEY	ECO:0000213	PubMed	35484232
P0DTC2	SANNCTFEY is a linear peptidic epitope (epitope ID 1324274) tested in 8 T cell assays.	IEDB	1324274	162	170	SANNCTFEY	ECO:0000213	PubMed	36302758
P0DTC2	SFPQSAPHGVVF is a linear peptidic epitope (epitope ID 1324414) tested in 3 T cell assays, 5 B cell assays and 1 MHC ligand assay.	IEDB	1324414	1051	1062	SFPQSAPHGVVF	ECO:0000213	PubMed	36068240
P0DTC2	SPRRARSV is a linear peptidic epitope (epitope ID 1324899) tested in 4 T cell assays.	IEDB	1324899	680	687	SPRRARSV	ECO:0000213	PubMed	33853928
P0DTC2	STGSNVFQTR is a linear peptidic epitope (epitope ID 1325105) tested in 7 T cell assays.	IEDB	1325105	637	646	STGSNVFQTR	ECO:0000213	PubMed	35139340
P0DTC2	STGSNVFQTR is a linear peptidic epitope (epitope ID 1325105) tested in 7 T cell assays.	IEDB	1325105	637	646	STGSNVFQTR	ECO:0000213	PubMed	35484232
P0DTC2	SVYAWNRKR is a linear peptidic epitope (epitope ID 1325172) tested in 10 T cell assays and 2 MHC ligand assays.	IEDB	1325172	349	357	SVYAWNRKR	ECO:0000213	PubMed	34728796
P0DTC2	SVYAWNRKR is a linear peptidic epitope (epitope ID 1325172) tested in 10 T cell assays and 2 MHC ligand assays.	IEDB	1325172	349	357	SVYAWNRKR	ECO:0000213	PubMed	35484232
P0DTC2	SVYAWNRKR is a linear peptidic epitope (epitope ID 1325172) tested in 10 T cell assays and 2 MHC ligand assays.	IEDB	1325172	349	357	SVYAWNRKR	ECO:0000213	PubMed	35699447
P0DTC2	TPCSFGGVSV is a linear peptidic epitope (epitope ID 1325795) tested in 5 T cell assays.	IEDB	1325795	588	597	TPCSFGGVSV	ECO:0000213	PubMed	33853928
P0DTC2	VASQSIIAY is a linear peptidic epitope (epitope ID 1326261) tested in 12 T cell assays.	IEDB	1326261	687	695	VASQSIIAY	ECO:0000213	PubMed	35484232
P0DTC2	VASQSIIAY is a linear peptidic epitope (epitope ID 1326261) tested in 12 T cell assays.	IEDB	1326261	687	695	VASQSIIAY	ECO:0000213	PubMed	38866784
P0DTC2	VASQSIIAY is a linear peptidic epitope (epitope ID 1326261) tested in 12 T cell assays.	IEDB	1326261	687	695	VASQSIIAY	ECO:0000213	PubMed	33853928
P0DTC2	VFAQVKQIY is a linear peptidic epitope (epitope ID 1326322) tested in 4 T cell assays.	IEDB	1326322	781	789	VFAQVKQIY	ECO:0000213	PubMed	38781962
P0DTC2	VFAQVKQIY is a linear peptidic epitope (epitope ID 1326322) tested in 4 T cell assays.	IEDB	1326322	781	789	VFAQVKQIY	ECO:0000213	PubMed	33853928
P0DTC2	VFKNIDGYF is a linear peptidic epitope (epitope ID 1326409) tested in 6 T cell assays and 1 MHC ligand assay.	IEDB	1326409	193	201	VFKNIDGYF	ECO:0000213	PubMed	34222571
P0DTC2	VFKNIDGYF is a linear peptidic epitope (epitope ID 1326409) tested in 6 T cell assays and 1 MHC ligand assay.	IEDB	1326409	193	201	VFKNIDGYF	ECO:0000213	PubMed	36068240
P0DTC2	VFKNIDGYF is a linear peptidic epitope (epitope ID 1326409) tested in 6 T cell assays and 1 MHC ligand assay.	IEDB	1326409	193	201	VFKNIDGYF	ECO:0000213	PubMed	34086357
P0DTC2	VFVSNGTHWF is a linear peptidic epitope (epitope ID 1326455) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1326455	1094	1103	VFVSNGTHWF	ECO:0000213	PubMed	36068240
P0DTC2	VYDPLQPELDSF is a linear peptidic epitope (epitope ID 1327418) tested in 4 T cell assays, 8 B cell assays and 1 MHC ligand assay.	IEDB	1327418	1137	1148	VYDPLQPELDSF	ECO:0000213	PubMed	34704808
P0DTC2	VYDPLQPELDSF is a linear peptidic epitope (epitope ID 1327418) tested in 4 T cell assays, 8 B cell assays and 1 MHC ligand assay.	IEDB	1327418	1137	1148	VYDPLQPELDSF	ECO:0000213	PubMed	36068240
P0DTC2	VYSSANNCTF is a linear peptidic epitope (epitope ID 1327695) tested in 12 T cell assays and 1 MHC ligand assay.	IEDB	1327695	159	168	VYSSANNCTF	ECO:0000213	PubMed	36068240
P0DTC2	WTAGAAAYY is a linear peptidic epitope (epitope ID 1327824) tested in 13 T cell assays and 1 MHC ligand assay.	IEDB	1327824	258	266	WTAGAAAYY	ECO:0000213	PubMed	34793243
P0DTC2	WTAGAAAYY is a linear peptidic epitope (epitope ID 1327824) tested in 13 T cell assays and 1 MHC ligand assay.	IEDB	1327824	258	266	WTAGAAAYY	ECO:0000213	PubMed	34968416
P0DTC2	WTAGAAAYY is a linear peptidic epitope (epitope ID 1327824) tested in 13 T cell assays and 1 MHC ligand assay.	IEDB	1327824	258	266	WTAGAAAYY	ECO:0000213	PubMed	38045681
P0DTC2	YAWNRKRI is a linear peptidic epitope (epitope ID 1327895) tested in 3 T cell assays.	IEDB	1327895	351	358	YAWNRKRI	ECO:0000213	PubMed	35484232
P0DTC2	YGFQPTNGV is a linear peptidic epitope (epitope ID 1328001) tested in 5 T cell assays and 2 MHC ligand assays.	IEDB	1328001	495	503	YGFQPTNGV	ECO:0000213	PubMed	34793243
P0DTC2	YQDVNCTEV is a linear peptidic epitope (epitope ID 1328471) tested in 9 T cell assays and 3 MHC ligand assays.	IEDB	1328471	612	620	YQDVNCTEV	ECO:0000213	PubMed	34793243
P0DTC2	YQDVNCTEV is a linear peptidic epitope (epitope ID 1328471) tested in 9 T cell assays and 3 MHC ligand assays.	IEDB	1328471	612	620	YQDVNCTEV	ECO:0000213	PubMed	35116022
P0DTC2	YTNSFTRGVY is a linear peptidic epitope (epitope ID 1328804) tested in 7 T cell assays.	IEDB	1328804	28	37	YTNSFTRGVY	ECO:0000213	PubMed	35139340
P0DTC2	YTNSFTRGVY is a linear peptidic epitope (epitope ID 1328804) tested in 7 T cell assays.	IEDB	1328804	28	37	YTNSFTRGVY	ECO:0000213	PubMed	38045681
P0DTC2	YTNSFTRGVY is a linear peptidic epitope (epitope ID 1328804) tested in 7 T cell assays.	IEDB	1328804	28	37	YTNSFTRGVY	ECO:0000213	PubMed	33853928
P0DTC2	YYVGYLQPRTF is a linear peptidic epitope (epitope ID 1329031) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1329031	265	275	YYVGYLQPRTF	ECO:0000213	PubMed	37193826
P0DTC2	AAEIRASANLAA is a linear peptidic epitope (epitope ID 1329074) tested in 5 B cell assays and 1 MHC ligand assay.	IEDB	1329074	1015	1026	AAEIRASANLAA	ECO:0000213	PubMed	33220791
P0DTC2	AAEIRASANLAAT is a linear peptidic epitope (epitope ID 1329075) tested in 1 MHC ligand assay.	IEDB	1329075	1015	1027	AAEIRASANLAAT	ECO:0000213	PubMed	33220791
P0DTC2	AAEIRASANLAATK is a linear peptidic epitope (epitope ID 1329076) tested in 2 MHC ligand assays.	IEDB	1329076	1015	1028	AAEIRASANLAATK	ECO:0000213	PubMed	34004174
P0DTC2	AAEIRASANLAATK is a linear peptidic epitope (epitope ID 1329076) tested in 2 MHC ligand assays.	IEDB	1329076	1015	1028	AAEIRASANLAATK	ECO:0000213	PubMed	33220791
P0DTC2	AAYYVGYLQPR is a linear peptidic epitope (epitope ID 1329080) tested in 1 MHC ligand assay.	IEDB	1329080	263	273	AAYYVGYLQPR	ECO:0000213	PubMed	33220791
P0DTC2	AGFIKQYGDCLG is a linear peptidic epitope (epitope ID 1329091) tested in 8 B cell assays and 1 MHC ligand assay.	IEDB	1329091	831	842	AGFIKQYGDCLG	ECO:0000213	PubMed	33220791
P0DTC2	AGFIKQYGDCLGDI is a linear peptidic epitope (epitope ID 1329092) tested in 1 MHC ligand assay.	IEDB	1329092	831	844	AGFIKQYGDCLGDI	ECO:0000213	PubMed	33220791
P0DTC2	AIGKIQDSLSST is a linear peptidic epitope (epitope ID 1329105) tested in 5 B cell assays and 1 MHC ligand assay.	IEDB	1329105	930	941	AIGKIQDSLSST	ECO:0000213	PubMed	33220791
P0DTC2	ALEPLVDLPI is a linear peptidic epitope (epitope ID 1329111) tested in 1 MHC ligand assay.	IEDB	1329111	222	231	ALEPLVDLPI	ECO:0000213	PubMed	33220791
P0DTC2	AMQMAYRFNGIGV is a linear peptidic epitope (epitope ID 1329120) tested in 1 MHC ligand assay.	IEDB	1329120	899	911	AMQMAYRFNGIGV	ECO:0000213	PubMed	33220791
P0DTC2	APGQTGKIADYNY is a linear peptidic epitope (epitope ID 1329123) tested in 1 MHC ligand assay.	IEDB	1329123	411	423	APGQTGKIADYNY	ECO:0000213	PubMed	33220791
P0DTC2	AQALNTLVKQLSS is a linear peptidic epitope (epitope ID 1329129) tested in 1 MHC ligand assay.	IEDB	1329129	956	968	AQALNTLVKQLSS	ECO:0000213	PubMed	33220791
P0DTC2	AQALNTLVKQLSSN is a linear peptidic epitope (epitope ID 1329130) tested in 1 MHC ligand assay.	IEDB	1329130	956	969	AQALNTLVKQLSSN	ECO:0000213	PubMed	33220791
P0DTC2	ASFSTFKCYGVSP is a linear peptidic epitope (epitope ID 1329140) tested in 1 MHC ligand assay.	IEDB	1329140	372	384	ASFSTFKCYGVSP	ECO:0000213	PubMed	33220791
P0DTC2	ASQSIIAYTMSLG is a linear peptidic epitope (epitope ID 1329149) tested in 2 MHC ligand assays.	IEDB	1329149	688	700	ASQSIIAYTMSLG	ECO:0000213	PubMed	38117652
P0DTC2	ASQSIIAYTMSLG is a linear peptidic epitope (epitope ID 1329149) tested in 2 MHC ligand assays.	IEDB	1329149	688	700	ASQSIIAYTMSLG	ECO:0000213	PubMed	33220791
P0DTC2	ASVVNIQKEIDRLN is a linear peptidic epitope (epitope ID 1329152) tested in 1 MHC ligand assay.	IEDB	1329152	1174	1187	ASVVNIQKEIDRLN	ECO:0000213	PubMed	33220791
P0DTC2	ASVYAWNRKRIS is a linear peptidic epitope (epitope ID 1329154) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1329154	348	359	ASVYAWNRKRIS	ECO:0000213	PubMed	33220791
P0DTC2	ASVYAWNRKRISN is a linear peptidic epitope (epitope ID 1329156) tested in 4 T cell assays, 4 B cell assays and 2 MHC ligand assays.	IEDB	1329156	348	360	ASVYAWNRKRISN	ECO:0000213	PubMed	33923363
P0DTC2	ASVYAWNRKRISN is a linear peptidic epitope (epitope ID 1329156) tested in 4 T cell assays, 4 B cell assays and 2 MHC ligand assays.	IEDB	1329156	348	360	ASVYAWNRKRISN	ECO:0000213	PubMed	34004174
P0DTC2	ASVYAWNRKRISN is a linear peptidic epitope (epitope ID 1329156) tested in 4 T cell assays, 4 B cell assays and 2 MHC ligand assays.	IEDB	1329156	348	360	ASVYAWNRKRISN	ECO:0000213	PubMed	33220791
P0DTC2	ASVYAWNRKRISNC is a linear peptidic epitope (epitope ID 1329158) tested in 1 MHC ligand assay.	IEDB	1329158	348	361	ASVYAWNRKRISNC	ECO:0000213	PubMed	33220791
P0DTC2	ASVYAWNRKRISNCV is a linear peptidic epitope (epitope ID 1329160) tested in 3 T cell assays and 8 MHC ligand assays.	IEDB	1329160	348	362	ASVYAWNRKRISNCV	ECO:0000213	PubMed	33220791
P0DTC2	ATRFASVYAWNRK is a linear peptidic epitope (epitope ID 1329166) tested in 1 MHC ligand assay.	IEDB	1329166	344	356	ATRFASVYAWNRK	ECO:0000213	PubMed	33220791
P0DTC2	ATRFASVYAWNRKR is a linear peptidic epitope (epitope ID 1329168) tested in 2 MHC ligand assays.	IEDB	1329168	344	357	ATRFASVYAWNRKR	ECO:0000213	PubMed	38117652
P0DTC2	ATRFASVYAWNRKR is a linear peptidic epitope (epitope ID 1329168) tested in 2 MHC ligand assays.	IEDB	1329168	344	357	ATRFASVYAWNRKR	ECO:0000213	PubMed	33220791
P0DTC2	ATRFASVYAWNRKRI is a linear peptidic epitope (epitope ID 1329169) tested in 19 T cell assays and 9 MHC ligand assays.	IEDB	1329169	344	358	ATRFASVYAWNRKRI	ECO:0000213	PubMed	33220791
P0DTC2	ATRFASVYAWNRKRISN is a linear peptidic epitope (epitope ID 1329170) tested in 4 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1329170	344	360	ATRFASVYAWNRKRISN	ECO:0000213	PubMed	34672530
P0DTC2	AWNRKRISNCVADYS is a linear peptidic epitope (epitope ID 1329173) tested in 3 T cell assays, 16 B cell assays and 8 MHC ligand assays.	IEDB	1329173	352	366	AWNRKRISNCVADYS	ECO:0000213	PubMed	33220791
P0DTC2	DAGFIKQYGD is a linear peptidic epitope (epitope ID 1329229) tested in 1 MHC ligand assay.	IEDB	1329229	830	839	DAGFIKQYGD	ECO:0000213	PubMed	33220791
P0DTC2	DAGFIKQYGDCLG is a linear peptidic epitope (epitope ID 1329230) tested in 1 MHC ligand assay.	IEDB	1329230	830	842	DAGFIKQYGDCLG	ECO:0000213	PubMed	33220791
P0DTC2	DAGFIKQYGDCLGD is a linear peptidic epitope (epitope ID 1329231) tested in 1 MHC ligand assay.	IEDB	1329231	830	843	DAGFIKQYGDCLGD	ECO:0000213	PubMed	33220791
P0DTC2	DAGFIKQYGDCLGDI is a linear peptidic epitope (epitope ID 1329232) tested in 10 MHC ligand assays.	IEDB	1329232	830	844	DAGFIKQYGDCLGDI	ECO:0000213	PubMed	33220791
P0DTC2	DEMIAQYTSAL is a linear peptidic epitope (epitope ID 1329248) tested in 1 MHC ligand assay.	IEDB	1329248	867	877	DEMIAQYTSAL	ECO:0000213	PubMed	33220791
P0DTC2	DEMIAQYTSALL is a linear peptidic epitope (epitope ID 1329250) tested in 5 B cell assays and 2 MHC ligand assays.	IEDB	1329250	867	878	DEMIAQYTSALL	ECO:0000213	PubMed	38117652
P0DTC2	DEMIAQYTSALL is a linear peptidic epitope (epitope ID 1329250) tested in 5 B cell assays and 2 MHC ligand assays.	IEDB	1329250	867	878	DEMIAQYTSALL	ECO:0000213	PubMed	33220791
P0DTC2	DEMIAQYTSALLA is a linear peptidic epitope (epitope ID 1329252) tested in 2 MHC ligand assays.	IEDB	1329252	867	879	DEMIAQYTSALLA	ECO:0000213	PubMed	38117652
P0DTC2	DEMIAQYTSALLA is a linear peptidic epitope (epitope ID 1329252) tested in 2 MHC ligand assays.	IEDB	1329252	867	879	DEMIAQYTSALLA	ECO:0000213	PubMed	33220791
P0DTC2	DEMIAQYTSALLAG is a linear peptidic epitope (epitope ID 1329254) tested in 2 MHC ligand assays.	IEDB	1329254	867	880	DEMIAQYTSALLAG	ECO:0000213	PubMed	38117652
P0DTC2	DEMIAQYTSALLAG is a linear peptidic epitope (epitope ID 1329254) tested in 2 MHC ligand assays.	IEDB	1329254	867	880	DEMIAQYTSALLAG	ECO:0000213	PubMed	33220791
P0DTC2	DEMIAQYTSALLAGT is a linear peptidic epitope (epitope ID 1329256) tested in 4 B cell assays and 9 MHC ligand assays.	IEDB	1329256	867	881	DEMIAQYTSALLAGT	ECO:0000213	PubMed	38117652
P0DTC2	DEMIAQYTSALLAGT is a linear peptidic epitope (epitope ID 1329256) tested in 4 B cell assays and 9 MHC ligand assays.	IEDB	1329256	867	881	DEMIAQYTSALLAGT	ECO:0000213	PubMed	33220791
P0DTC2	DGYFKIYSKHTPI is a linear peptidic epitope (epitope ID 1329271) tested in 1 MHC ligand assay.	IEDB	1329271	198	210	DGYFKIYSKHTPI	ECO:0000213	PubMed	33220791
P0DTC2	DGYFKIYSKHTPIN is a linear peptidic epitope (epitope ID 1329272) tested in 1 MHC ligand assay.	IEDB	1329272	198	211	DGYFKIYSKHTPIN	ECO:0000213	PubMed	33220791
P0DTC2	DIADTTDAVRDPQ is a linear peptidic epitope (epitope ID 1329273) tested in 1 MHC ligand assay.	IEDB	1329273	568	580	DIADTTDAVRDPQ	ECO:0000213	PubMed	33220791
P0DTC2	DIADTTDAVRDPQT is a linear peptidic epitope (epitope ID 1329274) tested in 1 MHC ligand assay.	IEDB	1329274	568	581	DIADTTDAVRDPQT	ECO:0000213	PubMed	33220791
P0DTC2	DISGINASVVNIQK is a linear peptidic epitope (epitope ID 1329276) tested in 1 MHC ligand assay.	IEDB	1329276	1168	1181	DISGINASVVNIQK	ECO:0000213	PubMed	33220791
P0DTC2	DISTEIYQAGSTPC is a linear peptidic epitope (epitope ID 1329281) tested in 1 MHC ligand assay.	IEDB	1329281	467	480	DISTEIYQAGSTPC	ECO:0000213	PubMed	33220791
P0DTC2	DLLFNKVTLADAG is a linear peptidic epitope (epitope ID 1329291) tested in 1 MHC ligand assay.	IEDB	1329291	820	832	DLLFNKVTLADAG	ECO:0000213	PubMed	33220791
P0DTC2	DLPQGFSALEPLVD is a linear peptidic epitope (epitope ID 1329293) tested in 1 MHC ligand assay.	IEDB	1329293	215	228	DLPQGFSALEPLVD	ECO:0000213	PubMed	33220791
P0DTC2	EFQFCNDPFLGVYY is a linear peptidic epitope (epitope ID 1329323) tested in 1 MHC ligand assay.	IEDB	1329323	132	145	EFQFCNDPFLGVYY	ECO:0000213	PubMed	33220791
P0DTC2	EFQFCNDPFLGVYYH is a linear peptidic epitope (epitope ID 1329325) tested in 11 MHC ligand assays.	IEDB	1329325	132	146	EFQFCNDPFLGVYYH	ECO:0000213	PubMed	33220791
P0DTC2	EFVFKNIDGYFK is a linear peptidic epitope (epitope ID 1329331) tested in 3 B cell assays and 2 MHC ligand assays.	IEDB	1329331	191	202	EFVFKNIDGYFK	ECO:0000213	PubMed	38117652
P0DTC2	EFVFKNIDGYFK is a linear peptidic epitope (epitope ID 1329331) tested in 3 B cell assays and 2 MHC ligand assays.	IEDB	1329331	191	202	EFVFKNIDGYFK	ECO:0000213	PubMed	33220791
P0DTC2	EFVFKNIDGYFKI is a linear peptidic epitope (epitope ID 1329332) tested in 1 MHC ligand assay.	IEDB	1329332	191	203	EFVFKNIDGYFKI	ECO:0000213	PubMed	33220791
P0DTC2	EFVFKNIDGYFKIY is a linear peptidic epitope (epitope ID 1329333) tested in 2 MHC ligand assays.	IEDB	1329333	191	204	EFVFKNIDGYFKIY	ECO:0000213	PubMed	38117652
P0DTC2	EFVFKNIDGYFKIY is a linear peptidic epitope (epitope ID 1329333) tested in 2 MHC ligand assays.	IEDB	1329333	191	204	EFVFKNIDGYFKIY	ECO:0000213	PubMed	33220791
P0DTC2	EIYQAGSTPCNGVE is a linear peptidic epitope (epitope ID 1329337) tested in 1 MHC ligand assay.	IEDB	1329337	471	484	EIYQAGSTPCNGVE	ECO:0000213	PubMed	33220791
P0DTC2	ELGKYEQYIKWP is a linear peptidic epitope (epitope ID 1329338) tested in 6 B cell assays and 1 MHC ligand assay.	IEDB	1329338	1202	1213	ELGKYEQYIKWP	ECO:0000213	PubMed	35916768
P0DTC2	ELGKYEQYIKWP is a linear peptidic epitope (epitope ID 1329338) tested in 6 B cell assays and 1 MHC ligand assay.	IEDB	1329338	1202	1213	ELGKYEQYIKWP	ECO:0000213	PubMed	33220791
P0DTC2	EMIAQYTSALLA is a linear peptidic epitope (epitope ID 1329340) tested in 10 T cell assays, 6 B cell assays and 2 MHC ligand assays.	IEDB	1329340	868	879	EMIAQYTSALLA	ECO:0000213	PubMed	35857584
P0DTC2	EMIAQYTSALLA is a linear peptidic epitope (epitope ID 1329340) tested in 10 T cell assays, 6 B cell assays and 2 MHC ligand assays.	IEDB	1329340	868	879	EMIAQYTSALLA	ECO:0000213	PubMed	38117652
P0DTC2	EMIAQYTSALLA is a linear peptidic epitope (epitope ID 1329340) tested in 10 T cell assays, 6 B cell assays and 2 MHC ligand assays.	IEDB	1329340	868	879	EMIAQYTSALLA	ECO:0000213	PubMed	33220791
P0DTC2	EMIAQYTSALLAG is a linear peptidic epitope (epitope ID 1329342) tested in 2 MHC ligand assays.	IEDB	1329342	868	880	EMIAQYTSALLAG	ECO:0000213	PubMed	38117652
P0DTC2	EMIAQYTSALLAG is a linear peptidic epitope (epitope ID 1329342) tested in 2 MHC ligand assays.	IEDB	1329342	868	880	EMIAQYTSALLAG	ECO:0000213	PubMed	33220791
P0DTC2	EMIAQYTSALLAGT is a linear peptidic epitope (epitope ID 1329344) tested in 2 MHC ligand assays.	IEDB	1329344	868	881	EMIAQYTSALLAGT	ECO:0000213	PubMed	38117652
P0DTC2	EMIAQYTSALLAGT is a linear peptidic epitope (epitope ID 1329344) tested in 2 MHC ligand assays.	IEDB	1329344	868	881	EMIAQYTSALLAGT	ECO:0000213	PubMed	33220791
P0DTC2	ENQKLIANQFNSAIG is a linear peptidic epitope (epitope ID 1329346) tested in 11 MHC ligand assays.	IEDB	1329346	918	932	ENQKLIANQFNSAIG	ECO:0000213	PubMed	33220791
P0DTC2	EPQIITTDNTFVSG is a linear peptidic epitope (epitope ID 1329353) tested in 2 MHC ligand assays.	IEDB	1329353	1111	1124	EPQIITTDNTFVSG	ECO:0000213	PubMed	34004174
P0DTC2	EPQIITTDNTFVSG is a linear peptidic epitope (epitope ID 1329353) tested in 2 MHC ligand assays.	IEDB	1329353	1111	1124	EPQIITTDNTFVSG	ECO:0000213	PubMed	33220791
P0DTC2	EQYIKWP is a linear peptidic epitope (epitope ID 1329357) tested in 1 MHC ligand assay.	IEDB	1329357	1207	1213	EQYIKWP	ECO:0000213	PubMed	33220791
P0DTC2	EYVSQPFLMDLE is a linear peptidic epitope (epitope ID 1329375) tested in 5 B cell assays and 1 MHC ligand assay.	IEDB	1329375	169	180	EYVSQPFLMDLE	ECO:0000213	PubMed	33220791
P0DTC2	EYVSQPFLMDLEG is a linear peptidic epitope (epitope ID 1329376) tested in 1 MHC ligand assay.	IEDB	1329376	169	181	EYVSQPFLMDLEG	ECO:0000213	PubMed	33220791
P0DTC2	FASVYAWNRKRI is a linear peptidic epitope (epitope ID 1329378) tested in 4 B cell assays and 1 MHC ligand assay.	IEDB	1329378	347	358	FASVYAWNRKRI	ECO:0000213	PubMed	36658749
P0DTC2	FASVYAWNRKRI is a linear peptidic epitope (epitope ID 1329378) tested in 4 B cell assays and 1 MHC ligand assay.	IEDB	1329378	347	358	FASVYAWNRKRI	ECO:0000213	PubMed	33220791
P0DTC2	FASVYAWNRKRIS is a linear peptidic epitope (epitope ID 1329379) tested in 1 MHC ligand assay.	IEDB	1329379	347	359	FASVYAWNRKRIS	ECO:0000213	PubMed	33220791
P0DTC2	FASVYAWNRKRISN is a linear peptidic epitope (epitope ID 1329381) tested in 1 MHC ligand assay.	IEDB	1329381	347	360	FASVYAWNRKRISN	ECO:0000213	PubMed	33220791
P0DTC2	FASVYAWNRKRISNC is a linear peptidic epitope (epitope ID 1329383) tested in 7 B cell assays and 8 MHC ligand assays.	IEDB	1329383	347	361	FASVYAWNRKRISNC	ECO:0000213	PubMed	33220791
P0DTC2	FCNDPFLGVYYH is a linear peptidic epitope (epitope ID 1329390) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1329390	135	146	FCNDPFLGVYYH	ECO:0000213	PubMed	33220791
P0DTC2	FEYVSQPFLMDLE is a linear peptidic epitope (epitope ID 1329393) tested in 1 MHC ligand assay.	IEDB	1329393	168	180	FEYVSQPFLMDLE	ECO:0000213	PubMed	33220791
P0DTC2	FEYVSQPFLMDLEG is a linear peptidic epitope (epitope ID 1329395) tested in 1 MHC ligand assay.	IEDB	1329395	168	181	FEYVSQPFLMDLEG	ECO:0000213	PubMed	33220791
P0DTC2	FEYVSQPFLMDLEGK is a linear peptidic epitope (epitope ID 1329396) tested in 8 MHC ligand assays.	IEDB	1329396	168	182	FEYVSQPFLMDLEGK	ECO:0000213	PubMed	33220791
P0DTC2	FKIYSKHTPINL is a linear peptidic epitope (epitope ID 1329403) tested in 2 MHC ligand assays.	IEDB	1329403	201	212	FKIYSKHTPINL	ECO:0000213	PubMed	34004174
P0DTC2	FKIYSKHTPINL is a linear peptidic epitope (epitope ID 1329403) tested in 2 MHC ligand assays.	IEDB	1329403	201	212	FKIYSKHTPINL	ECO:0000213	PubMed	33220791
P0DTC2	FLPFFSNV is a linear peptidic epitope (epitope ID 1329407) tested in 6 T cell assays and 2 MHC ligand assays.	IEDB	1329407	55	62	FLPFFSNV	ECO:0000213	PubMed	35484232
P0DTC2	FLPFFSNV is a linear peptidic epitope (epitope ID 1329407) tested in 6 T cell assays and 2 MHC ligand assays.	IEDB	1329407	55	62	FLPFFSNV	ECO:0000213	PubMed	33853928
P0DTC2	FNSAIGKIQDSLSST is a linear peptidic epitope (epitope ID 1329410) tested in 4 B cell assays and 10 MHC ligand assays.	IEDB	1329410	927	941	FNSAIGKIQDSLSST	ECO:0000213	PubMed	33220791
P0DTC2	FQFCNDPFLGVYY is a linear peptidic epitope (epitope ID 1329414) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1329414	133	145	FQFCNDPFLGVYY	ECO:0000213	PubMed	33220791
P0DTC2	FQFCNDPFLGVYYH is a linear peptidic epitope (epitope ID 1329416) tested in 1 MHC ligand assay.	IEDB	1329416	133	146	FQFCNDPFLGVYYH	ECO:0000213	PubMed	33220791
P0DTC2	FQTLLALHRSYLTPG is a linear peptidic epitope (epitope ID 1329417) tested in 6 B cell assays and 8 MHC ligand assays.	IEDB	1329417	238	252	FQTLLALHRSYLTPG	ECO:0000213	PubMed	33220791
P0DTC2	FSQILPDPSKPS is a linear peptidic epitope (epitope ID 1329421) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1329421	802	813	FSQILPDPSKPS	ECO:0000213	PubMed	33220791
P0DTC2	FSQILPDPSKPSKR is a linear peptidic epitope (epitope ID 1329422) tested in 2 MHC ligand assays.	IEDB	1329422	802	815	FSQILPDPSKPSKR	ECO:0000213	PubMed	34004174
P0DTC2	FSQILPDPSKPSKR is a linear peptidic epitope (epitope ID 1329422) tested in 2 MHC ligand assays.	IEDB	1329422	802	815	FSQILPDPSKPSKR	ECO:0000213	PubMed	33220791
P0DTC2	FSTFKCYGVSPT is a linear peptidic epitope (epitope ID 1329423) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1329423	374	385	FSTFKCYGVSPT	ECO:0000213	PubMed	33220791
P0DTC2	FTRGVYYPDKVFRSS is a linear peptidic epitope (epitope ID 1329426) tested in 9 MHC ligand assays.	IEDB	1329426	32	46	FTRGVYYPDKVFRSS	ECO:0000213	PubMed	33220791
P0DTC2	FVFKNIDGYFKIYS is a linear peptidic epitope (epitope ID 1329428) tested in 1 MHC ligand assay.	IEDB	1329428	192	205	FVFKNIDGYFKIYS	ECO:0000213	PubMed	33220791
P0DTC2	FVTQRNFYEPQ is a linear peptidic epitope (epitope ID 1329430) tested in 1 MHC ligand assay.	IEDB	1329430	1103	1113	FVTQRNFYEPQ	ECO:0000213	PubMed	33220791
P0DTC2	GCVIAWNSNNLDSK is a linear peptidic epitope (epitope ID 1329439) tested in 2 MHC ligand assays.	IEDB	1329439	431	444	GCVIAWNSNNLDSK	ECO:0000213	PubMed	38117652
P0DTC2	GCVIAWNSNNLDSK is a linear peptidic epitope (epitope ID 1329439) tested in 2 MHC ligand assays.	IEDB	1329439	431	444	GCVIAWNSNNLDSK	ECO:0000213	PubMed	33220791
P0DTC2	GFIKQYGDCLGDIA is a linear peptidic epitope (epitope ID 1329446) tested in 1 MHC ligand assay.	IEDB	1329446	832	845	GFIKQYGDCLGDIA	ECO:0000213	PubMed	33220791
P0DTC2	GFSALEPLVDLPI is a linear peptidic epitope (epitope ID 1329447) tested in 1 MHC ligand assay.	IEDB	1329447	219	231	GFSALEPLVDLPI	ECO:0000213	PubMed	33220791
P0DTC2	GGNYNYLYRLFRK is a linear peptidic epitope (epitope ID 1329452) tested in 1 MHC ligand assay.	IEDB	1329452	446	458	GGNYNYLYRLFRK	ECO:0000213	PubMed	33220791
P0DTC2	GIVNNTVYDPLQPE is a linear peptidic epitope (epitope ID 1329468) tested in 1 MHC ligand assay.	IEDB	1329468	1131	1144	GIVNNTVYDPLQPE	ECO:0000213	PubMed	33220791
P0DTC2	GKYEQYIKWP is a linear peptidic epitope (epitope ID 1329473) tested in 1 MHC ligand assay.	IEDB	1329473	1204	1213	GKYEQYIKWP	ECO:0000213	PubMed	33220791
P0DTC2	GLTGTGVLTESNK is a linear peptidic epitope (epitope ID 1329481) tested in 1 MHC ligand assay.	IEDB	1329481	545	557	GLTGTGVLTESNK	ECO:0000213	PubMed	33220791
P0DTC2	GLTGTGVLTESNKK is a linear peptidic epitope (epitope ID 1329482) tested in 1 MHC ligand assay.	IEDB	1329482	545	558	GLTGTGVLTESNKK	ECO:0000213	PubMed	33220791
P0DTC2	GNYNYLYRL is a linear peptidic epitope (epitope ID 1329485) tested in 2 T cell assays and 2 MHC ligand assays.	IEDB	1329485	447	455	GNYNYLYRL	ECO:0000213	PubMed	33220791
P0DTC2	GNYNYLYRLF is a linear peptidic epitope (epitope ID 1329486) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1329486	447	456	GNYNYLYRLF	ECO:0000213	PubMed	33220791
P0DTC2	GNYNYLYRLF is a linear peptidic epitope (epitope ID 1329486) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1329486	447	456	GNYNYLYRLF	ECO:0000213	PubMed	33853928
P0DTC2	GNYNYLYRLFR is a linear peptidic epitope (epitope ID 1329487) tested in 1 MHC ligand assay.	IEDB	1329487	447	457	GNYNYLYRLFR	ECO:0000213	PubMed	33220791
P0DTC2	GNYNYLYRLFRK is a linear peptidic epitope (epitope ID 1329488) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1329488	447	458	GNYNYLYRLFRK	ECO:0000213	PubMed	33220791
P0DTC2	GNYNYLYRLFRKS is a linear peptidic epitope (epitope ID 1329489) tested in 2 MHC ligand assays.	IEDB	1329489	447	459	GNYNYLYRLFRKS	ECO:0000213	PubMed	34004174
P0DTC2	GNYNYLYRLFRKS is a linear peptidic epitope (epitope ID 1329489) tested in 2 MHC ligand assays.	IEDB	1329489	447	459	GNYNYLYRLFRKS	ECO:0000213	PubMed	33220791
P0DTC2	GNYNYLYRLFRKSN is a linear peptidic epitope (epitope ID 1329490) tested in 1 MHC ligand assay.	IEDB	1329490	447	460	GNYNYLYRLFRKSN	ECO:0000213	PubMed	33220791
P0DTC2	GNYNYLYRLFRKSNL is a linear peptidic epitope (epitope ID 1329491) tested in 2 T cell assays, 7 B cell assays and 8 MHC ligand assays.	IEDB	1329491	447	461	GNYNYLYRLFRKSNL	ECO:0000213	PubMed	34805136
P0DTC2	GNYNYLYRLFRKSNL is a linear peptidic epitope (epitope ID 1329491) tested in 2 T cell assays, 7 B cell assays and 8 MHC ligand assays.	IEDB	1329491	447	461	GNYNYLYRLFRKSNL	ECO:0000213	PubMed	33220791
P0DTC2	GSNVFQTRAGCLIG is a linear peptidic epitope (epitope ID 1329511) tested in 1 MHC ligand assay.	IEDB	1329511	639	652	GSNVFQTRAGCLIG	ECO:0000213	PubMed	33220791
P0DTC2	GTHWFVTQRNFYEP is a linear peptidic epitope (epitope ID 1329515) tested in 1 MHC ligand assay.	IEDB	1329515	1099	1112	GTHWFVTQRNFYEP	ECO:0000213	PubMed	33220791
P0DTC2	GTHWFVTQRNFYEPQ is a linear peptidic epitope (epitope ID 1329517) tested in 10 B cell assays and 10 MHC ligand assays.	IEDB	1329517	1099	1113	GTHWFVTQRNFYEPQ	ECO:0000213	PubMed	34004174
P0DTC2	GTHWFVTQRNFYEPQ is a linear peptidic epitope (epitope ID 1329517) tested in 10 B cell assays and 10 MHC ligand assays.	IEDB	1329517	1099	1113	GTHWFVTQRNFYEPQ	ECO:0000213	PubMed	33220791
P0DTC2	GVYYPDKVFRSSVL is a linear peptidic epitope (epitope ID 1329529) tested in 3 MHC ligand assays.	IEDB	1329529	35	48	GVYYPDKVFRSSVL	ECO:0000213	PubMed	34004174
P0DTC2	GVYYPDKVFRSSVL is a linear peptidic epitope (epitope ID 1329529) tested in 3 MHC ligand assays.	IEDB	1329529	35	48	GVYYPDKVFRSSVL	ECO:0000213	PubMed	38117652
P0DTC2	GVYYPDKVFRSSVL is a linear peptidic epitope (epitope ID 1329529) tested in 3 MHC ligand assays.	IEDB	1329529	35	48	GVYYPDKVFRSSVL	ECO:0000213	PubMed	33220791
P0DTC2	GVYYPDKVFRSSVLH is a linear peptidic epitope (epitope ID 1329530) tested in 4 B cell assays and 12 MHC ligand assays.	IEDB	1329530	35	49	GVYYPDKVFRSSVLH	ECO:0000213	PubMed	34004174
P0DTC2	GVYYPDKVFRSSVLH is a linear peptidic epitope (epitope ID 1329530) tested in 4 B cell assays and 12 MHC ligand assays.	IEDB	1329530	35	49	GVYYPDKVFRSSVLH	ECO:0000213	PubMed	33220791
P0DTC2	GYFKIYSKHTPI is a linear peptidic epitope (epitope ID 1329533) tested in 8 B cell assays and 1 MHC ligand assay.	IEDB	1329533	199	210	GYFKIYSKHTPI	ECO:0000213	PubMed	33220791
P0DTC2	GYFKIYSKHTPIN is a linear peptidic epitope (epitope ID 1329534) tested in 1 MHC ligand assay.	IEDB	1329534	199	211	GYFKIYSKHTPIN	ECO:0000213	PubMed	33220791
P0DTC2	HTPINLVRDLPQ is a linear peptidic epitope (epitope ID 1329551) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1329551	207	218	HTPINLVRDLPQ	ECO:0000213	PubMed	33220791
P0DTC2	HTPINLVRDLPQGF is a linear peptidic epitope (epitope ID 1329552) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1329552	207	220	HTPINLVRDLPQGF	ECO:0000213	PubMed	33220791
P0DTC2	HWFVTQRNFYEP is a linear peptidic epitope (epitope ID 1329557) tested in 8 B cell assays and 1 MHC ligand assay.	IEDB	1329557	1101	1112	HWFVTQRNFYEP	ECO:0000213	PubMed	33220791
P0DTC2	HWFVTQRNFYEPQ is a linear peptidic epitope (epitope ID 1329558) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1329558	1101	1113	HWFVTQRNFYEPQ	ECO:0000213	PubMed	33220791
P0DTC2	IANQFNSAIGKIQDS is a linear peptidic epitope (epitope ID 1329561) tested in 4 B cell assays and 8 MHC ligand assays.	IEDB	1329561	923	937	IANQFNSAIGKIQDS	ECO:0000213	PubMed	33220791
P0DTC2	IAQYTSALL is a linear peptidic epitope (epitope ID 1329562) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1329562	870	878	IAQYTSALL	ECO:0000213	PubMed	34647971
P0DTC2	IAQYTSALL is a linear peptidic epitope (epitope ID 1329562) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1329562	870	878	IAQYTSALL	ECO:0000213	PubMed	33220791
P0DTC2	IAQYTSALLA is a linear peptidic epitope (epitope ID 1329563) tested in 1 MHC ligand assay.	IEDB	1329563	870	879	IAQYTSALLA	ECO:0000213	PubMed	33220791
P0DTC2	IAQYTSALLAG is a linear peptidic epitope (epitope ID 1329564) tested in 1 MHC ligand assay.	IEDB	1329564	870	880	IAQYTSALLAG	ECO:0000213	PubMed	33220791
P0DTC2	IAQYTSALLAGT is a linear peptidic epitope (epitope ID 1329565) tested in 5 B cell assays and 1 MHC ligand assay.	IEDB	1329565	870	881	IAQYTSALLAGT	ECO:0000213	PubMed	33220791
P0DTC2	IAQYTSALLAGTI is a linear peptidic epitope (epitope ID 1329566) tested in 1 MHC ligand assay.	IEDB	1329566	870	882	IAQYTSALLAGTI	ECO:0000213	PubMed	33220791
P0DTC2	IAQYTSALLAGTIT is a linear peptidic epitope (epitope ID 1329567) tested in 1 MHC ligand assay.	IEDB	1329567	870	883	IAQYTSALLAGTIT	ECO:0000213	PubMed	33220791
P0DTC2	IDGYFKIYSKHTPI is a linear peptidic epitope (epitope ID 1329568) tested in 1 MHC ligand assay.	IEDB	1329568	197	210	IDGYFKIYSKHTPI	ECO:0000213	PubMed	33220791
P0DTC2	IDRLITGRLQ is a linear peptidic epitope (epitope ID 1329570) tested in 1 MHC ligand assay.	IEDB	1329570	993	1002	IDRLITGRLQ	ECO:0000213	PubMed	33220791
P0DTC2	IDRLITGRLQSLQ is a linear peptidic epitope (epitope ID 1329571) tested in 1 MHC ligand assay.	IEDB	1329571	993	1005	IDRLITGRLQSLQ	ECO:0000213	PubMed	33220791
P0DTC2	IDRLITGRLQSLQT is a linear peptidic epitope (epitope ID 1329572) tested in 1 MHC ligand assay.	IEDB	1329572	993	1006	IDRLITGRLQSLQT	ECO:0000213	PubMed	33220791
P0DTC2	INASVVNIQKEIDR is a linear peptidic epitope (epitope ID 1329583) tested in 1 MHC ligand assay.	IEDB	1329583	1172	1185	INASVVNIQKEIDR	ECO:0000213	PubMed	33220791
P0DTC2	IPFAMQMAYRFNG is a linear peptidic epitope (epitope ID 1329590) tested in 1 T cell assay and 2 MHC ligand assays.	IEDB	1329590	896	908	IPFAMQMAYRFNG	ECO:0000213	PubMed	35857584
P0DTC2	IPFAMQMAYRFNG is a linear peptidic epitope (epitope ID 1329590) tested in 1 T cell assay and 2 MHC ligand assays.	IEDB	1329590	896	908	IPFAMQMAYRFNG	ECO:0000213	PubMed	38117652
P0DTC2	IPFAMQMAYRFNG is a linear peptidic epitope (epitope ID 1329590) tested in 1 T cell assay and 2 MHC ligand assays.	IEDB	1329590	896	908	IPFAMQMAYRFNG	ECO:0000213	PubMed	33220791
P0DTC2	ISGINASVVNIQK is a linear peptidic epitope (epitope ID 1329598) tested in 1 MHC ligand assay.	IEDB	1329598	1169	1181	ISGINASVVNIQK	ECO:0000213	PubMed	33220791
P0DTC2	ISGINASVVNIQKE is a linear peptidic epitope (epitope ID 1329599) tested in 1 MHC ligand assay.	IEDB	1329599	1169	1182	ISGINASVVNIQKE	ECO:0000213	PubMed	33220791
P0DTC2	ISTEIYQAGSTPC is a linear peptidic epitope (epitope ID 1329601) tested in 1 MHC ligand assay.	IEDB	1329601	468	480	ISTEIYQAGSTPC	ECO:0000213	PubMed	33220791
P0DTC2	ISTEIYQAGSTPCN is a linear peptidic epitope (epitope ID 1329602) tested in 1 MHC ligand assay.	IEDB	1329602	468	481	ISTEIYQAGSTPCN	ECO:0000213	PubMed	33220791
P0DTC2	ISTEIYQAGSTPCNG is a linear peptidic epitope (epitope ID 1329604) tested in 11 MHC ligand assays.	IEDB	1329604	468	482	ISTEIYQAGSTPCNG	ECO:0000213	PubMed	33220791
P0DTC2	ITDAVDCALDPLSE is a linear peptidic epitope (epitope ID 1329606) tested in 1 MHC ligand assay.	IEDB	1329606	285	298	ITDAVDCALDPLSE	ECO:0000213	PubMed	33220791
P0DTC2	ITRFQTLLALHRS is a linear peptidic epitope (epitope ID 1329609) tested in 1 MHC ligand assay.	IEDB	1329609	235	247	ITRFQTLLALHRS	ECO:0000213	PubMed	33220791
P0DTC2	ITRFQTLLALHRSY is a linear peptidic epitope (epitope ID 1329610) tested in 1 MHC ligand assay.	IEDB	1329610	235	248	ITRFQTLLALHRSY	ECO:0000213	PubMed	33220791
P0DTC2	KGIYQTSNFRVQP is a linear peptidic epitope (epitope ID 1329623) tested in 1 MHC ligand assay.	IEDB	1329623	310	322	KGIYQTSNFRVQP	ECO:0000213	PubMed	33220791
P0DTC2	KGIYQTSNFRVQPT is a linear peptidic epitope (epitope ID 1329624) tested in 2 MHC ligand assays.	IEDB	1329624	310	323	KGIYQTSNFRVQPT	ECO:0000213	PubMed	34004174
P0DTC2	KGIYQTSNFRVQPT is a linear peptidic epitope (epitope ID 1329624) tested in 2 MHC ligand assays.	IEDB	1329624	310	323	KGIYQTSNFRVQPT	ECO:0000213	PubMed	33220791
P0DTC2	KGIYQTSNFRVQPTE is a linear peptidic epitope (epitope ID 1329625) tested in 6 B cell assays and 10 MHC ligand assays.	IEDB	1329625	310	324	KGIYQTSNFRVQPTE	ECO:0000213	PubMed	34004174
P0DTC2	KGIYQTSNFRVQPTE is a linear peptidic epitope (epitope ID 1329625) tested in 6 B cell assays and 10 MHC ligand assays.	IEDB	1329625	310	324	KGIYQTSNFRVQPTE	ECO:0000213	PubMed	33220791
P0DTC2	KHTPINLVRDLPQG is a linear peptidic epitope (epitope ID 1329627) tested in 1 MHC ligand assay.	IEDB	1329627	206	219	KHTPINLVRDLPQG	ECO:0000213	PubMed	33220791
P0DTC2	KKFLPFQQFGRDI is a linear peptidic epitope (epitope ID 1329628) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1329628	557	569	KKFLPFQQFGRDI	ECO:0000213	PubMed	33220791
P0DTC2	KKFLPFQQFGRDIA is a linear peptidic epitope (epitope ID 1329629) tested in 1 MHC ligand assay.	IEDB	1329629	557	570	KKFLPFQQFGRDIA	ECO:0000213	PubMed	33220791
P0DTC2	KLIANQFNSAIG is a linear peptidic epitope (epitope ID 1329631) tested in 8 B cell assays and 1 MHC ligand assay.	IEDB	1329631	921	932	KLIANQFNSAIG	ECO:0000213	PubMed	33220791
P0DTC2	KVFRSSVLHSTQD is a linear peptidic epitope (epitope ID 1329653) tested in 1 MHC ligand assay.	IEDB	1329653	41	53	KVFRSSVLHSTQD	ECO:0000213	PubMed	33220791
P0DTC2	LGKYEQYIKWP is a linear peptidic epitope (epitope ID 1329668) tested in 1 MHC ligand assay.	IEDB	1329668	1203	1213	LGKYEQYIKWP	ECO:0000213	PubMed	33220791
P0DTC2	LIRAAEIRASA is a linear peptidic epitope (epitope ID 1329676) tested in 2 MHC ligand assays.	IEDB	1329676	1012	1022	LIRAAEIRASA	ECO:0000213	PubMed	38117652
P0DTC2	LIRAAEIRASA is a linear peptidic epitope (epitope ID 1329676) tested in 2 MHC ligand assays.	IEDB	1329676	1012	1022	LIRAAEIRASA	ECO:0000213	PubMed	33220791
P0DTC2	LIRAAEIRASAN is a linear peptidic epitope (epitope ID 1329677) tested in 6 B cell assays and 2 MHC ligand assays.	IEDB	1329677	1012	1023	LIRAAEIRASAN	ECO:0000213	PubMed	38117652
P0DTC2	LIRAAEIRASAN is a linear peptidic epitope (epitope ID 1329677) tested in 6 B cell assays and 2 MHC ligand assays.	IEDB	1329677	1012	1023	LIRAAEIRASAN	ECO:0000213	PubMed	33220791
P0DTC2	LIRAAEIRASANL is a linear peptidic epitope (epitope ID 1329678) tested in 2 MHC ligand assays.	IEDB	1329678	1012	1024	LIRAAEIRASANL	ECO:0000213	PubMed	38117652
P0DTC2	LIRAAEIRASANL is a linear peptidic epitope (epitope ID 1329678) tested in 2 MHC ligand assays.	IEDB	1329678	1012	1024	LIRAAEIRASANL	ECO:0000213	PubMed	33220791
P0DTC2	LKPFERDISTEIYQ is a linear peptidic epitope (epitope ID 1329682) tested in 2 MHC ligand assays.	IEDB	1329682	461	474	LKPFERDISTEIYQ	ECO:0000213	PubMed	34004174
P0DTC2	LKPFERDISTEIYQ is a linear peptidic epitope (epitope ID 1329682) tested in 2 MHC ligand assays.	IEDB	1329682	461	474	LKPFERDISTEIYQ	ECO:0000213	PubMed	33220791
P0DTC2	LKSFTVEKGIYQT is a linear peptidic epitope (epitope ID 1329683) tested in 1 MHC ligand assay.	IEDB	1329683	303	315	LKSFTVEKGIYQT	ECO:0000213	PubMed	33220791
P0DTC2	LKSFTVEKGIYQTS is a linear peptidic epitope (epitope ID 1329684) tested in 1 MHC ligand assay.	IEDB	1329684	303	316	LKSFTVEKGIYQTS	ECO:0000213	PubMed	33220791
P0DTC2	LKSFTVEKGIYQTSN is a linear peptidic epitope (epitope ID 1329685) tested in 4 B cell assays and 9 MHC ligand assays.	IEDB	1329685	303	317	LKSFTVEKGIYQTSN	ECO:0000213	PubMed	33220791
P0DTC2	LLLQYGSFCTQLNR is a linear peptidic epitope (epitope ID 1329692) tested in 1 MHC ligand assay.	IEDB	1329692	752	765	LLLQYGSFCTQLNR	ECO:0000213	PubMed	33220791
P0DTC2	LLQYGSFCTQLNR is a linear peptidic epitope (epitope ID 1329694) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1329694	753	765	LLQYGSFCTQLNR	ECO:0000213	PubMed	33220791
P0DTC2	LNRALTGIAVEQDK is a linear peptidic epitope (epitope ID 1329698) tested in 2 MHC ligand assays.	IEDB	1329698	763	776	LNRALTGIAVEQDK	ECO:0000213	PubMed	34004174
P0DTC2	LNRALTGIAVEQDK is a linear peptidic epitope (epitope ID 1329698) tested in 2 MHC ligand assays.	IEDB	1329698	763	776	LNRALTGIAVEQDK	ECO:0000213	PubMed	33220791
P0DTC2	LPQGFSALEPLVD is a linear peptidic epitope (epitope ID 1329716) tested in 1 MHC ligand assay.	IEDB	1329716	216	228	LPQGFSALEPLVD	ECO:0000213	PubMed	33220791
P0DTC2	LQYGSFCTQLNR is a linear peptidic epitope (epitope ID 1329725) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1329725	754	765	LQYGSFCTQLNR	ECO:0000213	PubMed	33220791
P0DTC2	LREFVFKNIDGYFK is a linear peptidic epitope (epitope ID 1329728) tested in 2 MHC ligand assays.	IEDB	1329728	189	202	LREFVFKNIDGYFK	ECO:0000213	PubMed	38117652
P0DTC2	LREFVFKNIDGYFK is a linear peptidic epitope (epitope ID 1329728) tested in 2 MHC ligand assays.	IEDB	1329728	189	202	LREFVFKNIDGYFK	ECO:0000213	PubMed	33220791
P0DTC2	LTPTWRVYSTGSN is a linear peptidic epitope (epitope ID 1329744) tested in 1 MHC ligand assay.	IEDB	1329744	629	641	LTPTWRVYSTGSN	ECO:0000213	PubMed	33220791
P0DTC2	MIAQYTSALLAG is a linear peptidic epitope (epitope ID 1329762) tested in 8 B cell assays and 1 MHC ligand assay.	IEDB	1329762	869	880	MIAQYTSALLAG	ECO:0000213	PubMed	33220791
P0DTC2	MIAQYTSALLAGT is a linear peptidic epitope (epitope ID 1329764) tested in 1 MHC ligand assay.	IEDB	1329764	869	881	MIAQYTSALLAGT	ECO:0000213	PubMed	33220791
P0DTC2	NAQALNTLVKQLSS is a linear peptidic epitope (epitope ID 1329784) tested in 1 MHC ligand assay.	IEDB	1329784	955	968	NAQALNTLVKQLSS	ECO:0000213	PubMed	33220791
P0DTC2	NAQALNTLVKQLSSN is a linear peptidic epitope (epitope ID 1329785) tested in 10 B cell assays and 11 MHC ligand assays.	IEDB	1329785	955	969	NAQALNTLVKQLSSN	ECO:0000213	PubMed	34004174
P0DTC2	NAQALNTLVKQLSSN is a linear peptidic epitope (epitope ID 1329785) tested in 10 B cell assays and 11 MHC ligand assays.	IEDB	1329785	955	969	NAQALNTLVKQLSSN	ECO:0000213	PubMed	33220791
P0DTC2	NDILSRLDKVEAEVQ is a linear peptidic epitope (epitope ID 1329793) tested in 11 MHC ligand assays.	IEDB	1329793	978	992	NDILSRLDKVEAEVQ	ECO:0000213	PubMed	33220791
P0DTC2	NGLTGTGVLTESNK is a linear peptidic epitope (epitope ID 1329797) tested in 1 MHC ligand assay.	IEDB	1329797	544	557	NGLTGTGVLTESNK	ECO:0000213	PubMed	33220791
P0DTC2	NGLTGTGVLTESNKK is a linear peptidic epitope (epitope ID 1329798) tested in 6 B cell assays and 8 MHC ligand assays.	IEDB	1329798	544	558	NGLTGTGVLTESNKK	ECO:0000213	PubMed	33220791
P0DTC2	NKKFLPFQQFGRDI is a linear peptidic epitope (epitope ID 1329811) tested in 1 MHC ligand assay.	IEDB	1329811	556	569	NKKFLPFQQFGRDI	ECO:0000213	PubMed	33220791
P0DTC2	NLKPFERDISTEIYQ is a linear peptidic epitope (epitope ID 1329813) tested in 3 T cell assays, 8 B cell assays and 10 MHC ligand assays.	IEDB	1329813	460	474	NLKPFERDISTEIYQ	ECO:0000213	PubMed	34004174
P0DTC2	NLKPFERDISTEIYQ is a linear peptidic epitope (epitope ID 1329813) tested in 3 T cell assays, 8 B cell assays and 10 MHC ligand assays.	IEDB	1329813	460	474	NLKPFERDISTEIYQ	ECO:0000213	PubMed	33220791
P0DTC2	NQKLIANQFNSAIG is a linear peptidic epitope (epitope ID 1329818) tested in 1 MHC ligand assay.	IEDB	1329818	919	932	NQKLIANQFNSAIG	ECO:0000213	PubMed	33220791
P0DTC2	NQKLIANQFNSAIGK is a linear peptidic epitope (epitope ID 1329819) tested in 10 B cell assays and 11 MHC ligand assays.	IEDB	1329819	919	933	NQKLIANQFNSAIGK	ECO:0000213	PubMed	33220791
P0DTC2	NRALTGIAVEQDK is a linear peptidic epitope (epitope ID 1329821) tested in 1 MHC ligand assay.	IEDB	1329821	764	776	NRALTGIAVEQDK	ECO:0000213	PubMed	33220791
P0DTC2	NRALTGIAVEQDKN is a linear peptidic epitope (epitope ID 1329822) tested in 2 MHC ligand assays.	IEDB	1329822	764	777	NRALTGIAVEQDKN	ECO:0000213	PubMed	38117652
P0DTC2	NRALTGIAVEQDKN is a linear peptidic epitope (epitope ID 1329822) tested in 2 MHC ligand assays.	IEDB	1329822	764	777	NRALTGIAVEQDKN	ECO:0000213	PubMed	33220791
P0DTC2	NRALTGIAVEQDKNT is a linear peptidic epitope (epitope ID 1329823) tested in 2 B cell assays and 9 MHC ligand assays.	IEDB	1329823	764	778	NRALTGIAVEQDKNT	ECO:0000213	PubMed	38117652
P0DTC2	NRALTGIAVEQDKNT is a linear peptidic epitope (epitope ID 1329823) tested in 2 B cell assays and 9 MHC ligand assays.	IEDB	1329823	764	778	NRALTGIAVEQDKNT	ECO:0000213	PubMed	33220791
P0DTC2	NSAIGKIQDSLSS is a linear peptidic epitope (epitope ID 1329826) tested in 1 MHC ligand assay.	IEDB	1329826	928	940	NSAIGKIQDSLSS	ECO:0000213	PubMed	33220791
P0DTC2	NSAIGKIQDSLSST is a linear peptidic epitope (epitope ID 1329827) tested in 1 MHC ligand assay.	IEDB	1329827	928	941	NSAIGKIQDSLSST	ECO:0000213	PubMed	33220791
P0DTC2	NSAIGKIQDSLSSTA is a linear peptidic epitope (epitope ID 1329828) tested in 3 T cell assays, 6 B cell assays and 11 MHC ligand assays.	IEDB	1329828	928	942	NSAIGKIQDSLSSTA	ECO:0000213	PubMed	33220791
P0DTC2	NSASFSTFKCYGVSP is a linear peptidic epitope (epitope ID 1329829) tested in 8 B cell assays and 10 MHC ligand assays.	IEDB	1329829	370	384	NSASFSTFKCYGVSP	ECO:0000213	PubMed	33220791
P0DTC2	NSASFSTFKCYGVSPTKL is a linear peptidic epitope (epitope ID 1329833) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1329833	370	387	NSASFSTFKCYGVSPTKL	ECO:0000213	PubMed	35474581
P0DTC2	NTLVKQLSSNFG is a linear peptidic epitope (epitope ID 1329846) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1329846	960	971	NTLVKQLSSNFG	ECO:0000213	PubMed	33220791
P0DTC2	NTLVKQLSSNFGA is a linear peptidic epitope (epitope ID 1329847) tested in 1 MHC ligand assay.	IEDB	1329847	960	972	NTLVKQLSSNFGA	ECO:0000213	PubMed	33220791
P0DTC2	NTLVKQLSSNFGAI is a linear peptidic epitope (epitope ID 1329848) tested in 2 MHC ligand assays.	IEDB	1329848	960	973	NTLVKQLSSNFGAI	ECO:0000213	PubMed	34004174
P0DTC2	NTLVKQLSSNFGAI is a linear peptidic epitope (epitope ID 1329848) tested in 2 MHC ligand assays.	IEDB	1329848	960	973	NTLVKQLSSNFGAI	ECO:0000213	PubMed	33220791
P0DTC2	NTLVKQLSSNFGAIS is a linear peptidic epitope (epitope ID 1329849) tested in 12 MHC ligand assays.	IEDB	1329849	960	974	NTLVKQLSSNFGAIS	ECO:0000213	PubMed	34004174
P0DTC2	NTLVKQLSSNFGAIS is a linear peptidic epitope (epitope ID 1329849) tested in 12 MHC ligand assays.	IEDB	1329849	960	974	NTLVKQLSSNFGAIS	ECO:0000213	PubMed	33220791
P0DTC2	NTQEVFAQVKQIYK is a linear peptidic epitope (epitope ID 1329851) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1329851	777	790	NTQEVFAQVKQIYK	ECO:0000213	PubMed	33220791
P0DTC2	NVYADSFVIRGDEV is a linear peptidic epitope (epitope ID 1329859) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1329859	394	407	NVYADSFVIRGDEV	ECO:0000213	PubMed	33220791
P0DTC2	NYLYRLFRKSNLKP is a linear peptidic epitope (epitope ID 1329861) tested in 1 MHC ligand assay.	IEDB	1329861	450	463	NYLYRLFRKSNLKP	ECO:0000213	PubMed	33220791
P0DTC2	NYLYRLFRKSNLKPF is a linear peptidic epitope (epitope ID 1329862) tested in 3 T cell assays and 8 MHC ligand assays.	IEDB	1329862	450	464	NYLYRLFRKSNLKPF	ECO:0000213	PubMed	33220791
P0DTC2	NYLYRLFRKSNLKPF is a linear peptidic epitope (epitope ID 1329862) tested in 3 T cell assays and 8 MHC ligand assays.	IEDB	1329862	450	464	NYLYRLFRKSNLKPF	ECO:0000213	PubMed	35699447
P0DTC2	NYNYLYRLFRKSNL is a linear peptidic epitope (epitope ID 1329864) tested in 1 MHC ligand assay.	IEDB	1329864	448	461	NYNYLYRLFRKSNL	ECO:0000213	PubMed	33220791
P0DTC2	NYNYLYRLFRKSNLK is a linear peptidic epitope (epitope ID 1329865) tested in 3 T cell assays, 8 B cell assays and 8 MHC ligand assays.	IEDB	1329865	448	462	NYNYLYRLFRKSNLK	ECO:0000213	PubMed	33220791
P0DTC2	QEVFAQVKQIYKTPP is a linear peptidic epitope (epitope ID 1329937) tested in 4 B cell assays and 8 MHC ligand assays.	IEDB	1329937	779	793	QEVFAQVKQIYKTPP	ECO:0000213	PubMed	33220791
P0DTC2	QIDRLITGRLQSLQT is a linear peptidic epitope (epitope ID 1329940) tested in 3 T cell assays, 8 B cell assays and 9 MHC ligand assays.	IEDB	1329940	992	1006	QIDRLITGRLQSLQT	ECO:0000213	PubMed	33220791
P0DTC2	QIPFAMQMAYRFN is a linear peptidic epitope (epitope ID 1329942) tested in 2 MHC ligand assays.	IEDB	1329942	895	907	QIPFAMQMAYRFN	ECO:0000213	PubMed	38117652
P0DTC2	QIPFAMQMAYRFN is a linear peptidic epitope (epitope ID 1329942) tested in 2 MHC ligand assays.	IEDB	1329942	895	907	QIPFAMQMAYRFN	ECO:0000213	PubMed	33220791
P0DTC2	QIPFAMQMAYRFNG is a linear peptidic epitope (epitope ID 1329944) tested in 2 MHC ligand assays.	IEDB	1329944	895	908	QIPFAMQMAYRFNG	ECO:0000213	PubMed	38117652
P0DTC2	QIPFAMQMAYRFNG is a linear peptidic epitope (epitope ID 1329944) tested in 2 MHC ligand assays.	IEDB	1329944	895	908	QIPFAMQMAYRFNG	ECO:0000213	PubMed	33220791
P0DTC2	QKLIANQFNSA is a linear peptidic epitope (epitope ID 1329945) tested in 1 MHC ligand assay.	IEDB	1329945	920	930	QKLIANQFNSA	ECO:0000213	PubMed	33220791
P0DTC2	QKLIANQFNSAIG is a linear peptidic epitope (epitope ID 1329947) tested in 1 MHC ligand assay.	IEDB	1329947	920	932	QKLIANQFNSAIG	ECO:0000213	PubMed	33220791
P0DTC2	QLIRAAEIRASAN is a linear peptidic epitope (epitope ID 1329948) tested in 1 MHC ligand assay.	IEDB	1329948	1011	1023	QLIRAAEIRASAN	ECO:0000213	PubMed	33220791
P0DTC2	QLIRAAEIRASANL is a linear peptidic epitope (epitope ID 1329949) tested in 1 MHC ligand assay.	IEDB	1329949	1011	1024	QLIRAAEIRASANL	ECO:0000213	PubMed	33220791
P0DTC2	QLNRALTGIAVEQ is a linear peptidic epitope (epitope ID 1329950) tested in 1 MHC ligand assay.	IEDB	1329950	762	774	QLNRALTGIAVEQ	ECO:0000213	PubMed	33220791
P0DTC2	QLNRALTGIAVEQD is a linear peptidic epitope (epitope ID 1329951) tested in 1 MHC ligand assay.	IEDB	1329951	762	775	QLNRALTGIAVEQD	ECO:0000213	PubMed	33220791
P0DTC2	QLNRALTGIAVEQDK is a linear peptidic epitope (epitope ID 1329952) tested in 9 B cell assays and 11 MHC ligand assays.	IEDB	1329952	762	776	QLNRALTGIAVEQDK	ECO:0000213	PubMed	33220791
P0DTC2	QLSSNFGAISSVLN is a linear peptidic epitope (epitope ID 1329953) tested in 1 MHC ligand assay.	IEDB	1329953	965	978	QLSSNFGAISSVLN	ECO:0000213	PubMed	33220791
P0DTC2	QNVLYENQKLIAN is a linear peptidic epitope (epitope ID 1329957) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1329957	913	925	QNVLYENQKLIAN	ECO:0000213	PubMed	33220791
P0DTC2	QNVLYENQKLIANQ is a linear peptidic epitope (epitope ID 1329959) tested in 1 MHC ligand assay.	IEDB	1329959	913	926	QNVLYENQKLIANQ	ECO:0000213	PubMed	33220791
P0DTC2	QQLIRAAEIRASAN is a linear peptidic epitope (epitope ID 1329967) tested in 2 MHC ligand assays.	IEDB	1329967	1010	1023	QQLIRAAEIRASAN	ECO:0000213	PubMed	38117652
P0DTC2	QQLIRAAEIRASAN is a linear peptidic epitope (epitope ID 1329967) tested in 2 MHC ligand assays.	IEDB	1329967	1010	1023	QQLIRAAEIRASAN	ECO:0000213	PubMed	33220791
P0DTC2	QSIIAYTMSLGAE is a linear peptidic epitope (epitope ID 1329969) tested in 1 MHC ligand assay.	IEDB	1329969	690	702	QSIIAYTMSLGAE	ECO:0000213	PubMed	33220791
P0DTC2	QTLLALHRSYLTPG is a linear peptidic epitope (epitope ID 1329971) tested in 1 MHC ligand assay.	IEDB	1329971	239	252	QTLLALHRSYLTPG	ECO:0000213	PubMed	33220791
P0DTC2	RDIADTTDAVRDPQ is a linear peptidic epitope (epitope ID 1329986) tested in 1 MHC ligand assay.	IEDB	1329986	567	580	RDIADTTDAVRDPQ	ECO:0000213	PubMed	33220791
P0DTC2	REFVFKNIDGYFK is a linear peptidic epitope (epitope ID 1329992) tested in 2 MHC ligand assays.	IEDB	1329992	190	202	REFVFKNIDGYFK	ECO:0000213	PubMed	38117652
P0DTC2	REFVFKNIDGYFK is a linear peptidic epitope (epitope ID 1329992) tested in 2 MHC ligand assays.	IEDB	1329992	190	202	REFVFKNIDGYFK	ECO:0000213	PubMed	33220791
P0DTC2	REFVFKNIDGYFKI is a linear peptidic epitope (epitope ID 1329993) tested in 2 MHC ligand assays.	IEDB	1329993	190	203	REFVFKNIDGYFKI	ECO:0000213	PubMed	38117652
P0DTC2	REFVFKNIDGYFKI is a linear peptidic epitope (epitope ID 1329993) tested in 2 MHC ligand assays.	IEDB	1329993	190	203	REFVFKNIDGYFKI	ECO:0000213	PubMed	33220791
P0DTC2	REFVFKNIDGYFKIY is a linear peptidic epitope (epitope ID 1329994) tested in 3 T cell assays, 6 B cell assays and 9 MHC ligand assays.	IEDB	1329994	190	204	REFVFKNIDGYFKIY	ECO:0000213	PubMed	38117652
P0DTC2	REFVFKNIDGYFKIY is a linear peptidic epitope (epitope ID 1329994) tested in 3 T cell assays, 6 B cell assays and 9 MHC ligand assays.	IEDB	1329994	190	204	REFVFKNIDGYFKIY	ECO:0000213	PubMed	33220791
P0DTC2	RGVYYPDKVFR is a linear peptidic epitope (epitope ID 1330003) tested in 2 MHC ligand assays.	IEDB	1330003	34	44	RGVYYPDKVFR	ECO:0000213	PubMed	34004174
P0DTC2	RGVYYPDKVFR is a linear peptidic epitope (epitope ID 1330003) tested in 2 MHC ligand assays.	IEDB	1330003	34	44	RGVYYPDKVFR	ECO:0000213	PubMed	33220791
P0DTC2	RGVYYPDKVFRS is a linear peptidic epitope (epitope ID 1330004) tested in 3 B cell assays and 2 MHC ligand assays.	IEDB	1330004	34	45	RGVYYPDKVFRS	ECO:0000213	PubMed	34004174
P0DTC2	RGVYYPDKVFRS is a linear peptidic epitope (epitope ID 1330004) tested in 3 B cell assays and 2 MHC ligand assays.	IEDB	1330004	34	45	RGVYYPDKVFRS	ECO:0000213	PubMed	33220791
P0DTC2	RGVYYPDKVFRSS is a linear peptidic epitope (epitope ID 1330005) tested in 2 MHC ligand assays.	IEDB	1330005	34	46	RGVYYPDKVFRSS	ECO:0000213	PubMed	34004174
P0DTC2	RGVYYPDKVFRSS is a linear peptidic epitope (epitope ID 1330005) tested in 2 MHC ligand assays.	IEDB	1330005	34	46	RGVYYPDKVFRSS	ECO:0000213	PubMed	33220791
P0DTC2	RGVYYPDKVFRSSVL is a linear peptidic epitope (epitope ID 1330006) tested in 6 B cell assays and 11 MHC ligand assays.	IEDB	1330006	34	48	RGVYYPDKVFRSSVL	ECO:0000213	PubMed	34004174
P0DTC2	RGVYYPDKVFRSSVL is a linear peptidic epitope (epitope ID 1330006) tested in 6 B cell assays and 11 MHC ligand assays.	IEDB	1330006	34	48	RGVYYPDKVFRSSVL	ECO:0000213	PubMed	33220791
P0DTC2	RSFIEDLLFNKVT is a linear peptidic epitope (epitope ID 1330028) tested in 13 T cell assays and 1 MHC ligand assay.	IEDB	1330028	815	827	RSFIEDLLFNKVT	ECO:0000213	PubMed	35061630
P0DTC2	RSFIEDLLFNKVT is a linear peptidic epitope (epitope ID 1330028) tested in 13 T cell assays and 1 MHC ligand assay.	IEDB	1330028	815	827	RSFIEDLLFNKVT	ECO:0000213	PubMed	33220791
P0DTC2	RSFIEDLLFNKVTL is a linear peptidic epitope (epitope ID 1330029) tested in 1 MHC ligand assay.	IEDB	1330029	815	828	RSFIEDLLFNKVTL	ECO:0000213	PubMed	33220791
P0DTC2	RSFIEDLLFNKVTLA is a linear peptidic epitope (epitope ID 1330030) tested in 8 T cell assays, 4 B cell assays and 11 MHC ligand assays.	IEDB	1330030	815	829	RSFIEDLLFNKVTLA	ECO:0000213	PubMed	35675811
P0DTC2	RSFIEDLLFNKVTLA is a linear peptidic epitope (epitope ID 1330030) tested in 8 T cell assays, 4 B cell assays and 11 MHC ligand assays.	IEDB	1330030	815	829	RSFIEDLLFNKVTLA	ECO:0000213	PubMed	38105139
P0DTC2	RSFIEDLLFNKVTLA is a linear peptidic epitope (epitope ID 1330030) tested in 8 T cell assays, 4 B cell assays and 11 MHC ligand assays.	IEDB	1330030	815	829	RSFIEDLLFNKVTLA	ECO:0000213	PubMed	33220791
P0DTC2	SAIGKIQDSLSS is a linear peptidic epitope (epitope ID 1330044) tested in 5 B cell assays and 1 MHC ligand assay.	IEDB	1330044	929	940	SAIGKIQDSLSS	ECO:0000213	PubMed	33220791
P0DTC2	SAIGKIQDSLSST is a linear peptidic epitope (epitope ID 1330045) tested in 1 MHC ligand assay.	IEDB	1330045	929	941	SAIGKIQDSLSST	ECO:0000213	PubMed	33220791
P0DTC2	SAIGKIQDSLSSTA is a linear peptidic epitope (epitope ID 1330046) tested in 1 MHC ligand assay.	IEDB	1330046	929	942	SAIGKIQDSLSSTA	ECO:0000213	PubMed	33220791
P0DTC2	SASFSTFKCYG is a linear peptidic epitope (epitope ID 1330049) tested in 1 MHC ligand assay.	IEDB	1330049	371	381	SASFSTFKCYG	ECO:0000213	PubMed	33220791
P0DTC2	SASFSTFKCYGVSP is a linear peptidic epitope (epitope ID 1330050) tested in 1 MHC ligand assay.	IEDB	1330050	371	384	SASFSTFKCYGVSP	ECO:0000213	PubMed	33220791
P0DTC2	SFIEDLLFNKVT is a linear peptidic epitope (epitope ID 1330061) tested in 4 B cell assays and 1 MHC ligand assay.	IEDB	1330061	816	827	SFIEDLLFNKVT	ECO:0000213	PubMed	33220791
P0DTC2	SFSTFKCYGVSPT is a linear peptidic epitope (epitope ID 1330063) tested in 1 MHC ligand assay.	IEDB	1330063	373	385	SFSTFKCYGVSPT	ECO:0000213	PubMed	33220791
P0DTC2	SNIIRGWIFGTTLD is a linear peptidic epitope (epitope ID 1330089) tested in 1 MHC ligand assay.	IEDB	1330089	98	111	SNIIRGWIFGTTLD	ECO:0000213	PubMed	33220791
P0DTC2	SNIIRGWIFGTTLDS is a linear peptidic epitope (epitope ID 1330090) tested in 8 MHC ligand assays.	IEDB	1330090	98	112	SNIIRGWIFGTTLDS	ECO:0000213	PubMed	33220791
P0DTC2	SNKKFLPFQQFG is a linear peptidic epitope (epitope ID 1330091) tested in 5 B cell assays and 1 MHC ligand assay.	IEDB	1330091	555	566	SNKKFLPFQQFG	ECO:0000213	PubMed	33220791
P0DTC2	SNKKFLPFQQFGRD is a linear peptidic epitope (epitope ID 1330092) tested in 1 MHC ligand assay.	IEDB	1330092	555	568	SNKKFLPFQQFGRD	ECO:0000213	PubMed	33220791
P0DTC2	SNKKFLPFQQFGRDI is a linear peptidic epitope (epitope ID 1330093) tested in 4 B cell assays and 8 MHC ligand assays.	IEDB	1330093	555	569	SNKKFLPFQQFGRDI	ECO:0000213	PubMed	33220791
P0DTC2	SNLLLQYGSF is a linear peptidic epitope (epitope ID 1330097) tested in 1 MHC ligand assay.	IEDB	1330097	750	759	SNLLLQYGSF	ECO:0000213	PubMed	33220791
P0DTC2	SNLLLQYGSFCT is a linear peptidic epitope (epitope ID 1330099) tested in 6 B cell assays and 1 MHC ligand assay.	IEDB	1330099	750	761	SNLLLQYGSFCT	ECO:0000213	PubMed	33220791
P0DTC2	SNLLLQYGSFCTQ is a linear peptidic epitope (epitope ID 1330101) tested in 2 MHC ligand assays.	IEDB	1330101	750	762	SNLLLQYGSFCTQ	ECO:0000213	PubMed	38117652
P0DTC2	SNLLLQYGSFCTQ is a linear peptidic epitope (epitope ID 1330101) tested in 2 MHC ligand assays.	IEDB	1330101	750	762	SNLLLQYGSFCTQ	ECO:0000213	PubMed	33220791
P0DTC2	SNLLLQYGSFCTQL is a linear peptidic epitope (epitope ID 1330103) tested in 2 MHC ligand assays.	IEDB	1330103	750	763	SNLLLQYGSFCTQL	ECO:0000213	PubMed	38117652
P0DTC2	SNLLLQYGSFCTQL is a linear peptidic epitope (epitope ID 1330103) tested in 2 MHC ligand assays.	IEDB	1330103	750	763	SNLLLQYGSFCTQL	ECO:0000213	PubMed	33220791
P0DTC2	SNLLLQYGSFCTQLN is a linear peptidic epitope (epitope ID 1330105) tested in 12 MHC ligand assays.	IEDB	1330105	750	764	SNLLLQYGSFCTQLN	ECO:0000213	PubMed	38117652
P0DTC2	SNLLLQYGSFCTQLN is a linear peptidic epitope (epitope ID 1330105) tested in 12 MHC ligand assays.	IEDB	1330105	750	764	SNLLLQYGSFCTQLN	ECO:0000213	PubMed	33220791
P0DTC2	SSNFGAISSVLND is a linear peptidic epitope (epitope ID 1330136) tested in 1 MHC ligand assay.	IEDB	1330136	967	979	SSNFGAISSVLND	ECO:0000213	PubMed	33220791
P0DTC2	SSVLHSTQDLFLPF is a linear peptidic epitope (epitope ID 1330137) tested in 2 MHC ligand assays.	IEDB	1330137	45	58	SSVLHSTQDLFLPF	ECO:0000213	PubMed	34004174
P0DTC2	SSVLHSTQDLFLPF is a linear peptidic epitope (epitope ID 1330137) tested in 2 MHC ligand assays.	IEDB	1330137	45	58	SSVLHSTQDLFLPF	ECO:0000213	PubMed	33220791
P0DTC2	STASALGKLQDVVN is a linear peptidic epitope (epitope ID 1330138) tested in 1 MHC ligand assay.	IEDB	1330138	940	953	STASALGKLQDVVN	ECO:0000213	PubMed	33220791
P0DTC2	STEIYQAGSTPCN is a linear peptidic epitope (epitope ID 1330140) tested in 1 B cell assay and 1 MHC ligand assay.	IEDB	1330140	469	481	STEIYQAGSTPCN	ECO:0000213	PubMed	33220791
P0DTC2	STEIYQAGSTPCNG is a linear peptidic epitope (epitope ID 1330141) tested in 1 MHC ligand assay.	IEDB	1330141	469	482	STEIYQAGSTPCNG	ECO:0000213	PubMed	33220791
P0DTC2	STFKCYGVSPT is a linear peptidic epitope (epitope ID 1330142) tested in 1 MHC ligand assay.	IEDB	1330142	375	385	STFKCYGVSPT	ECO:0000213	PubMed	33220791
P0DTC2	SVYAWNRKRISN is a linear peptidic epitope (epitope ID 1330147) tested in 7 B cell assays and 1 MHC ligand assay.	IEDB	1330147	349	360	SVYAWNRKRISN	ECO:0000213	PubMed	37766081
P0DTC2	SVYAWNRKRISN is a linear peptidic epitope (epitope ID 1330147) tested in 7 B cell assays and 1 MHC ligand assay.	IEDB	1330147	349	360	SVYAWNRKRISN	ECO:0000213	PubMed	33220791
P0DTC2	TDEMIAQYTSALLA is a linear peptidic epitope (epitope ID 1330164) tested in 2 T cell assays and 2 MHC ligand assays.	IEDB	1330164	866	879	TDEMIAQYTSALLA	ECO:0000213	PubMed	38117652
P0DTC2	TDEMIAQYTSALLA is a linear peptidic epitope (epitope ID 1330164) tested in 2 T cell assays and 2 MHC ligand assays.	IEDB	1330164	866	879	TDEMIAQYTSALLA	ECO:0000213	PubMed	33220791
P0DTC2	TEIYQAGSTPCNG is a linear peptidic epitope (epitope ID 1330175) tested in 1 MHC ligand assay.	IEDB	1330175	470	482	TEIYQAGSTPCNG	ECO:0000213	PubMed	33220791
P0DTC2	TFEYVSQPFLMD is a linear peptidic epitope (epitope ID 1330176) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1330176	167	178	TFEYVSQPFLMD	ECO:0000213	PubMed	33220791
P0DTC2	TFEYVSQPFLMDL is a linear peptidic epitope (epitope ID 1330177) tested in 1 MHC ligand assay.	IEDB	1330177	167	179	TFEYVSQPFLMDL	ECO:0000213	PubMed	33220791
P0DTC2	TFEYVSQPFLMDLE is a linear peptidic epitope (epitope ID 1330178) tested in 16 T cell assays and 1 MHC ligand assay.	IEDB	1330178	167	180	TFEYVSQPFLMDLE	ECO:0000213	PubMed	35026152
P0DTC2	TFEYVSQPFLMDLE is a linear peptidic epitope (epitope ID 1330178) tested in 16 T cell assays and 1 MHC ligand assay.	IEDB	1330178	167	180	TFEYVSQPFLMDLE	ECO:0000213	PubMed	35750048
P0DTC2	TFEYVSQPFLMDLE is a linear peptidic epitope (epitope ID 1330178) tested in 16 T cell assays and 1 MHC ligand assay.	IEDB	1330178	167	180	TFEYVSQPFLMDLE	ECO:0000213	PubMed	39284068
P0DTC2	TFEYVSQPFLMDLE is a linear peptidic epitope (epitope ID 1330178) tested in 16 T cell assays and 1 MHC ligand assay.	IEDB	1330178	167	180	TFEYVSQPFLMDLE	ECO:0000213	PubMed	33220791
P0DTC2	TFEYVSQPFLMDLEG is a linear peptidic epitope (epitope ID 1330180) tested in 3 T cell assays, 4 B cell assays and 12 MHC ligand assays.	IEDB	1330180	167	181	TFEYVSQPFLMDLEG	ECO:0000213	PubMed	33220791
P0DTC2	TGCVIAWNSNNL is a linear peptidic epitope (epitope ID 1330186) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1330186	430	441	TGCVIAWNSNNL	ECO:0000213	PubMed	33220791
P0DTC2	TGCVIAWNSNNLD is a linear peptidic epitope (epitope ID 1330188) tested in 1 MHC ligand assay.	IEDB	1330188	430	442	TGCVIAWNSNNLD	ECO:0000213	PubMed	33220791
P0DTC2	TGCVIAWNSNNLDS is a linear peptidic epitope (epitope ID 1330190) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1330190	430	443	TGCVIAWNSNNLDS	ECO:0000213	PubMed	33220791
P0DTC2	TGCVIAWNSNNLDSK is a linear peptidic epitope (epitope ID 1330192) tested in 8 B cell assays and 11 MHC ligand assays.	IEDB	1330192	430	444	TGCVIAWNSNNLDSK	ECO:0000213	PubMed	38117652
P0DTC2	TGCVIAWNSNNLDSK is a linear peptidic epitope (epitope ID 1330192) tested in 8 B cell assays and 11 MHC ligand assays.	IEDB	1330192	430	444	TGCVIAWNSNNLDSK	ECO:0000213	PubMed	33220791
P0DTC2	THWFVTQRNFYEP is a linear peptidic epitope (epitope ID 1330197) tested in 1 MHC ligand assay.	IEDB	1330197	1100	1112	THWFVTQRNFYEP	ECO:0000213	PubMed	33220791
P0DTC2	THWFVTQRNFYEPQ is a linear peptidic epitope (epitope ID 1330199) tested in 1 MHC ligand assay.	IEDB	1330199	1100	1113	THWFVTQRNFYEPQ	ECO:0000213	PubMed	33220791
P0DTC2	THWFVTQRNFYEPQI is a linear peptidic epitope (epitope ID 1330200) tested in 3 T cell assays and 8 MHC ligand assays.	IEDB	1330200	1100	1114	THWFVTQRNFYEPQI	ECO:0000213	PubMed	33220791
P0DTC2	TLKSFTVEKGIYQTS is a linear peptidic epitope (epitope ID 1330209) tested in 9 B cell assays and 11 MHC ligand assays.	IEDB	1330209	302	316	TLKSFTVEKGIYQTS	ECO:0000213	PubMed	33220791
P0DTC2	TLVKQLSSNFGAIS is a linear peptidic epitope (epitope ID 1330214) tested in 1 MHC ligand assay.	IEDB	1330214	961	974	TLVKQLSSNFGAIS	ECO:0000213	PubMed	33220791
P0DTC2	TNVYADSFVIRG is a linear peptidic epitope (epitope ID 1330218) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1330218	393	404	TNVYADSFVIRG	ECO:0000213	PubMed	33220791
P0DTC2	TPGDSSSGWTAGAAA is a linear peptidic epitope (epitope ID 1330219) tested in 6 B cell assays and 8 MHC ligand assays.	IEDB	1330219	250	264	TPGDSSSGWTAGAAA	ECO:0000213	PubMed	33220791
P0DTC2	TPINLVRDLPQG is a linear peptidic epitope (epitope ID 1330220) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1330220	208	219	TPINLVRDLPQG	ECO:0000213	PubMed	33220791
P0DTC2	TPTWRVYSTGSN is a linear peptidic epitope (epitope ID 1330225) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1330225	630	641	TPTWRVYSTGSN	ECO:0000213	PubMed	33220791
P0DTC2	TQDLFLPFF is a linear peptidic epitope (epitope ID 1330227) tested in 4 T cell assays and 2 MHC ligand assays.	IEDB	1330227	51	59	TQDLFLPFF	ECO:0000213	PubMed	33853928
P0DTC2	TQEVFAQVKQIYK is a linear peptidic epitope (epitope ID 1330229) tested in 1 MHC ligand assay.	IEDB	1330229	778	790	TQEVFAQVKQIYK	ECO:0000213	PubMed	33220791
P0DTC2	TQNVLYENQKLIANQ is a linear peptidic epitope (epitope ID 1330234) tested in 3 T cell assays, 8 B cell assays and 8 MHC ligand assays.	IEDB	1330234	912	926	TQNVLYENQKLIANQ	ECO:0000213	PubMed	33220791
P0DTC2	TRFQTLLALHRSYL is a linear peptidic epitope (epitope ID 1330241) tested in 1 MHC ligand assay.	IEDB	1330241	236	249	TRFQTLLALHRSYL	ECO:0000213	PubMed	33220791
P0DTC2	TRGVYYPDKVFRS is a linear peptidic epitope (epitope ID 1330243) tested in 1 T cell assay and 2 MHC ligand assays.	IEDB	1330243	33	45	TRGVYYPDKVFRS	ECO:0000213	PubMed	34004174
P0DTC2	TRGVYYPDKVFRS is a linear peptidic epitope (epitope ID 1330243) tested in 1 T cell assay and 2 MHC ligand assays.	IEDB	1330243	33	45	TRGVYYPDKVFRS	ECO:0000213	PubMed	33220791
P0DTC2	TRGVYYPDKVFRSS is a linear peptidic epitope (epitope ID 1330244) tested in 2 MHC ligand assays.	IEDB	1330244	33	46	TRGVYYPDKVFRSS	ECO:0000213	PubMed	34004174
P0DTC2	TRGVYYPDKVFRSS is a linear peptidic epitope (epitope ID 1330244) tested in 2 MHC ligand assays.	IEDB	1330244	33	46	TRGVYYPDKVFRSS	ECO:0000213	PubMed	33220791
P0DTC2	TSNFRVQPTESIVR is a linear peptidic epitope (epitope ID 1330251) tested in 2 MHC ligand assays.	IEDB	1330251	315	328	TSNFRVQPTESIVR	ECO:0000213	PubMed	34004174
P0DTC2	TSNFRVQPTESIVR is a linear peptidic epitope (epitope ID 1330251) tested in 2 MHC ligand assays.	IEDB	1330251	315	328	TSNFRVQPTESIVR	ECO:0000213	PubMed	33220791
P0DTC2	VGGNYNYLYRL is a linear peptidic epitope (epitope ID 1330280) tested in 1 MHC ligand assay.	IEDB	1330280	445	455	VGGNYNYLYRL	ECO:0000213	PubMed	33220791
P0DTC2	VGGNYNYLYRLFRK is a linear peptidic epitope (epitope ID 1330281) tested in 1 MHC ligand assay.	IEDB	1330281	445	458	VGGNYNYLYRLFRK	ECO:0000213	PubMed	33220791
P0DTC2	VIAWNSNNLD is a linear peptidic epitope (epitope ID 1330289) tested in 1 MHC ligand assay.	IEDB	1330289	433	442	VIAWNSNNLD	ECO:0000213	PubMed	33220791
P0DTC2	VIAWNSNNLDS is a linear peptidic epitope (epitope ID 1330290) tested in 1 MHC ligand assay.	IEDB	1330290	433	443	VIAWNSNNLDS	ECO:0000213	PubMed	33220791
P0DTC2	VIAWNSNNLDSK is a linear peptidic epitope (epitope ID 1330292) tested in 11 B cell assays and 1 MHC ligand assay.	IEDB	1330292	433	444	VIAWNSNNLDSK	ECO:0000213	PubMed	37766081
P0DTC2	VIAWNSNNLDSK is a linear peptidic epitope (epitope ID 1330292) tested in 11 B cell assays and 1 MHC ligand assay.	IEDB	1330292	433	444	VIAWNSNNLDSK	ECO:0000213	PubMed	33220791
P0DTC2	VIRGDEVRQIAPG is a linear peptidic epitope (epitope ID 1330296) tested in 2 T cell assays, 1 B cell assay and 2 MHC ligand assays.	IEDB	1330296	401	413	VIRGDEVRQIAPG	ECO:0000213	PubMed	34004174
P0DTC2	VIRGDEVRQIAPG is a linear peptidic epitope (epitope ID 1330296) tested in 2 T cell assays, 1 B cell assay and 2 MHC ligand assays.	IEDB	1330296	401	413	VIRGDEVRQIAPG	ECO:0000213	PubMed	33220791
P0DTC2	VSQPFLMDLE is a linear peptidic epitope (epitope ID 1330320) tested in 1 MHC ligand assay.	IEDB	1330320	171	180	VSQPFLMDLE	ECO:0000213	PubMed	33220791
P0DTC2	VTQQLIRAAEIRASA is a linear peptidic epitope (epitope ID 1330325) tested in 3 T cell assays and 9 MHC ligand assays.	IEDB	1330325	1008	1022	VTQQLIRAAEIRASA	ECO:0000213	PubMed	33220791
P0DTC2	VTQRNFYEPQ is a linear peptidic epitope (epitope ID 1330326) tested in 1 MHC ligand assay.	IEDB	1330326	1104	1113	VTQRNFYEPQ	ECO:0000213	PubMed	33220791
P0DTC2	WFVTQRNFYEPQ is a linear peptidic epitope (epitope ID 1330344) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1330344	1102	1113	WFVTQRNFYEPQ	ECO:0000213	PubMed	33220791
P0DTC2	YEQYIKWP is a linear peptidic epitope (epitope ID 1330363) tested in 1 MHC ligand assay.	IEDB	1330363	1206	1213	YEQYIKWP	ECO:0000213	PubMed	33220791
P0DTC2	YFKIYSKHTPINL is a linear peptidic epitope (epitope ID 1330365) tested in 2 MHC ligand assays.	IEDB	1330365	200	212	YFKIYSKHTPINL	ECO:0000213	PubMed	34004174
P0DTC2	YFKIYSKHTPINL is a linear peptidic epitope (epitope ID 1330365) tested in 2 MHC ligand assays.	IEDB	1330365	200	212	YFKIYSKHTPINL	ECO:0000213	PubMed	33220791
P0DTC2	YFKIYSKHTPINLVR is a linear peptidic epitope (epitope ID 1330366) tested in 9 MHC ligand assays.	IEDB	1330366	200	214	YFKIYSKHTPINLVR	ECO:0000213	PubMed	34004174
P0DTC2	YFKIYSKHTPINLVR is a linear peptidic epitope (epitope ID 1330366) tested in 9 MHC ligand assays.	IEDB	1330366	200	214	YFKIYSKHTPINLVR	ECO:0000213	PubMed	33220791
P0DTC2	YLYRLFRKSNLKP is a linear peptidic epitope (epitope ID 1330375) tested in 1 MHC ligand assay.	IEDB	1330375	451	463	YLYRLFRKSNLKP	ECO:0000213	PubMed	33220791
P0DTC2	YNYLYRLFRKSNL is a linear peptidic epitope (epitope ID 1330379) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1330379	449	461	YNYLYRLFRKSNL	ECO:0000213	PubMed	33220791
P0DTC2	YNYLYRLFRKSNLK is a linear peptidic epitope (epitope ID 1330380) tested in 1 MHC ligand assay.	IEDB	1330380	449	462	YNYLYRLFRKSNLK	ECO:0000213	PubMed	33220791
P0DTC2	YPDKVFRSSVLHSTQ is a linear peptidic epitope (epitope ID 1330383) tested in 9 MHC ligand assays.	IEDB	1330383	38	52	YPDKVFRSSVLHSTQ	ECO:0000213	PubMed	33220791
P0DTC2	YTSALLAGTIT is a linear peptidic epitope (epitope ID 1330391) tested in 1 MHC ligand assay.	IEDB	1330391	873	883	YTSALLAGTIT	ECO:0000213	PubMed	33220791
P0DTC2	YVSQPFLMDL is a linear peptidic epitope (epitope ID 1330394) tested in 1 MHC ligand assay.	IEDB	1330394	170	179	YVSQPFLMDL	ECO:0000213	PubMed	33220791
P0DTC2	YVSQPFLMDLE is a linear peptidic epitope (epitope ID 1330396) tested in 1 MHC ligand assay.	IEDB	1330396	170	180	YVSQPFLMDLE	ECO:0000213	PubMed	33220791
P0DTC2	APHGVVFL is a linear peptidic epitope (epitope ID 1330420) tested in 14 T cell assays.	IEDB	1330420	1056	1063	APHGVVFL	ECO:0000213	PubMed	38077128
P0DTC2	APHGVVFL is a linear peptidic epitope (epitope ID 1330420) tested in 14 T cell assays.	IEDB	1330420	1056	1063	APHGVVFL	ECO:0000213	PubMed	33427749
P0DTC2	ASVVNIQKEIDR is a linear peptidic epitope (epitope ID 1330425) tested in 6 B cell assays and 1 MHC ligand assay.	IEDB	1330425	1174	1185	ASVVNIQKEIDR	ECO:0000213	PubMed	34004174
P0DTC2	DGYFKIYSKHTPINL is a linear peptidic epitope (epitope ID 1330432) tested in 2 T cell assays and 8 MHC ligand assays.	IEDB	1330432	198	212	DGYFKIYSKHTPINL	ECO:0000213	PubMed	34004174
P0DTC2	DSLSSTASALGKL is a linear peptidic epitope (epitope ID 1330437) tested in 1 MHC ligand assay.	IEDB	1330437	936	948	DSLSSTASALGKL	ECO:0000213	PubMed	34004174
P0DTC2	DSLSSTASALGKLQ is a linear peptidic epitope (epitope ID 1330438) tested in 1 MHC ligand assay.	IEDB	1330438	936	949	DSLSSTASALGKLQ	ECO:0000213	PubMed	34004174
P0DTC2	DYSVLYNSASFSTFK is a linear peptidic epitope (epitope ID 1330442) tested in 8 B cell assays and 9 MHC ligand assays.	IEDB	1330442	364	378	DYSVLYNSASFSTFK	ECO:0000213	PubMed	34004174
P0DTC2	EGFNCYFPLQ is a linear peptidic epitope (epitope ID 1330444) tested in 1 B cell assay.	IEDB	1330444	484	493	EGFNCYFPLQ	ECO:0000213	PubMed	33443248
P0DTC2	EGFNCYFPLQSYGFQ is a linear peptidic epitope (epitope ID 1330445) tested in 17 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1330445	484	498	EGFNCYFPLQSYGFQ	ECO:0000213	PubMed	35891550
P0DTC2	EGFNCYFPLQSYGFQ is a linear peptidic epitope (epitope ID 1330445) tested in 17 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1330445	484	498	EGFNCYFPLQSYGFQ	ECO:0000213	PubMed	36680141
P0DTC2	EYVSQPFLMDLEGK is a linear peptidic epitope (epitope ID 1330448) tested in 1 MHC ligand assay.	IEDB	1330448	169	182	EYVSQPFLMDLEGK	ECO:0000213	PubMed	34004174
P0DTC2	FRVQPTESIVR is a linear peptidic epitope (epitope ID 1330454) tested in 1 MHC ligand assay.	IEDB	1330454	318	328	FRVQPTESIVR	ECO:0000213	PubMed	34004174
P0DTC2	FSQILPDPSKPSK is a linear peptidic epitope (epitope ID 1330456) tested in 1 MHC ligand assay.	IEDB	1330456	802	814	FSQILPDPSKPSK	ECO:0000213	PubMed	34004174
P0DTC2	FSQILPDPSKPSKRS is a linear peptidic epitope (epitope ID 1330457) tested in 16 B cell assays and 8 MHC ligand assays.	IEDB	1330457	802	816	FSQILPDPSKPSKRS	ECO:0000213	PubMed	34004174
P0DTC2	FTRGVYYPDK is a linear peptidic epitope (epitope ID 1330460) tested in 1 MHC ligand assay.	IEDB	1330460	32	41	FTRGVYYPDK	ECO:0000213	PubMed	34004174
P0DTC2	GIYQTSNFRVQPT is a linear peptidic epitope (epitope ID 1330464) tested in 1 MHC ligand assay.	IEDB	1330464	311	323	GIYQTSNFRVQPT	ECO:0000213	PubMed	34004174
P0DTC2	GKAHFPR is a linear peptidic epitope (epitope ID 1330465) tested in 1 MHC ligand assay.	IEDB	1330465	1085	1091	GKAHFPR	ECO:0000213	PubMed	34004174
P0DTC2	GKAHFPRE is a linear peptidic epitope (epitope ID 1330466) tested in 1 MHC ligand assay.	IEDB	1330466	1085	1092	GKAHFPRE	ECO:0000213	PubMed	34004174
P0DTC2	GKAHFPREG is a linear peptidic epitope (epitope ID 1330467) tested in 1 MHC ligand assay.	IEDB	1330467	1085	1093	GKAHFPREG	ECO:0000213	PubMed	34004174
P0DTC2	GVYYPDK is a linear peptidic epitope (epitope ID 1330474) tested in 1 MHC ligand assay.	IEDB	1330474	35	41	GVYYPDK	ECO:0000213	PubMed	34004174
P0DTC2	GVYYPDKVFRS is a linear peptidic epitope (epitope ID 1330475) tested in 1 MHC ligand assay.	IEDB	1330475	35	45	GVYYPDKVFRS	ECO:0000213	PubMed	34004174
P0DTC2	GVYYPDKVFRSSV is a linear peptidic epitope (epitope ID 1330476) tested in 1 MHC ligand assay.	IEDB	1330476	35	47	GVYYPDKVFRSSV	ECO:0000213	PubMed	34004174
P0DTC2	GYFKIYSKHTPINL is a linear peptidic epitope (epitope ID 1330477) tested in 1 MHC ligand assay.	IEDB	1330477	199	212	GYFKIYSKHTPINL	ECO:0000213	PubMed	34004174
P0DTC2	ILPDPSKPSKR is a linear peptidic epitope (epitope ID 1330487) tested in 1 MHC ligand assay.	IEDB	1330487	805	815	ILPDPSKPSKR	ECO:0000213	PubMed	34004174
P0DTC2	IQDSLSSTASALGKL is a linear peptidic epitope (epitope ID 1330489) tested in 6 B cell assays and 9 MHC ligand assays.	IEDB	1330489	934	948	IQDSLSSTASALGKL	ECO:0000213	PubMed	34004174
P0DTC2	IYKTPPIKDF is a linear peptidic epitope (epitope ID 1330491) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1330491	788	797	IYKTPPIKDF	ECO:0000213	PubMed	34728796
P0DTC2	IYKTPPIKDF is a linear peptidic epitope (epitope ID 1330491) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1330491	788	797	IYKTPPIKDF	ECO:0000213	PubMed	33853928
P0DTC2	KIYSKHTPINL is a linear peptidic epitope (epitope ID 1330493) tested in 1 MHC ligand assay.	IEDB	1330493	202	212	KIYSKHTPINL	ECO:0000213	PubMed	34004174
P0DTC2	KPFERDISTEIYQ is a linear peptidic epitope (epitope ID 1330503) tested in 4 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	1330503	462	474	KPFERDISTEIYQ	ECO:0000213	PubMed	34004174
P0DTC2	KPFERDISTEIYQ is a linear peptidic epitope (epitope ID 1330503) tested in 4 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	1330503	462	474	KPFERDISTEIYQ	ECO:0000213	PubMed	35857619
P0DTC2	LADAGFIKQY is a linear peptidic epitope (epitope ID 1330515) tested in 4 T cell assays.	IEDB	1330515	828	837	LADAGFIKQY	ECO:0000213	PubMed	35389886
P0DTC2	LADAGFIKQY is a linear peptidic epitope (epitope ID 1330515) tested in 4 T cell assays.	IEDB	1330515	828	837	LADAGFIKQY	ECO:0000213	PubMed	33853928
P0DTC2	LKSFTVEKGIYQ is a linear peptidic epitope (epitope ID 1330518) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1330518	303	314	LKSFTVEKGIYQ	ECO:0000213	PubMed	34004174
P0DTC2	LYNSASFSTF is a linear peptidic epitope (epitope ID 1330526) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1330526	368	377	LYNSASFSTF	ECO:0000213	PubMed	34728796
P0DTC2	LYNSASFSTF is a linear peptidic epitope (epitope ID 1330526) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1330526	368	377	LYNSASFSTF	ECO:0000213	PubMed	37193826
P0DTC2	PFFSNVTWF is a linear peptidic epitope (epitope ID 1330548) tested in 3 T cell assays.	IEDB	1330548	57	65	PFFSNVTWF	ECO:0000213	PubMed	33853928
P0DTC2	PFLGVYYH is a linear peptidic epitope (epitope ID 1330549) tested in 1 MHC ligand assay.	IEDB	1330549	139	146	PFLGVYYH	ECO:0000213	PubMed	34004174
P0DTC2	PFLGVYYHK is a linear peptidic epitope (epitope ID 1330550) tested in 1 MHC ligand assay.	IEDB	1330550	139	147	PFLGVYYHK	ECO:0000213	PubMed	34004174
P0DTC2	PSKPSKRSF is a linear peptidic epitope (epitope ID 1330551) tested in 1 MHC ligand assay.	IEDB	1330551	809	817	PSKPSKRSF	ECO:0000213	PubMed	34004174
P0DTC2	PSKPSKRSFI is a linear peptidic epitope (epitope ID 1330552) tested in 1 MHC ligand assay.	IEDB	1330552	809	818	PSKPSKRSFI	ECO:0000213	PubMed	34004174
P0DTC2	RGVYYPDK is a linear peptidic epitope (epitope ID 1330566) tested in 1 MHC ligand assay.	IEDB	1330566	34	41	RGVYYPDK	ECO:0000213	PubMed	34004174
P0DTC2	RGVYYPDKVFRSSV is a linear peptidic epitope (epitope ID 1330567) tested in 2 MHC ligand assays.	IEDB	1330567	34	47	RGVYYPDKVFRSSV	ECO:0000213	PubMed	34004174
P0DTC2	RGVYYPDKVFRSSV is a linear peptidic epitope (epitope ID 1330567) tested in 2 MHC ligand assays.	IEDB	1330567	34	47	RGVYYPDKVFRSSV	ECO:0000213	PubMed	38117652
P0DTC2	RQIAPGQTGK is a linear peptidic epitope (epitope ID 1330580) tested in 2 T cell assays.	IEDB	1330580	408	417	RQIAPGQTGK	ECO:0000213	PubMed	38781962
P0DTC2	SLSSTASALGKLQ is a linear peptidic epitope (epitope ID 1330589) tested in 1 MHC ligand assay.	IEDB	1330589	937	949	SLSSTASALGKLQ	ECO:0000213	PubMed	34004174
P0DTC2	SQILPDPSKPSK is a linear peptidic epitope (epitope ID 1330597) tested in 1 T cell assay, 5 B cell assays and 1 MHC ligand assay.	IEDB	1330597	803	814	SQILPDPSKPSK	ECO:0000213	PubMed	34004174
P0DTC2	SQILPDPSKPSK is a linear peptidic epitope (epitope ID 1330597) tested in 1 T cell assay, 5 B cell assays and 1 MHC ligand assay.	IEDB	1330597	803	814	SQILPDPSKPSK	ECO:0000213	PubMed	35857584
P0DTC2	SQILPDPSKPSKR is a linear peptidic epitope (epitope ID 1330598) tested in 1 MHC ligand assay.	IEDB	1330598	803	815	SQILPDPSKPSKR	ECO:0000213	PubMed	34004174
P0DTC2	TPINLVRDLPQGFS is a linear peptidic epitope (epitope ID 1330623) tested in 1 MHC ligand assay.	IEDB	1330623	208	221	TPINLVRDLPQGFS	ECO:0000213	PubMed	34004174
P0DTC2	TPINLVRDLPQGFSA is a linear peptidic epitope (epitope ID 1330624) tested in 6 B cell assays and 11 MHC ligand assays.	IEDB	1330624	208	222	TPINLVRDLPQGFSA	ECO:0000213	PubMed	34004174
P0DTC2	TPTWRVYSTGSNVFQ is a linear peptidic epitope (epitope ID 1330629) tested in 9 MHC ligand assays.	IEDB	1330629	630	644	TPTWRVYSTGSNVFQ	ECO:0000213	PubMed	34004174
P0DTC2	TRGVYYPDK is a linear peptidic epitope (epitope ID 1330631) tested in 1 MHC ligand assay.	IEDB	1330631	33	41	TRGVYYPDK	ECO:0000213	PubMed	34004174
P0DTC2	VEKGIYQTSNFRV is a linear peptidic epitope (epitope ID 1330642) tested in 1 MHC ligand assay.	IEDB	1330642	308	320	VEKGIYQTSNFRV	ECO:0000213	PubMed	34004174
P0DTC2	VEKGIYQTSNFRVQP is a linear peptidic epitope (epitope ID 1330643) tested in 3 T cell assays and 10 MHC ligand assays.	IEDB	1330643	308	322	VEKGIYQTSNFRVQP	ECO:0000213	PubMed	34004174
P0DTC2	CNDPFLGVY is a linear peptidic epitope (epitope ID 1331139) tested in 7 T cell assays and 3 MHC ligand assays.	IEDB	1331139	136	144	CNDPFLGVY	ECO:0000213	PubMed	33853928
P0DTC2	EELDKYF is a linear peptidic epitope (epitope ID 1331544) tested in 2 B cell assays.	IEDB	1331544	1150	1156	EELDKYF	ECO:0000213	PubMed	33495758
P0DTC2	ELLHAPATV is a linear peptidic epitope (epitope ID 1331642) tested in 3 T cell assays.	IEDB	1331642	516	524	ELLHAPATV	ECO:0000213	PubMed	37193826
P0DTC2	ELLHAPATV is a linear peptidic epitope (epitope ID 1331642) tested in 3 T cell assays.	IEDB	1331642	516	524	ELLHAPATV	ECO:0000213	PubMed	33853928
P0DTC2	FELLHAPATV is a linear peptidic epitope (epitope ID 1331943) tested in 2 T cell assays, 1 B cell assay and 3 MHC ligand assays.	IEDB	1331943	515	524	FELLHAPATV	ECO:0000213	PubMed	36658749
P0DTC2	FELLHAPATV is a linear peptidic epitope (epitope ID 1331943) tested in 2 T cell assays, 1 B cell assay and 3 MHC ligand assays.	IEDB	1331943	515	524	FELLHAPATV	ECO:0000213	PubMed	39456150
P0DTC2	FELLHAPATV is a linear peptidic epitope (epitope ID 1331943) tested in 2 T cell assays, 1 B cell assay and 3 MHC ligand assays.	IEDB	1331943	515	524	FELLHAPATV	ECO:0000213	PubMed	33853928
P0DTC2	FKNLREFVF is a linear peptidic epitope (epitope ID 1331958) tested in 4 T cell assays.	IEDB	1331958	186	194	FKNLREFVF	ECO:0000213	PubMed	38045681
P0DTC2	FKNLREFVF is a linear peptidic epitope (epitope ID 1331958) tested in 4 T cell assays.	IEDB	1331958	186	194	FKNLREFVF	ECO:0000213	PubMed	33853928
P0DTC2	FRSSVLHST is a linear peptidic epitope (epitope ID 1331988) tested in 3 T cell assays.	IEDB	1331988	43	51	FRSSVLHST	ECO:0000213	PubMed	33853928
P0DTC2	FVFLVLLPL is a linear peptidic epitope (epitope ID 1332003) tested in 11 T cell assays.	IEDB	1332003	2	10	FVFLVLLPL	ECO:0000213	PubMed	34793243
P0DTC2	FVFLVLLPL is a linear peptidic epitope (epitope ID 1332003) tested in 11 T cell assays.	IEDB	1332003	2	10	FVFLVLLPL	ECO:0000213	PubMed	38605956
P0DTC2	FVFLVLLPL is a linear peptidic epitope (epitope ID 1332003) tested in 11 T cell assays.	IEDB	1332003	2	10	FVFLVLLPL	ECO:0000213	PubMed	33911008
P0DTC2	HADQLTPTW is a linear peptidic epitope (epitope ID 1332221) tested in 4 T cell assays and 11 MHC ligand assays.	IEDB	1332221	625	633	HADQLTPTW	ECO:0000213	PubMed	34171305
P0DTC2	ITGRLQSLQTY is a linear peptidic epitope (epitope ID 1332424) tested in 1 T cell assay.	IEDB	1332424	997	1007	ITGRLQSLQTY	ECO:0000213	PubMed	33853928
P0DTC2	KNIDGYFKIY is a linear peptidic epitope (epitope ID 1332509) tested in 4 T cell assays and 10 MHC ligand assays.	IEDB	1332509	195	204	KNIDGYFKIY	ECO:0000213	PubMed	34171305
P0DTC2	LLTDEMIAQY is a linear peptidic epitope (epitope ID 1332664) tested in 1 T cell assay.	IEDB	1332664	864	873	LLTDEMIAQY	ECO:0000213	PubMed	33853928
P0DTC2	LPQGFSALEPL is a linear peptidic epitope (epitope ID 1332697) tested in 4 T cell assays.	IEDB	1332697	216	226	LPQGFSALEPL	ECO:0000213	PubMed	37193826
P0DTC2	LPQGFSALEPL is a linear peptidic epitope (epitope ID 1332697) tested in 4 T cell assays.	IEDB	1332697	216	226	LPQGFSALEPL	ECO:0000213	PubMed	33853928
P0DTC2	LQELGKYEQY is a linear peptidic epitope (epitope ID 1332702) tested in 1 T cell assay.	IEDB	1332702	1200	1209	LQELGKYEQY	ECO:0000213	PubMed	33853928
P0DTC2	LTDEMIAQYT is a linear peptidic epitope (epitope ID 1332727) tested in 1 T cell assay.	IEDB	1332727	865	874	LTDEMIAQYT	ECO:0000213	PubMed	33853928
P0DTC2	LVKNKCVNF is a linear peptidic epitope (epitope ID 1332741) tested in 8 T cell assays.	IEDB	1332741	533	541	LVKNKCVNF	ECO:0000213	PubMed	33853928
P0DTC2	MFVFLVLLPLVSS is a linear peptidic epitope (epitope ID 1332785) tested in 9 T cell assays.	IEDB	1332785	1	13	MFVFLVLLPLVSS	ECO:0000213	PubMed	38605956
P0DTC2	MFVFLVLLPLVSS is a linear peptidic epitope (epitope ID 1332785) tested in 9 T cell assays.	IEDB	1332785	1	13	MFVFLVLLPLVSS	ECO:0000213	PubMed	33911008
P0DTC2	NATNVVIKV is a linear peptidic epitope (epitope ID 1332861) tested in 10 T cell assays and 10 MHC ligand assays.	IEDB	1332861	122	130	NATNVVIKV	ECO:0000213	PubMed	34171305
P0DTC2	NATNVVIKV is a linear peptidic epitope (epitope ID 1332861) tested in 10 T cell assays and 10 MHC ligand assays.	IEDB	1332861	122	130	NATNVVIKV	ECO:0000213	PubMed	35139340
P0DTC2	NATNVVIKV is a linear peptidic epitope (epitope ID 1332861) tested in 10 T cell assays and 10 MHC ligand assays.	IEDB	1332861	122	130	NATNVVIKV	ECO:0000213	PubMed	38781962
P0DTC2	QSAPHGVVF is a linear peptidic epitope (epitope ID 1333222) tested in 4 T cell assays and 2 MHC ligand assays.	IEDB	1333222	1054	1062	QSAPHGVVF	ECO:0000213	PubMed	35139340
P0DTC2	QSAPHGVVF is a linear peptidic epitope (epitope ID 1333222) tested in 4 T cell assays and 2 MHC ligand assays.	IEDB	1333222	1054	1062	QSAPHGVVF	ECO:0000213	PubMed	33853928
P0DTC2	RLDKVEAEVQI is a linear peptidic epitope (epitope ID 1333325) tested in 1 T cell assay.	IEDB	1333325	983	993	RLDKVEAEVQI	ECO:0000213	PubMed	33853928
P0DTC2	RVQPTESIVRF is a linear peptidic epitope (epitope ID 1333410) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1333410	319	329	RVQPTESIVRF	ECO:0000213	PubMed	33853928
P0DTC2	SASFSTFKCY is a linear peptidic epitope (epitope ID 1333450) tested in 1 T cell assay.	IEDB	1333450	371	380	SASFSTFKCY	ECO:0000213	PubMed	33853928
P0DTC2	SFELLHAPATV is a linear peptidic epitope (epitope ID 1333520) tested in 2 T cell assays.	IEDB	1333520	514	524	SFELLHAPATV	ECO:0000213	PubMed	33853928
P0DTC2	SFIEDLLF is a linear peptidic epitope (epitope ID 1333523) tested in 1 T cell assay.	IEDB	1333523	816	823	SFIEDLLF	ECO:0000213	PubMed	33853928
P0DTC2	SKRVDFCGKGY is a linear peptidic epitope (epitope ID 1333568) tested in 1 T cell assay and 2 MHC ligand assays.	IEDB	1333568	1037	1047	SKRVDFCGKGY	ECO:0000213	PubMed	33853928
P0DTC2	SSANNCTFEY is a linear peptidic epitope (epitope ID 1333782) tested in 1 T cell assay.	IEDB	1333782	161	170	SSANNCTFEY	ECO:0000213	PubMed	33853928
P0DTC2	STECSNLLLQY is a linear peptidic epitope (epitope ID 1333801) tested in 3 T cell assays.	IEDB	1333801	746	756	STECSNLLLQY	ECO:0000213	PubMed	33853928
P0DTC2	STQDLFLPF is a linear peptidic epitope (epitope ID 1333812) tested in 3 T cell assays.	IEDB	1333812	50	58	STQDLFLPF	ECO:0000213	PubMed	35139340
P0DTC2	STQDLFLPF is a linear peptidic epitope (epitope ID 1333812) tested in 3 T cell assays.	IEDB	1333812	50	58	STQDLFLPF	ECO:0000213	PubMed	33853928
P0DTC2	STQDLFLPF is a linear peptidic epitope (epitope ID 1333812) tested in 3 T cell assays.	IEDB	1333812	50	58	STQDLFLPF	ECO:0000213	PubMed	34249101
P0DTC2	SWMESEFRV is a linear peptidic epitope (epitope ID 1333886) tested in 2 T cell assays.	IEDB	1333886	151	159	SWMESEFRV	ECO:0000213	PubMed	34793243
P0DTC2	SWMESEFRV is a linear peptidic epitope (epitope ID 1333886) tested in 2 T cell assays.	IEDB	1333886	151	159	SWMESEFRV	ECO:0000213	PubMed	33853928
P0DTC2	TDEMIAQY is a linear peptidic epitope (epitope ID 1333921) tested in 1 T cell assay.	IEDB	1333921	866	873	TDEMIAQY	ECO:0000213	PubMed	33853928
P0DTC2	TFEYVSQPFLM is a linear peptidic epitope (epitope ID 1333951) tested in 1 T cell assay.	IEDB	1333951	167	177	TFEYVSQPFLM	ECO:0000213	PubMed	33853928
P0DTC2	TRFASVYAW is a linear peptidic epitope (epitope ID 1334060) tested in 4 T cell assays.	IEDB	1334060	345	353	TRFASVYAW	ECO:0000213	PubMed	38045681
P0DTC2	TRFASVYAW is a linear peptidic epitope (epitope ID 1334060) tested in 4 T cell assays.	IEDB	1334060	345	353	TRFASVYAW	ECO:0000213	PubMed	33853928
P0DTC2	TRTQLPPAY is a linear peptidic epitope (epitope ID 1334061) tested in 1 T cell assay.	IEDB	1334061	20	28	TRTQLPPAY	ECO:0000213	PubMed	33853928
P0DTC2	TYVPAQEKNFT is a linear peptidic epitope (epitope ID 1334122) tested in 1 T cell assay.	IEDB	1334122	1066	1076	TYVPAQEKNFT	ECO:0000213	PubMed	33853928
P0DTC2	VFVSNGTHW is a linear peptidic epitope (epitope ID 1334171) tested in 2 T cell assays.	IEDB	1334171	1094	1102	VFVSNGTHW	ECO:0000213	PubMed	33853928
P0DTC2	VGYLQPRTF is a linear peptidic epitope (epitope ID 1334182) tested in 10 T cell assays and 10 MHC ligand assays.	IEDB	1334182	267	275	VGYLQPRTF	ECO:0000213	PubMed	34171305
P0DTC2	VGYLQPRTF is a linear peptidic epitope (epitope ID 1334182) tested in 10 T cell assays and 10 MHC ligand assays.	IEDB	1334182	267	275	VGYLQPRTF	ECO:0000213	PubMed	35139340
P0DTC2	VGYLQPRTFL is a linear peptidic epitope (epitope ID 1334183) tested in 1 T cell assay.	IEDB	1334183	267	276	VGYLQPRTFL	ECO:0000213	PubMed	33853928
P0DTC2	VGYQPYRVV is a linear peptidic epitope (epitope ID 1334184) tested in 1 T cell assay.	IEDB	1334184	503	511	VGYQPYRVV	ECO:0000213	PubMed	33853928
P0DTC2	VKQIYKT is a linear peptidic epitope (epitope ID 1334204) tested in 2 B cell assays.	IEDB	1334204	785	791	VKQIYKT	ECO:0000213	PubMed	33495758
P0DTC2	VLPFNDGVYFA is a linear peptidic epitope (epitope ID 1334231) tested in 2 T cell assays.	IEDB	1334231	83	93	VLPFNDGVYFA	ECO:0000213	PubMed	39456150
P0DTC2	VLPFNDGVYFA is a linear peptidic epitope (epitope ID 1334231) tested in 2 T cell assays.	IEDB	1334231	83	93	VLPFNDGVYFA	ECO:0000213	PubMed	33853928
P0DTC2	VLTESNKKF is a linear peptidic epitope (epitope ID 1334234) tested in 1 T cell assay.	IEDB	1334234	551	559	VLTESNKKF	ECO:0000213	PubMed	33853928
P0DTC2	YQPYRVVVL is a linear peptidic epitope (epitope ID 1334394) tested in 10 T cell assays and 3 MHC ligand assays.	IEDB	1334394	505	513	YQPYRVVVL	ECO:0000213	PubMed	38045681
P0DTC2	YQPYRVVVL is a linear peptidic epitope (epitope ID 1334394) tested in 10 T cell assays and 3 MHC ligand assays.	IEDB	1334394	505	513	YQPYRVVVL	ECO:0000213	PubMed	33853928
P0DTC2	YTNSFTRGVYY is a linear peptidic epitope (epitope ID 1334416) tested in 3 T cell assays.	IEDB	1334416	28	38	YTNSFTRGVYY	ECO:0000213	PubMed	33853928
P0DTC2	TEIYQAGST is a linear peptidic epitope (epitope ID 1335256) tested in 1 T cell assay and 18 B cell assays.	IEDB	1335256	470	478	TEIYQAGST	ECO:0000213	PubMed	38781962
P0DTC2	LKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQ is a linear peptidic epitope (epitope ID 1338498) tested in 4 T cell assays and 12 B cell assays.	IEDB	1338498	461	493	LKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQ	ECO:0000213	PubMed	36195474
P0DTC2	IWLGFIAGL is a linear peptidic epitope (epitope ID 1338839) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1338839	1216	1224	IWLGFIAGL	ECO:0000213	PubMed	34857854
P0DTC2	YNYLYRLF is a linear peptidic epitope (epitope ID 1338972) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1338972	449	456	YNYLYRLF	ECO:0000213	PubMed	37886945
P0DTC2	KKFLPFQQFGR is a linear peptidic epitope (epitope ID 1342355) tested in 2 T cell assays and 2 B cell assays.	IEDB	1342355	557	567	KKFLPFQQFGR	ECO:0000213	PubMed	34647971
P0DTC2	KKFLPFQQFGR is a linear peptidic epitope (epitope ID 1342355) tested in 2 T cell assays and 2 B cell assays.	IEDB	1342355	557	567	KKFLPFQQFGR	ECO:0000213	PubMed	38716629
P0DTC2	GDEVRQI is a linear peptidic epitope (epitope ID 1347032) tested in 8 B cell assays.	IEDB	1347032	404	410	GDEVRQI	ECO:0000213	PubMed	33810465
P0DTC2	NNSYECDIPIGAGICA is a linear peptidic epitope (epitope ID 1386199) tested in 3 T cell assays and 2 B cell assays.	IEDB	1386199	657	672	NNSYECDIPIGAGICA	ECO:0000213	PubMed	34630356
P0DTC2	APHGVVFLH is a linear peptidic epitope (epitope ID 1392052) tested in 3 T cell assays.	IEDB	1392052	1056	1064	APHGVVFLH	ECO:0000213	PubMed	34793243
P0DTC2	FGEVFNATRFASVYA is a linear peptidic epitope (epitope ID 1392147) tested in 3 T cell assays, 2 B cell assays and 7 MHC ligand assays.	IEDB	1392147	338	352	FGEVFNATRFASVYA	ECO:0000213	PubMed	35104433
P0DTC2	FQFCNDPFL is a linear peptidic epitope (epitope ID 1392157) tested in 15 T cell assays and 2 MHC ligand assays.	IEDB	1392157	133	141	FQFCNDPFL	ECO:0000213	PubMed	34506741
P0DTC2	FQFCNDPFL is a linear peptidic epitope (epitope ID 1392157) tested in 15 T cell assays and 2 MHC ligand assays.	IEDB	1392157	133	141	FQFCNDPFL	ECO:0000213	PubMed	35116022
P0DTC2	GCVIAWNSNNLDSKVGGNYN is a linear peptidic epitope (epitope ID 1392172) tested in 6 T cell assays.	IEDB	1392172	431	450	GCVIAWNSNNLDSKVGGNYN	ECO:0000213	PubMed	34538222
P0DTC2	GIYQTSNFRVQPTESIVRFP is a linear peptidic epitope (epitope ID 1392178) tested in 6 T cell assays.	IEDB	1392178	311	330	GIYQTSNFRVQPTESIVRFP	ECO:0000213	PubMed	34538222
P0DTC2	LLALHRSYLTPGDSSSGWTA is a linear peptidic epitope (epitope ID 1392269) tested in 6 T cell assays.	IEDB	1392269	241	260	LLALHRSYLTPGDSSSGWTA	ECO:0000213	PubMed	34538222
P0DTC2	LSRLDKVEAEVQIDRLITGR is a linear peptidic epitope (epitope ID 1392288) tested in 10 T cell assays.	IEDB	1392288	981	1000	LSRLDKVEAEVQIDRLITGR	ECO:0000213	PubMed	34006597
P0DTC2	NLVRDLPQGFSALEPLVDLP is a linear peptidic epitope (epitope ID 1392328) tested in 3 T cell assays and 1 B cell assay.	IEDB	1392328	211	230	NLVRDLPQGFSALEPLVDLP	ECO:0000213	PubMed	34538222
P0DTC2	SFTRGVYYPDKVFRSSVLHS is a linear peptidic epitope (epitope ID 1392421) tested in 6 T cell assays and 1 B cell assay.	IEDB	1392421	31	50	SFTRGVYYPDKVFRSSVLHS	ECO:0000213	PubMed	34538222
P0DTC2	SVLYNSASF is a linear peptidic epitope (epitope ID 1392439) tested in 3 T cell assays.	IEDB	1392439	366	374	SVLYNSASF	ECO:0000213	PubMed	33923363
P0DTC2	VVVLSFEL is a linear peptidic epitope (epitope ID 1392512) tested in 4 T cell assays.	IEDB	1392512	510	517	VVVLSFEL	ECO:0000213	PubMed	39589869
P0DTC2	FKEELDKYF is a linear peptidic epitope (epitope ID 1397122) tested in 30 B cell assays and has 3D structure(s) 7m53.	IEDB	1397122	1148	1156	FKEELDKYF	ECO:0000213	PubMed	33981021
P0DTC2	FKEELDKYF is a linear peptidic epitope (epitope ID 1397122) tested in 30 B cell assays and has 3D structure(s) 7m53.	IEDB	1397122	1148	1156	FKEELDKYF	ECO:0000213	PubMed	36912367
P0DTC2	VYADSFVIRG is a linear peptidic epitope (epitope ID 1397510) tested in 2 T cell assays.	IEDB	1397510	395	404	VYADSFVIRG	ECO:0000213	PubMed	34208032
P0DTC2	SKPSKRSFIEDLLF is a linear peptidic epitope (epitope ID 1397994) tested in 3 B cell assays.	IEDB	1397994	810	823	SKPSKRSFIEDLLF	ECO:0000213	PubMed	34273512
P0DTC2	ADTTDAVRDPQT is a linear peptidic epitope (epitope ID 1407656) tested in 8 B cell assays.	IEDB	1407656	570	581	ADTTDAVRDPQT	ECO:0000213	PubMed	37251407
P0DTC2	CCKFDEDDSEPV is a linear peptidic epitope (epitope ID 1415159) tested in 11 B cell assays.	IEDB	1415159	1253	1264	CCKFDEDDSEPV	ECO:0000213	PubMed	37251407
P0DTC2	CEFQFCNDPFLG is a linear peptidic epitope (epitope ID 1415557) tested in 4 B cell assays.	IEDB	1415557	131	142	CEFQFCNDPFLG	ECO:0000213	PubMed	37251407
P0DTC2	FDEDDSEPVLKG is a linear peptidic epitope (epitope ID 1431844) tested in 8 B cell assays.	IEDB	1431844	1256	1267	FDEDDSEPVLKG	ECO:0000213	PubMed	37251407
P0DTC2	FERDISTEIYQA is a linear peptidic epitope (epitope ID 1432366) tested in 7 B cell assays.	IEDB	1432366	464	475	FERDISTEIYQA	ECO:0000213	PubMed	35916768
P0DTC2	FKEELDKYFKNH is a linear peptidic epitope (epitope ID 1433742) tested in 31 B cell assays.	IEDB	1433742	1148	1159	FKEELDKYFKNH	ECO:0000213	PubMed	37251407
P0DTC2	INLVRDLPQGFS is a linear peptidic epitope (epitope ID 1453240) tested in 1 T cell assay and 3 B cell assays.	IEDB	1453240	210	221	INLVRDLPQGFS	ECO:0000213	PubMed	35857584
P0DTC2	IPFAMQMAYRFN is a linear peptidic epitope (epitope ID 1453488) tested in 7 B cell assays and 1 MHC ligand assay.	IEDB	1453488	896	907	IPFAMQMAYRFN	ECO:0000213	PubMed	38117652
P0DTC2	IYQAGSTPCNGVEGFNCY is a linear peptidic epitope (epitope ID 1456376) tested in 1 T cell assay and 3 B cell assays.	IEDB	1456376	472	489	IYQAGSTPCNGVEGFNCY	ECO:0000213	PubMed	35474581
P0DTC2	LNDLCFTNVYAD is a linear peptidic epitope (epitope ID 1470083) tested in 9 B cell assays.	IEDB	1470083	387	398	LNDLCFTNVYAD	ECO:0000213	PubMed	36658749
P0DTC2	NLLLQYGSFCTQ is a linear peptidic epitope (epitope ID 1481887) tested in 1 T cell assay and 8 B cell assays.	IEDB	1481887	751	762	NLLLQYGSFCTQ	ECO:0000213	PubMed	35857584
P0DTC2	PFAMQMAYRFNG is a linear peptidic epitope (epitope ID 1486663) tested in 9 B cell assays.	IEDB	1486663	897	908	PFAMQMAYRFNG	ECO:0000213	PubMed	34684763
P0DTC2	PFQQFGRDIADT is a linear peptidic epitope (epitope ID 1486834) tested in 10 B cell assays.	IEDB	1486834	561	572	PFQQFGRDIADT	ECO:0000213	PubMed	37251407
P0DTC2	PKKSTNLVKNKC is a linear peptidic epitope (epitope ID 1487852) tested in 4 B cell assays.	IEDB	1487852	527	538	PKKSTNLVKNKC	ECO:0000213	PubMed	36658749
P0DTC2	QFGRDIADTTDA is a linear peptidic epitope (epitope ID 1492259) tested in 8 B cell assays.	IEDB	1492259	564	575	QFGRDIADTTDA	ECO:0000213	PubMed	37251407
P0DTC2	QPELDSFKEELD is a linear peptidic epitope (epitope ID 1494216) tested in 6 B cell assays.	IEDB	1494216	1142	1153	QPELDSFKEELD	ECO:0000213	PubMed	37251407
P0DTC2	QQLIRAAEIRAS is a linear peptidic epitope (epitope ID 1494642) tested in 7 B cell assays and 1 MHC ligand assay.	IEDB	1494642	1010	1021	QQLIRAAEIRAS	ECO:0000213	PubMed	38117652
P0DTC2	SKRSFIEDLLFN is a linear peptidic epitope (epitope ID 1505852) tested in 18 B cell assays and has 3D structure(s) 7tow.	IEDB	1505852	813	824	SKRSFIEDLLFN	ECO:0000213	PubMed	37251407
P0DTC2	SNFRVQPTESIV is a linear peptidic epitope (epitope ID 1507236) tested in 1 T cell assay and 6 B cell assays.	IEDB	1507236	316	327	SNFRVQPTESIV	ECO:0000213	PubMed	35857584
P0DTC2	TDAVDCALDPLS is a linear peptidic epitope (epitope ID 1512925) tested in 7 B cell assays.	IEDB	1512925	286	297	TDAVDCALDPLS	ECO:0000213	PubMed	35916768
P0DTC2	TDAVRDPQTLEI is a linear peptidic epitope (epitope ID 1512930) tested in 11 B cell assays.	IEDB	1512930	573	584	TDAVRDPQTLEI	ECO:0000213	PubMed	37251407
P0DTC2	TRFQTLLALHRS is a linear peptidic epitope (epitope ID 1518333) tested in 2 T cell assays and 3 B cell assays.	IEDB	1518333	236	247	TRFQTLLALHRS	ECO:0000213	PubMed	35857584
P0DTC2	VLYNSASFSTFK is a linear peptidic epitope (epitope ID 1526436) tested in 9 B cell assays.	IEDB	1526436	367	378	VLYNSASFSTFK	ECO:0000213	PubMed	36658749
P0DTC2	VRDPQTLEILDI is a linear peptidic epitope (epitope ID 1528368) tested in 6 B cell assays.	IEDB	1528368	576	587	VRDPQTLEILDI	ECO:0000213	PubMed	37251407
P0DTC2	WNRKRISNCVADYSVLYNS is a linear peptidic epitope (epitope ID 1532692) tested in 12 T cell assays.	IEDB	1532692	353	371	WNRKRISNCVADYSVLYNS	ECO:0000213	PubMed	37541134
P0DTC2	YNENGTITDAVD is a linear peptidic epitope (epitope ID 1536472) tested in 5 B cell assays.	IEDB	1536472	279	290	YNENGTITDAVD	ECO:0000213	PubMed	37251407
P0DTC2	ADYSVLYNSASFSTF is a linear peptidic epitope (epitope ID 1539410) tested in 23 T cell assays, 7 B cell assays and 8 MHC ligand assays.	IEDB	1539410	363	377	ADYSVLYNSASFSTF	ECO:0000213	PubMed	35891550
P0DTC2	ADYSVLYNSASFSTF is a linear peptidic epitope (epitope ID 1539410) tested in 23 T cell assays, 7 B cell assays and 8 MHC ligand assays.	IEDB	1539410	363	377	ADYSVLYNSASFSTF	ECO:0000213	PubMed	36680141
P0DTC2	HTPINLVRDLPQGFS is a linear peptidic epitope (epitope ID 1540724) tested in 17 T cell assays, 6 B cell assays and 10 MHC ligand assays.	IEDB	1540724	207	221	HTPINLVRDLPQGFS	ECO:0000213	PubMed	35891550
P0DTC2	HTPINLVRDLPQGFS is a linear peptidic epitope (epitope ID 1540724) tested in 17 T cell assays, 6 B cell assays and 10 MHC ligand assays.	IEDB	1540724	207	221	HTPINLVRDLPQGFS	ECO:0000213	PubMed	36680141
P0DTC2	KLQDVVNQNAQALNT is a linear peptidic epitope (epitope ID 1541060) tested in 17 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1541060	947	961	KLQDVVNQNAQALNT	ECO:0000213	PubMed	35891550
P0DTC2	KLQDVVNQNAQALNT is a linear peptidic epitope (epitope ID 1541060) tested in 17 T cell assays, 4 B cell assays and 9 MHC ligand assays.	IEDB	1541060	947	961	KLQDVVNQNAQALNT	ECO:0000213	PubMed	36680141
P0DTC2	KTSVDCTMY is a linear peptidic epitope (epitope ID 1541151) tested in 1 T cell assay and 2 MHC ligand assays.	IEDB	1541151	733	741	KTSVDCTMY	ECO:0000213	PubMed	38045681
P0DTC2	LPVSMTKTSV is a linear peptidic epitope (epitope ID 1541448) tested in 3 T cell assays and 2 MHC ligand assays.	IEDB	1541448	727	736	LPVSMTKTSV	ECO:0000213	PubMed	37193826
P0DTC2	NDGVYFASTEKSNII is a linear peptidic epitope (epitope ID 1541691) tested in 16 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1541691	87	101	NDGVYFASTEKSNII	ECO:0000213	PubMed	35891550
P0DTC2	NRKRISNCVAD is a linear peptidic epitope (epitope ID 1541817) tested in 1 T cell assay.	IEDB	1541817	354	364	NRKRISNCVAD	ECO:0000213	PubMed	34006597
P0DTC2	PFERDISTEIYQAGS is a linear peptidic epitope (epitope ID 1541927) tested in 52 B cell assays and 8 MHC ligand assays.	IEDB	1541927	463	477	PFERDISTEIYQAGS	ECO:0000213	PubMed	34756082
P0DTC2	PKKSTNLVKNKCVNF is a linear peptidic epitope (epitope ID 1541963) tested in 6 B cell assays and 8 MHC ligand assays.	IEDB	1541963	527	541	PKKSTNLVKNKCVNF	ECO:0000213	PubMed	34756082
P0DTC2	QPYRVVVLSFELLHAPATVC is a linear peptidic epitope (epitope ID 1542166) tested in 5 T cell assays.	IEDB	1542166	506	525	QPYRVVVLSFELLHAPATVC	ECO:0000213	PubMed	34006597
P0DTC2	RFASVYAWNRKR is a linear peptidic epitope (epitope ID 1542248) tested in 1 T cell assay.	IEDB	1542248	346	357	RFASVYAWNRKR	ECO:0000213	PubMed	34006597
P0DTC2	RKRISNCVAD is a linear peptidic epitope (epitope ID 1542282) tested in 4 T cell assays.	IEDB	1542282	355	364	RKRISNCVAD	ECO:0000213	PubMed	34006597
P0DTC2	RVQPTESIVRFPNIT is a linear peptidic epitope (epitope ID 1542357) tested in 1 T cell assay, 12 B cell assays and 7 MHC ligand assays.	IEDB	1542357	319	333	RVQPTESIVRFPNIT	ECO:0000213	PubMed	34756082
P0DTC2	SFVIRGDEVRQIAPG is a linear peptidic epitope (epitope ID 1542450) tested in 1 T cell assay, 7 B cell assays and 9 MHC ligand assays.	IEDB	1542450	399	413	SFVIRGDEVRQIAPG	ECO:0000213	PubMed	36680141
P0DTC2	TGKIADYNYKLPDDF is a linear peptidic epitope (epitope ID 1542752) tested in 16 B cell assays and 7 MHC ligand assays.	IEDB	1542752	415	429	TGKIADYNYKLPDDF	ECO:0000213	PubMed	34756082
P0DTC2	TVCGPKKSTNLVKNK is a linear peptidic epitope (epitope ID 1542953) tested in 12 B cell assays and 7 MHC ligand assays.	IEDB	1542953	523	537	TVCGPKKSTNLVKNK	ECO:0000213	PubMed	34756082
P0DTC2	VYAWNRKRIS is a linear peptidic epitope (epitope ID 1543315) tested in 1 T cell assay.	IEDB	1543315	350	359	VYAWNRKRIS	ECO:0000213	PubMed	34006597
P0DTC2	ASVYAWNRK is a linear peptidic epitope (epitope ID 1544519) tested in 5 T cell assays and 4 MHC ligand assays.	IEDB	1544519	348	356	ASVYAWNRK	ECO:0000213	PubMed	34506741
P0DTC2	ASVYAWNRK is a linear peptidic epitope (epitope ID 1544519) tested in 5 T cell assays and 4 MHC ligand assays.	IEDB	1544519	348	356	ASVYAWNRK	ECO:0000213	PubMed	34728796
P0DTC2	FIEDLLFNK is a linear peptidic epitope (epitope ID 1546420) tested in 3 T cell assays and 3 MHC ligand assays.	IEDB	1546420	817	825	FIEDLLFNK	ECO:0000213	PubMed	34728796
P0DTC2	GIYQTSNFR is a linear peptidic epitope (epitope ID 1547148) tested in 4 T cell assays and 4 MHC ligand assays.	IEDB	1547148	311	319	GIYQTSNFR	ECO:0000213	PubMed	34728796
P0DTC2	GYLQPRTFL is a linear peptidic epitope (epitope ID 1547648) tested in 3 T cell assays.	IEDB	1547648	268	276	GYLQPRTFL	ECO:0000213	PubMed	34222571
P0DTC2	KSTNLVKNK is a linear peptidic epitope (epitope ID 1549036) tested in 7 T cell assays and 3 MHC ligand assays.	IEDB	1549036	529	537	KSTNLVKNK	ECO:0000213	PubMed	36254196
P0DTC2	VLYENQKLI is a linear peptidic epitope (epitope ID 1555419) tested in 9 T cell assays and 3 MHC ligand assays.	IEDB	1555419	915	923	VLYENQKLI	ECO:0000213	PubMed	34793243
P0DTC2	VLYENQKLI is a linear peptidic epitope (epitope ID 1555419) tested in 9 T cell assays and 3 MHC ligand assays.	IEDB	1555419	915	923	VLYENQKLI	ECO:0000213	PubMed	39456150
P0DTC2	QLIRAAEIRASANLAATKM is a linear peptidic epitope (epitope ID 1584233) tested in 8 T cell assays.	IEDB	1584233	1011	1029	QLIRAAEIRASANLAATKM	ECO:0000213	PubMed	33911008
P0DTC2	SFKEELDKYF is a linear peptidic epitope (epitope ID 1595221) tested in 101 B cell assays and has 3D structure(s) 7rnj.	IEDB	1595221	1147	1156	SFKEELDKYF	ECO:0000213	PubMed	36701425
P0DTC2	SFKEELDKYF is a linear peptidic epitope (epitope ID 1595221) tested in 101 B cell assays and has 3D structure(s) 7rnj.	IEDB	1595221	1147	1156	SFKEELDKYF	ECO:0000213	PubMed	38036525
P0DTC2	FIEDLLFNKV is a linear peptidic epitope (epitope ID 1597683) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1597683	817	826	FIEDLLFNKV	ECO:0000213	PubMed	38105139
P0DTC2	FLHVTYVPA is a linear peptidic epitope (epitope ID 1597686) tested in 11 T cell assays and 3 MHC ligand assays.	IEDB	1597686	1062	1070	FLHVTYVPA	ECO:0000213	PubMed	34728796
P0DTC2	FLHVTYVPA is a linear peptidic epitope (epitope ID 1597686) tested in 11 T cell assays and 3 MHC ligand assays.	IEDB	1597686	1062	1070	FLHVTYVPA	ECO:0000213	PubMed	34793243
P0DTC2	FLHVTYVPA is a linear peptidic epitope (epitope ID 1597686) tested in 11 T cell assays and 3 MHC ligand assays.	IEDB	1597686	1062	1070	FLHVTYVPA	ECO:0000213	PubMed	37193826
P0DTC2	FLHVTYVPA is a linear peptidic epitope (epitope ID 1597686) tested in 11 T cell assays and 3 MHC ligand assays.	IEDB	1597686	1062	1070	FLHVTYVPA	ECO:0000213	PubMed	38932408
P0DTC2	FLHVTYVPA is a linear peptidic epitope (epitope ID 1597686) tested in 11 T cell assays and 3 MHC ligand assays.	IEDB	1597686	1062	1070	FLHVTYVPA	ECO:0000213	PubMed	34231935
P0DTC2	KLPDDFTGC is a linear peptidic epitope (epitope ID 1597720) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1597720	424	432	KLPDDFTGC	ECO:0000213	PubMed	34793243
P0DTC2	KQIYKTPPI is a linear peptidic epitope (epitope ID 1597721) tested in 9 T cell assays and 4 MHC ligand assays.	IEDB	1597721	786	794	KQIYKTPPI	ECO:0000213	PubMed	34793243
P0DTC2	KQIYKTPPI is a linear peptidic epitope (epitope ID 1597721) tested in 9 T cell assays and 4 MHC ligand assays.	IEDB	1597721	786	794	KQIYKTPPI	ECO:0000213	PubMed	35139340
P0DTC2	KQIYKTPPI is a linear peptidic epitope (epitope ID 1597721) tested in 9 T cell assays and 4 MHC ligand assays.	IEDB	1597721	786	794	KQIYKTPPI	ECO:0000213	PubMed	37193826
P0DTC2	KQLSSNFGA is a linear peptidic epitope (epitope ID 1597722) tested in 4 T cell assays and 2 MHC ligand assays.	IEDB	1597722	964	972	KQLSSNFGA	ECO:0000213	PubMed	34793243
P0DTC2	SVTTEILPV is a linear peptidic epitope (epitope ID 1597815) tested in 10 T cell assays and 1 MHC ligand assay.	IEDB	1597815	721	729	SVTTEILPV	ECO:0000213	PubMed	34793243
P0DTC2	VTWFHAIHV is a linear peptidic epitope (epitope ID 1597845) tested in 5 T cell assays and 4 MHC ligand assays.	IEDB	1597845	62	70	VTWFHAIHV	ECO:0000213	PubMed	34793243
P0DTC2	VTWFHAIHV is a linear peptidic epitope (epitope ID 1597845) tested in 5 T cell assays and 4 MHC ligand assays.	IEDB	1597845	62	70	VTWFHAIHV	ECO:0000213	PubMed	34231935
P0DTC2	YQAGSTP is a linear peptidic epitope (epitope ID 1597861) tested in 3 B cell assays.	IEDB	1597861	473	479	YQAGSTP	ECO:0000213	PubMed	34621266
P0DTC2	ALDPLSETKCT is a linear peptidic epitope (epitope ID 1625351) tested in 2 B cell assays.	IEDB	1625351	292	302	ALDPLSETKCT	ECO:0000213	PubMed	34650130
P0DTC2	CGDSTECS is a linear peptidic epitope (epitope ID 1625362) tested in 2 B cell assays.	IEDB	1625362	743	750	CGDSTECS	ECO:0000213	PubMed	34650130
P0DTC2	DVNCTEVPV is a linear peptidic epitope (epitope ID 1625365) tested in 2 B cell assays.	IEDB	1625365	614	622	DVNCTEVPV	ECO:0000213	PubMed	34650130
P0DTC2	EGKQGNFKNLR is a linear peptidic epitope (epitope ID 1625368) tested in 2 B cell assays.	IEDB	1625368	180	190	EGKQGNFKNLR	ECO:0000213	PubMed	34650130
P0DTC2	LPDPSKPSKR is a linear peptidic epitope (epitope ID 1625408) tested in 2 B cell assays.	IEDB	1625408	806	815	LPDPSKPSKR	ECO:0000213	PubMed	34650130
P0DTC2	MTKTSVDC is a linear peptidic epitope (epitope ID 1625412) tested in 2 B cell assays.	IEDB	1625412	731	738	MTKTSVDC	ECO:0000213	PubMed	34650130
P0DTC2	PQSAPHG is a linear peptidic epitope (epitope ID 1625421) tested in 2 B cell assays.	IEDB	1625421	1053	1059	PQSAPHG	ECO:0000213	PubMed	34650130
P0DTC2	SSVLHSTQ is a linear peptidic epitope (epitope ID 1625440) tested in 2 B cell assays.	IEDB	1625440	45	52	SSVLHSTQ	ECO:0000213	PubMed	34650130
P0DTC2	VEGFNCYFPLQ is a linear peptidic epitope (epitope ID 1625452) tested in 3 B cell assays.	IEDB	1625452	483	493	VEGFNCYFPLQ	ECO:0000213	PubMed	34650130
P0DTC2	VYYPDKVFR is a linear peptidic epitope (epitope ID 1625462) tested in 1 T cell assay, 2 B cell assays and 2 MHC ligand assays.	IEDB	1625462	36	44	VYYPDKVFR	ECO:0000213	PubMed	34650130
P0DTC2	VYYPDKVFR is a linear peptidic epitope (epitope ID 1625462) tested in 1 T cell assay, 2 B cell assays and 2 MHC ligand assays.	IEDB	1625462	36	44	VYYPDKVFR	ECO:0000213	PubMed	34728796
P0DTC2	EILDITPCSFG is a linear peptidic epitope (epitope ID 1625928) tested in 4 T cell assays and 9 MHC ligand assays.	IEDB	1625928	583	593	EILDITPCSFG	ECO:0000213	PubMed	34171305
P0DTC2	EIYQAGSTPCNGV is a linear peptidic epitope (epitope ID 1628561) tested in 1 T cell assay and 1 B cell assay.	IEDB	1628561	471	483	EIYQAGSTPCNGV	ECO:0000213	PubMed	34630356
P0DTC2	NSNNLDSKVGG is a linear peptidic epitope (epitope ID 1631826) tested in 1 T cell assay.	IEDB	1631826	437	447	NSNNLDSKVGG	ECO:0000213	PubMed	34630356
P0DTC2	NYNYLYRLFR is a linear peptidic epitope (epitope ID 1631928) tested in 2 T cell assays.	IEDB	1631928	448	457	NYNYLYRLFR	ECO:0000213	PubMed	37193826
P0DTC2	NYNYLYRLFR is a linear peptidic epitope (epitope ID 1631928) tested in 2 T cell assays.	IEDB	1631928	448	457	NYNYLYRLFR	ECO:0000213	PubMed	34630356
P0DTC2	VFQTRAGCLIGAEHV is a linear peptidic epitope (epitope ID 1633036) tested in 1 T cell assay, 8 B cell assays and 7 MHC ligand assays.	IEDB	1633036	642	656	VFQTRAGCLIGAEHV	ECO:0000213	PubMed	34630356
P0DTC2	RLITGRLQSL is a linear peptidic epitope (epitope ID 1635375) tested in 15 T cell assays and 1 MHC ligand assay.	IEDB	1635375	995	1004	RLITGRLQSL	ECO:0000213	PubMed	34725257
P0DTC2	RLITGRLQSL is a linear peptidic epitope (epitope ID 1635375) tested in 15 T cell assays and 1 MHC ligand assay.	IEDB	1635375	995	1004	RLITGRLQSL	ECO:0000213	PubMed	37193826
P0DTC2	RLITGRLQSL is a linear peptidic epitope (epitope ID 1635375) tested in 15 T cell assays and 1 MHC ligand assay.	IEDB	1635375	995	1004	RLITGRLQSL	ECO:0000213	PubMed	38932408
P0DTC2	RLITGRLQSL is a linear peptidic epitope (epitope ID 1635375) tested in 15 T cell assays and 1 MHC ligand assay.	IEDB	1635375	995	1004	RLITGRLQSL	ECO:0000213	PubMed	38045681
P0DTC2	ATRFASVYA is a linear peptidic epitope (epitope ID 1646541) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1646541	344	352	ATRFASVYA	ECO:0000213	PubMed	34728796
P0DTC2	CFTNVYADSF is a linear peptidic epitope (epitope ID 1647797) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1647797	391	400	CFTNVYADSF	ECO:0000213	PubMed	34728796
P0DTC2	CTLKSFTVEK is a linear peptidic epitope (epitope ID 1649022) tested in 1 T cell assay and 2 MHC ligand assays.	IEDB	1649022	301	310	CTLKSFTVEK	ECO:0000213	PubMed	34728796
P0DTC2	FKIYSKHTPI is a linear peptidic epitope (epitope ID 1657458) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1657458	201	210	FKIYSKHTPI	ECO:0000213	PubMed	34728796
P0DTC2	FVFLVLLPLV is a linear peptidic epitope (epitope ID 1659240) tested in 8 T cell assays and 5 MHC ligand assays.	IEDB	1659240	2	11	FVFLVLLPLV	ECO:0000213	PubMed	34728796
P0DTC2	FVFLVLLPLV is a linear peptidic epitope (epitope ID 1659240) tested in 8 T cell assays and 5 MHC ligand assays.	IEDB	1659240	2	11	FVFLVLLPLV	ECO:0000213	PubMed	35116022
P0DTC2	FVFLVLLPLV is a linear peptidic epitope (epitope ID 1659240) tested in 8 T cell assays and 5 MHC ligand assays.	IEDB	1659240	2	11	FVFLVLLPLV	ECO:0000213	PubMed	35937077
P0DTC2	FVSNGTHWFV is a linear peptidic epitope (epitope ID 1659456) tested in 5 T cell assays and 3 MHC ligand assays.	IEDB	1659456	1095	1104	FVSNGTHWFV	ECO:0000213	PubMed	34728796
P0DTC2	FVSNGTHWFV is a linear peptidic epitope (epitope ID 1659456) tested in 5 T cell assays and 3 MHC ligand assays.	IEDB	1659456	1095	1104	FVSNGTHWFV	ECO:0000213	PubMed	38045681
P0DTC2	IGAEHVNNSYECDIPI is a linear peptidic epitope (epitope ID 1666213) tested in 1 T cell assay and 4 B cell assays.	IEDB	1666213	651	666	IGAEHVNNSYECDIPI	ECO:0000213	PubMed	37251407
P0DTC2	KNLREFVFK is a linear peptidic epitope (epitope ID 1671378) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1671378	187	195	KNLREFVFK	ECO:0000213	PubMed	34728796
P0DTC2	LQSYGFQPT is a linear peptidic epitope (epitope ID 1677313) tested in 1 T cell assay, 1 B cell assay and 1 MHC ligand assay.	IEDB	1677313	492	500	LQSYGFQPT	ECO:0000213	PubMed	34684763
P0DTC2	LQSYGFQPT is a linear peptidic epitope (epitope ID 1677313) tested in 1 T cell assay, 1 B cell assay and 1 MHC ligand assay.	IEDB	1677313	492	500	LQSYGFQPT	ECO:0000213	PubMed	34728796
P0DTC2	NGVGYQPYR is a linear peptidic epitope (epitope ID 1681938) tested in 2 T cell assays and 2 MHC ligand assays.	IEDB	1681938	501	509	NGVGYQPYR	ECO:0000213	PubMed	34728796
P0DTC2	QLNRALTGI is a linear peptidic epitope (epitope ID 1688328) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1688328	762	770	QLNRALTGI	ECO:0000213	PubMed	34728796
P0DTC2	RARSVASQSI is a linear peptidic epitope (epitope ID 1689634) tested in 8 T cell assays.	IEDB	1689634	683	692	RARSVASQSI	ECO:0000213	PubMed	37193826
P0DTC2	SALEPLVDLPIGINIT is a linear peptidic epitope (epitope ID 1692051) tested in 1 T cell assay and 4 B cell assays.	IEDB	1692051	221	236	SALEPLVDLPIGINIT	ECO:0000213	PubMed	37251407
P0DTC2	TEIYQAGSTPCNGVEG is a linear peptidic epitope (epitope ID 1697606) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1697606	470	485	TEIYQAGSTPCNGVEG	ECO:0000213	PubMed	34684763
P0DTC2	YYVGYLQPR is a linear peptidic epitope (epitope ID 1711597) tested in 3 T cell assays and 4 MHC ligand assays.	IEDB	1711597	265	273	YYVGYLQPR	ECO:0000213	PubMed	34728796
P0DTC2	YYVGYLQPR is a linear peptidic epitope (epitope ID 1711597) tested in 3 T cell assays and 4 MHC ligand assays.	IEDB	1711597	265	273	YYVGYLQPR	ECO:0000213	PubMed	38716629
P0DTC2	GKYEQYIKWPWYIWL is a linear peptidic epitope (epitope ID 1857361) tested in 7 T cell assays, 6 B cell assays and 7 MHC ligand assays.	IEDB	1857361	1204	1218	GKYEQYIKWPWYIWL	ECO:0000213	PubMed	34857854
P0DTC2	IKWPWYIWL is a linear peptidic epitope (epitope ID 1857835) tested in 2 T cell assays.	IEDB	1857835	1210	1218	IKWPWYIWL	ECO:0000213	PubMed	34857854
P0DTC2	KWPWYIWLG is a linear peptidic epitope (epitope ID 1858355) tested in 4 T cell assays.	IEDB	1858355	1211	1219	KWPWYIWLG	ECO:0000213	PubMed	34793243
P0DTC2	KWPWYIWLG is a linear peptidic epitope (epitope ID 1858355) tested in 4 T cell assays.	IEDB	1858355	1211	1219	KWPWYIWLG	ECO:0000213	PubMed	34857854
P0DTC2	LGFIAGLIA is a linear peptidic epitope (epitope ID 1858482) tested in 2 T cell assays.	IEDB	1858482	1218	1226	LGFIAGLIA	ECO:0000213	PubMed	34857854
P0DTC2	LQELGKYEQYIKWPW is a linear peptidic epitope (epitope ID 1858678) tested in 7 T cell assays and 7 MHC ligand assays.	IEDB	1858678	1200	1214	LQELGKYEQYIKWPW	ECO:0000213	PubMed	34857854
P0DTC2	PWYIWLGFI is a linear peptidic epitope (epitope ID 1859072) tested in 2 T cell assays.	IEDB	1859072	1213	1221	PWYIWLGFI	ECO:0000213	PubMed	34857854
P0DTC2	QYIKWPWYIWLGFIA is a linear peptidic epitope (epitope ID 1859278) tested in 7 T cell assays and 7 MHC ligand assays.	IEDB	1859278	1208	1222	QYIKWPWYIWLGFIA	ECO:0000213	PubMed	34857854
P0DTC2	TLLALHRSY is a linear peptidic epitope (epitope ID 1860045) tested in 2 T cell assays.	IEDB	1860045	240	248	TLLALHRSY	ECO:0000213	PubMed	34814158
P0DTC2	TRFQTLLAL is a linear peptidic epitope (epitope ID 1860144) tested in 3 T cell assays.	IEDB	1860144	236	244	TRFQTLLAL	ECO:0000213	PubMed	34814158
P0DTC2	WLGFIAGLI is a linear peptidic epitope (epitope ID 1860587) tested in 2 T cell assays.	IEDB	1860587	1217	1225	WLGFIAGLI	ECO:0000213	PubMed	34857854
P0DTC2	WPWYIWLGF is a linear peptidic epitope (epitope ID 1860591) tested in 4 T cell assays.	IEDB	1860591	1212	1220	WPWYIWLGF	ECO:0000213	PubMed	34793243
P0DTC2	WPWYIWLGF is a linear peptidic epitope (epitope ID 1860591) tested in 4 T cell assays.	IEDB	1860591	1212	1220	WPWYIWLGF	ECO:0000213	PubMed	34857854
P0DTC2	WPWYIWLGFIAGLIA is a linear peptidic epitope (epitope ID 1860592) tested in 7 T cell assays, 8 B cell assays and 7 MHC ligand assays.	IEDB	1860592	1212	1226	WPWYIWLGFIAGLIA	ECO:0000213	PubMed	34857854
P0DTC2	WYIWLGFIA is a linear peptidic epitope (epitope ID 1860610) tested in 2 T cell assays.	IEDB	1860610	1214	1222	WYIWLGFIA	ECO:0000213	PubMed	34857854
P0DTC2	YIKWPWYIW is a linear peptidic epitope (epitope ID 1860671) tested in 2 T cell assays.	IEDB	1860671	1209	1217	YIKWPWYIW	ECO:0000213	PubMed	34857854
P0DTC2	YIWLGFIAG is a linear peptidic epitope (epitope ID 1860674) tested in 2 T cell assays.	IEDB	1860674	1215	1223	YIWLGFIAG	ECO:0000213	PubMed	34857854
P0DTC2	APATVCGPKKSTNLV is a linear peptidic epitope (epitope ID 1860812) tested in 3 T cell assays, 8 B cell assays and 7 MHC ligand assays.	IEDB	1860812	520	534	APATVCGPKKSTNLV	ECO:0000213	PubMed	34756082
P0DTC2	NLCPFGEVFNATRFA is a linear peptidic epitope (epitope ID 1860856) tested in 1 T cell assay, 8 B cell assays and 7 MHC ligand assays.	IEDB	1860856	334	348	NLCPFGEVFNATRFA	ECO:0000213	PubMed	35699447
P0DTC2	NVYADSFVIRGDEVR is a linear peptidic epitope (epitope ID 1860857) tested in 8 B cell assays and 10 MHC ligand assays.	IEDB	1860857	394	408	NVYADSFVIRGDEVR	ECO:0000213	PubMed	34756082
P0DTC2	PTESIVRFPNITNLC is a linear peptidic epitope (epitope ID 1860862) tested in 16 B cell assays and 7 MHC ligand assays.	IEDB	1860862	322	336	PTESIVRFPNITNLC	ECO:0000213	PubMed	34756082
P0DTC2	RFPNITNLCPFGEVF is a linear peptidic epitope (epitope ID 1860869) tested in 8 B cell assays and 8 MHC ligand assays.	IEDB	1860869	328	342	RFPNITNLCPFGEVF	ECO:0000213	PubMed	34756082
P0DTC2	RLFRKSNLKPFERDI is a linear peptidic epitope (epitope ID 1860873) tested in 8 B cell assays and 7 MHC ligand assays.	IEDB	1860873	454	468	RLFRKSNLKPFERDI	ECO:0000213	PubMed	34756082
P0DTC2	SFELLHAPATVCGPK is a linear peptidic epitope (epitope ID 1860874) tested in 8 B cell assays and 7 MHC ligand assays.	IEDB	1860874	514	528	SFELLHAPATVCGPK	ECO:0000213	PubMed	34756082
P0DTC2	DPSKPSKR is a linear peptidic epitope (epitope ID 1870778) tested in 1 B cell assay.	IEDB	1870778	808	815	DPSKPSKR	ECO:0000213	PubMed	35174857
P0DTC2	AHFPREGVF is a linear peptidic epitope (epitope ID 1876454) tested in 3 T cell assays.	IEDB	1876454	1087	1095	AHFPREGVF	ECO:0000213	PubMed	35139340
P0DTC2	AHFPREGVF is a linear peptidic epitope (epitope ID 1876454) tested in 3 T cell assays.	IEDB	1876454	1087	1095	AHFPREGVF	ECO:0000213	PubMed	38781962
P0DTC2	AHFPREGVF is a linear peptidic epitope (epitope ID 1876454) tested in 3 T cell assays.	IEDB	1876454	1087	1095	AHFPREGVF	ECO:0000213	PubMed	38045681
P0DTC2	ELDSFKEEL is a linear peptidic epitope (epitope ID 1886278) tested in 1 T cell assay.	IEDB	1886278	1144	1152	ELDSFKEEL	ECO:0000213	PubMed	35139340
P0DTC2	FASTEKSNI is a linear peptidic epitope (epitope ID 1888578) tested in 1 T cell assay.	IEDB	1888578	92	100	FASTEKSNI	ECO:0000213	PubMed	35139340
P0DTC2	FCNDPFLGV is a linear peptidic epitope (epitope ID 1888599) tested in 1 T cell assay.	IEDB	1888599	135	143	FCNDPFLGV	ECO:0000213	PubMed	35139340
P0DTC2	FCNDPFLGVY is a linear peptidic epitope (epitope ID 1888600) tested in 11 T cell assays and 2 MHC ligand assays.	IEDB	1888600	135	144	FCNDPFLGVY	ECO:0000213	PubMed	35389886
P0DTC2	GVYYPDKVF is a linear peptidic epitope (epitope ID 1896317) tested in 1 T cell assay.	IEDB	1896317	35	43	GVYYPDKVF	ECO:0000213	PubMed	35139340
P0DTC2	IEDLLFNKV is a linear peptidic epitope (epitope ID 1898614) tested in 3 T cell assays.	IEDB	1898614	818	826	IEDLLFNKV	ECO:0000213	PubMed	35139340
P0DTC2	KSFTVEKGI is a linear peptidic epitope (epitope ID 1908546) tested in 1 T cell assay.	IEDB	1908546	304	312	KSFTVEKGI	ECO:0000213	PubMed	35139340
P0DTC2	LVKQLSSNF is a linear peptidic epitope (epitope ID 1914665) tested in 2 T cell assays.	IEDB	1914665	962	970	LVKQLSSNF	ECO:0000213	PubMed	35139340
P0DTC2	LVKQLSSNF is a linear peptidic epitope (epitope ID 1914665) tested in 2 T cell assays.	IEDB	1914665	962	970	LVKQLSSNF	ECO:0000213	PubMed	38866784
P0DTC2	NTSNQVAVL is a linear peptidic epitope (epitope ID 1918635) tested in 1 T cell assay.	IEDB	1918635	603	611	NTSNQVAVL	ECO:0000213	PubMed	35139340
P0DTC2	RNFYEPQII is a linear peptidic epitope (epitope ID 1927257) tested in 1 T cell assay.	IEDB	1927257	1107	1115	RNFYEPQII	ECO:0000213	PubMed	35139340
P0DTC2	RVVVLSFEL is a linear peptidic epitope (epitope ID 1929146) tested in 12 T cell assays.	IEDB	1929146	509	517	RVVVLSFEL	ECO:0000213	PubMed	34793243
P0DTC2	RVVVLSFEL is a linear peptidic epitope (epitope ID 1929146) tested in 12 T cell assays.	IEDB	1929146	509	517	RVVVLSFEL	ECO:0000213	PubMed	35139340
P0DTC2	SRLDKVEAEV is a linear peptidic epitope (epitope ID 1933783) tested in 1 T cell assay.	IEDB	1933783	982	991	SRLDKVEAEV	ECO:0000213	PubMed	35139340
P0DTC2	VVNQNAQAL is a linear peptidic epitope (epitope ID 1942216) tested in 1 T cell assay and 2 MHC ligand assays.	IEDB	1942216	951	959	VVNQNAQAL	ECO:0000213	PubMed	35139340
P0DTC2	ILPDPSKPSKRSFIEDLLFNKVTLADAGFIK is a linear peptidic epitope (epitope ID 1966318) tested in 7 B cell assays.	IEDB	1966318	805	835	ILPDPSKPSKRSFIEDLLFNKVTLADAGFIK	ECO:0000213	PubMed	35404959
P0DTC2	DLGDISGIN is a linear peptidic epitope (epitope ID 1972694) tested in 85 B cell assays.	IEDB	1972694	1165	1173	DLGDISGIN	ECO:0000213	PubMed	35290246
P0DTC2	YVSQPFLM is a linear peptidic epitope (epitope ID 1972729) tested in 3 T cell assays.	IEDB	1972729	170	177	YVSQPFLM	ECO:0000213	PubMed	35026152
P0DTC2	ADSFVIRG is a linear peptidic epitope (epitope ID 1972950) tested in 1 B cell assay.	IEDB	1972950	397	404	ADSFVIRG	ECO:0000213	PubMed	35371042
P0DTC2	ASVYAWNR is a linear peptidic epitope (epitope ID 1972956) tested in 1 B cell assay.	IEDB	1972956	348	355	ASVYAWNR	ECO:0000213	PubMed	35371042
P0DTC2	AVEQDKNT is a linear peptidic epitope (epitope ID 1972957) tested in 1 B cell assay.	IEDB	1972957	771	778	AVEQDKNT	ECO:0000213	PubMed	35371042
P0DTC2	AYTNSFTR is a linear peptidic epitope (epitope ID 1972958) tested in 1 B cell assay.	IEDB	1972958	27	34	AYTNSFTR	ECO:0000213	PubMed	35371042
P0DTC2	DYNYKLPD is a linear peptidic epitope (epitope ID 1972962) tested in 1 B cell assay.	IEDB	1972962	420	427	DYNYKLPD	ECO:0000213	PubMed	35371042
P0DTC2	ERDISTEI is a linear peptidic epitope (epitope ID 1972963) tested in 1 B cell assay.	IEDB	1972963	465	472	ERDISTEI	ECO:0000213	PubMed	35371042
P0DTC2	GVLTESNK is a linear peptidic epitope (epitope ID 1972968) tested in 1 B cell assay.	IEDB	1972968	550	557	GVLTESNK	ECO:0000213	PubMed	35371042
P0DTC2	GWTAGAAA is a linear peptidic epitope (epitope ID 1972969) tested in 1 B cell assay.	IEDB	1972969	257	264	GWTAGAAA	ECO:0000213	PubMed	35371042
P0DTC2	HTPINLVR is a linear peptidic epitope (epitope ID 1972970) tested in 1 B cell assay.	IEDB	1972970	207	214	HTPINLVR	ECO:0000213	PubMed	35371042
P0DTC2	IAPGQTGK is a linear peptidic epitope (epitope ID 1972971) tested in 1 B cell assay.	IEDB	1972971	410	417	IAPGQTGK	ECO:0000213	PubMed	35371042
P0DTC2	IWLGFIAG is a linear peptidic epitope (epitope ID 1972973) tested in 1 B cell assay.	IEDB	1972973	1216	1223	IWLGFIAG	ECO:0000213	PubMed	35371042
P0DTC2	KCVNFNFN is a linear peptidic epitope (epitope ID 1972974) tested in 1 B cell assay.	IEDB	1972974	537	544	KCVNFNFN	ECO:0000213	PubMed	35371042
P0DTC2	KFLPFQQF is a linear peptidic epitope (epitope ID 1972975) tested in 1 B cell assay.	IEDB	1972975	558	565	KFLPFQQF	ECO:0000213	PubMed	35371042
P0DTC2	KSTNLVKN is a linear peptidic epitope (epitope ID 1972978) tested in 1 B cell assay.	IEDB	1972978	529	536	KSTNLVKN	ECO:0000213	PubMed	35371042
P0DTC2	LQIPFAMQ is a linear peptidic epitope (epitope ID 1972983) tested in 1 B cell assay.	IEDB	1972983	894	901	LQIPFAMQ	ECO:0000213	PubMed	35371042
P0DTC2	QLTPTWRV is a linear peptidic epitope (epitope ID 1972988) tested in 1 B cell assay.	IEDB	1972988	628	635	QLTPTWRV	ECO:0000213	PubMed	35371042
P0DTC2	QTNSPRRA is a linear peptidic epitope (epitope ID 1972990) tested in 1 B cell assay.	IEDB	1972990	677	684	QTNSPRRA	ECO:0000213	PubMed	35371042
P0DTC2	SFKEELDKYFK is a linear peptidic epitope (epitope ID 1972993) tested in 13 B cell assays.	IEDB	1972993	1147	1157	SFKEELDKYFK	ECO:0000213	PubMed	35411021
P0DTC2	TLKSFTVE is a linear peptidic epitope (epitope ID 1972999) tested in 1 B cell assay.	IEDB	1972999	302	309	TLKSFTVE	ECO:0000213	PubMed	35371042
P0DTC2	TTDAVRDP is a linear peptidic epitope (epitope ID 1973000) tested in 1 B cell assay.	IEDB	1973000	572	579	TTDAVRDP	ECO:0000213	PubMed	35371042
P0DTC2	YLTPGDSS is a linear peptidic epitope (epitope ID 1973003) tested in 1 B cell assay.	IEDB	1973003	248	255	YLTPGDSS	ECO:0000213	PubMed	35371042
P0DTC2	YPDKVFRS is a linear peptidic epitope (epitope ID 1973004) tested in 1 B cell assay.	IEDB	1973004	38	45	YPDKVFRS	ECO:0000213	PubMed	35371042
P0DTC2	YIWLGFIAGL is a linear peptidic epitope (epitope ID 2000272) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	2000272	1215	1224	YIWLGFIAGL	ECO:0000213	PubMed	35116022
P0DTC2	ICASYQTQTNSPRRA is a linear peptidic epitope (epitope ID 2001108) tested in 6 B cell assays and 10 MHC ligand assays.	IEDB	2001108	670	684	ICASYQTQTNSPRRA	ECO:0000213	PubMed	38117652
P0DTC2	LQSYGFQPTNGVGYQPYR is a linear peptidic epitope (epitope ID 2001192) tested in 1 T cell assay and 3 B cell assays.	IEDB	2001192	492	509	LQSYGFQPTNGVGYQPYR	ECO:0000213	PubMed	35474581
P0DTC2	NLLLQYGSFCTQLNRAL is a linear peptidic epitope (epitope ID 2001221) tested in 10 T cell assays.	IEDB	2001221	751	767	NLLLQYGSFCTQLNRAL	ECO:0000213	PubMed	39284068
P0DTC2	IPTNFTISVTTEILP is a linear peptidic epitope (epitope ID 2122262) tested in 1 T cell assay and 10 MHC ligand assays.	IEDB	2122262	714	728	IPTNFTISVTTEILP	ECO:0000213	PubMed	35486722
P0DTC2	LQSYGFQPTNGVGYQ is a linear peptidic epitope (epitope ID 2124507) tested in 16 T cell assays, 8 B cell assays and 10 MHC ligand assays.	IEDB	2124507	492	506	LQSYGFQPTNGVGYQ	ECO:0000213	PubMed	35891550
P0DTC2	NITRFQTLLALHRSY is a linear peptidic epitope (epitope ID 2125471) tested in 1 T cell assay and 9 MHC ligand assays.	IEDB	2125471	234	248	NITRFQTLLALHRSY	ECO:0000213	PubMed	38105139
P0DTC2	NRKRISNCVADYSVL is a linear peptidic epitope (epitope ID 2125711) tested in 1 T cell assay and 9 MHC ligand assays.	IEDB	2125711	354	368	NRKRISNCVADYSVL	ECO:0000213	PubMed	35699447
P0DTC2	SNVTWFHAIHVSGTN is a linear peptidic epitope (epitope ID 2127915) tested in 18 T cell assays and 12 MHC ligand assays.	IEDB	2127915	60	74	SNVTWFHAIHVSGTN	ECO:0000213	PubMed	35891550
P0DTC2	SNVTWFHAIHVSGTN is a linear peptidic epitope (epitope ID 2127915) tested in 18 T cell assays and 12 MHC ligand assays.	IEDB	2127915	60	74	SNVTWFHAIHVSGTN	ECO:0000213	PubMed	36680141
P0DTC2	SNVTWFHAIHVSGTN is a linear peptidic epitope (epitope ID 2127915) tested in 18 T cell assays and 12 MHC ligand assays.	IEDB	2127915	60	74	SNVTWFHAIHVSGTN	ECO:0000213	PubMed	38105139
P0DTC2	FIKQYGDCLGD is a linear peptidic epitope (epitope ID 2131447) tested in 1 T cell assay.	IEDB	2131447	833	843	FIKQYGDCLGD	ECO:0000213	PubMed	34647971
P0DTC2	FNATRFASVYAWNRK is a linear peptidic epitope (epitope ID 2131491) tested in 1 T cell assay, 8 B cell assays and 7 MHC ligand assays.	IEDB	2131491	342	356	FNATRFASVYAWNRK	ECO:0000213	PubMed	35699447
P0DTC2	IRGDEVRQIAPGQTGKIADYNYKLPD is a linear peptidic epitope (epitope ID 2131962) tested in 1 B cell assay.	IEDB	2131962	402	427	IRGDEVRQIAPGQTGKIADYNYKLPD	ECO:0000213	PubMed	34684763
P0DTC2	LLQYGSF is a linear peptidic epitope (epitope ID 2132361) tested in 4 T cell assays.	IEDB	2132361	753	759	LLQYGSF	ECO:0000213	PubMed	34647971
P0DTC2	NFNFNGLTGTGVLTE is a linear peptidic epitope (epitope ID 2132629) tested in 16 T cell assays and 7 MHC ligand assays.	IEDB	2132629	540	554	NFNFNGLTGTGVLTE	ECO:0000213	PubMed	35891550
P0DTC2	NLREFVFKNIDGYFK is a linear peptidic epitope (epitope ID 2132665) tested in 8 MHC ligand assays.	IEDB	2132665	188	202	NLREFVFKNIDGYFK	ECO:0000213	PubMed	38117652
P0DTC2	QALNTLVKQLS is a linear peptidic epitope (epitope ID 2132861) tested in 4 T cell assays.	IEDB	2132861	957	967	QALNTLVKQLS	ECO:0000213	PubMed	34647971
P0DTC2	QALNTLVKQLS is a linear peptidic epitope (epitope ID 2132861) tested in 4 T cell assays.	IEDB	2132861	957	967	QALNTLVKQLS	ECO:0000213	PubMed	35857584
P0DTC2	QALNTLVKQLS is a linear peptidic epitope (epitope ID 2132861) tested in 4 T cell assays.	IEDB	2132861	957	967	QALNTLVKQLS	ECO:0000213	PubMed	38716629
P0DTC2	QSAPHGVVFL is a linear peptidic epitope (epitope ID 2132927) tested in 1 T cell assay.	IEDB	2132927	1054	1063	QSAPHGVVFL	ECO:0000213	PubMed	35486722
P0DTC2	TNGVGYQPYRVVVLS is a linear peptidic epitope (epitope ID 2133422) tested in 17 T cell assays and 9 MHC ligand assays.	IEDB	2133422	500	514	TNGVGYQPYRVVVLS	ECO:0000213	PubMed	35891550
P0DTC2	TNGVGYQPYRVVVLS is a linear peptidic epitope (epitope ID 2133422) tested in 17 T cell assays and 9 MHC ligand assays.	IEDB	2133422	500	514	TNGVGYQPYRVVVLS	ECO:0000213	PubMed	36680141
P0DTC2	VYAWNRKRISNCVAD is a linear peptidic epitope (epitope ID 2133791) tested in 1 T cell assay and 7 MHC ligand assays.	IEDB	2133791	350	364	VYAWNRKRISNCVAD	ECO:0000213	PubMed	35699447
P0DTC2	AEIRASANLAA is a linear peptidic epitope (epitope ID 2133990) tested in 2 T cell assays.	IEDB	2133990	1016	1026	AEIRASANLAA	ECO:0000213	PubMed	35857584
P0DTC2	APATVCGPK is a linear peptidic epitope (epitope ID 2134003) tested in 1 T cell assay.	IEDB	2134003	520	528	APATVCGPK	ECO:0000213	PubMed	34793243
P0DTC2	DGYFKIYSKHT is a linear peptidic epitope (epitope ID 2134026) tested in 1 T cell assay.	IEDB	2134026	198	208	DGYFKIYSKHT	ECO:0000213	PubMed	35857584
P0DTC2	FLPFFSNVT is a linear peptidic epitope (epitope ID 2134063) tested in 2 T cell assays.	IEDB	2134063	55	63	FLPFFSNVT	ECO:0000213	PubMed	34793243
P0DTC2	FLVLLPLVS is a linear peptidic epitope (epitope ID 2134064) tested in 2 T cell assays.	IEDB	2134064	4	12	FLVLLPLVS	ECO:0000213	PubMed	34793243
P0DTC2	FPNITNLCP is a linear peptidic epitope (epitope ID 2134072) tested in 1 T cell assay.	IEDB	2134072	329	337	FPNITNLCP	ECO:0000213	PubMed	34793243
P0DTC2	FSNVTWFHA is a linear peptidic epitope (epitope ID 2134076) tested in 1 T cell assay.	IEDB	2134076	59	67	FSNVTWFHA	ECO:0000213	PubMed	34793243
P0DTC2	GEVFNATRFASV is a linear peptidic epitope (epitope ID 2134090) tested in 1 T cell assay.	IEDB	2134090	339	350	GEVFNATRFASV	ECO:0000213	PubMed	35857584
P0DTC2	GLIAIVMVT is a linear peptidic epitope (epitope ID 2134095) tested in 2 T cell assays.	IEDB	2134095	1223	1231	GLIAIVMVT	ECO:0000213	PubMed	34793243
P0DTC2	ILPDPSKPS is a linear peptidic epitope (epitope ID 2134113) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	2134113	805	813	ILPDPSKPS	ECO:0000213	PubMed	34793243
P0DTC2	IMLCCMTSC is a linear peptidic epitope (epitope ID 2134115) tested in 3 T cell assays.	IEDB	2134115	1232	1240	IMLCCMTSC	ECO:0000213	PubMed	34793243
P0DTC2	IPFAMQMAYRF is a linear peptidic epitope (epitope ID 2134117) tested in 3 T cell assays.	IEDB	2134117	896	906	IPFAMQMAYRF	ECO:0000213	PubMed	35857584
P0DTC2	ITSGWTFGA is a linear peptidic epitope (epitope ID 2134127) tested in 1 T cell assay.	IEDB	2134127	882	890	ITSGWTFGA	ECO:0000213	PubMed	34793243
P0DTC2	KGIYQTSNFRV is a linear peptidic epitope (epitope ID 2134134) tested in 4 T cell assays.	IEDB	2134134	310	320	KGIYQTSNFRV	ECO:0000213	PubMed	35857584
P0DTC2	LPDDFTGCV is a linear peptidic epitope (epitope ID 2134172) tested in 1 T cell assay.	IEDB	2134172	425	433	LPDDFTGCV	ECO:0000213	PubMed	34793243
P0DTC2	QPYRVVVLS is a linear peptidic epitope (epitope ID 2134241) tested in 1 T cell assay.	IEDB	2134241	506	514	QPYRVVVLS	ECO:0000213	PubMed	34793243
P0DTC2	QTLLALHRSYL is a linear peptidic epitope (epitope ID 2134243) tested in 1 T cell assay.	IEDB	2134243	239	249	QTLLALHRSYL	ECO:0000213	PubMed	35857584
P0DTC2	SLSSTASAL is a linear peptidic epitope (epitope ID 2134274) tested in 7 T cell assays.	IEDB	2134274	937	945	SLSSTASAL	ECO:0000213	PubMed	34793243
P0DTC2	SLSSTASAL is a linear peptidic epitope (epitope ID 2134274) tested in 7 T cell assays.	IEDB	2134274	937	945	SLSSTASAL	ECO:0000213	PubMed	38539271
P0DTC2	STECSNLLL is a linear peptidic epitope (epitope ID 2134285) tested in 4 T cell assays.	IEDB	2134285	746	754	STECSNLLL	ECO:0000213	PubMed	34793243
P0DTC2	VFLVLLPLV is a linear peptidic epitope (epitope ID 2134320) tested in 3 T cell assays.	IEDB	2134320	3	11	VFLVLLPLV	ECO:0000213	PubMed	34793243
P0DTC2	VLSFELLHA is a linear peptidic epitope (epitope ID 2134327) tested in 3 T cell assays.	IEDB	2134327	512	520	VLSFELLHA	ECO:0000213	PubMed	34793243
P0DTC2	WMESEFRVY is a linear peptidic epitope (epitope ID 2134346) tested in 1 T cell assay.	IEDB	2134346	152	160	WMESEFRVY	ECO:0000213	PubMed	34793243
P0DTC2	YLYRLFRKSNL is a linear peptidic epitope (epitope ID 2134361) tested in 6 T cell assays.	IEDB	2134361	451	461	YLYRLFRKSNL	ECO:0000213	PubMed	37809871
P0DTC2	YSSANNCTF is a linear peptidic epitope (epitope ID 2134368) tested in 2 T cell assays.	IEDB	2134368	160	168	YSSANNCTF	ECO:0000213	PubMed	34793243
P0DTC2	YSSANNCTF is a linear peptidic epitope (epitope ID 2134368) tested in 2 T cell assays.	IEDB	2134368	160	168	YSSANNCTF	ECO:0000213	PubMed	38105139
P0DTC2	YTNSFTRGV is a linear peptidic epitope (epitope ID 2134375) tested in 6 T cell assays.	IEDB	2134375	28	36	YTNSFTRGV	ECO:0000213	PubMed	34793243
P0DTC2	LLTDEMIAQYTSALLAGTI is a linear peptidic epitope (epitope ID 2134455) tested in 2 T cell assays.	IEDB	2134455	864	882	LLTDEMIAQYTSALLAGTI	ECO:0000213	PubMed	34647971
P0DTC2	QAGSTPCNGV is a linear peptidic epitope (epitope ID 2144692) tested in 3 B cell assays.	IEDB	2144692	474	483	QAGSTPCNGV	ECO:0000213	PubMed	36195474
P0DTC2	CTFEYVSQPFLMD is a linear peptidic epitope (epitope ID 2144790) tested in 2 T cell assays.	IEDB	2144790	166	178	CTFEYVSQPFLMD	ECO:0000213	PubMed	35484232
P0DTC2	RAAEIRASA is a linear peptidic epitope (epitope ID 2150193) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	2150193	1014	1022	RAAEIRASA	ECO:0000213	PubMed	36254196
P0DTC2	RAAEIRASA is a linear peptidic epitope (epitope ID 2150193) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	2150193	1014	1022	RAAEIRASA	ECO:0000213	PubMed	38045681
P0DTC2	ASFSTFKCY is a linear peptidic epitope (epitope ID 2157658) tested in 3 T cell assays.	IEDB	2157658	372	380	ASFSTFKCY	ECO:0000213	PubMed	38045681
P0DTC2	ECSNLLLQY is a linear peptidic epitope (epitope ID 2157666) tested in 2 T cell assays.	IEDB	2157666	748	756	ECSNLLLQY	ECO:0000213	PubMed	36603583
P0DTC2	YLQPRTFLLK is a linear peptidic epitope (epitope ID 2157762) tested in 5 T cell assays.	IEDB	2157762	269	278	YLQPRTFLLK	ECO:0000213	PubMed	37193826
P0DTC2	YLQPRTFLLK is a linear peptidic epitope (epitope ID 2157762) tested in 5 T cell assays.	IEDB	2157762	269	278	YLQPRTFLLK	ECO:0000213	PubMed	38716629
P0DTC2	YLQPRTFLLK is a linear peptidic epitope (epitope ID 2157762) tested in 5 T cell assays.	IEDB	2157762	269	278	YLQPRTFLLK	ECO:0000213	PubMed	38781962
P0DTC2	PRRARSVASQS is a linear peptidic epitope (epitope ID 2157781) tested in 3 B cell assays.	IEDB	2157781	681	691	PRRARSVASQS	ECO:0000213	PubMed	36508877
P0DTC2	FIEDLLF is a linear peptidic epitope (epitope ID 2163762) tested in 5 B cell assays and has 3D structure(s) 7yue.	IEDB	2163762	817	823	FIEDLLF	ECO:0000213	PubMed	36691733
P0DTC2	AWNRKRI is a linear peptidic epitope (epitope ID 2187455) tested in 3 B cell assays.	IEDB	2187455	352	358	AWNRKRI	ECO:0000213	PubMed	36658749
P0DTC2	CPFGEVFN is a linear peptidic epitope (epitope ID 2187458) tested in 2 B cell assays.	IEDB	2187458	336	343	CPFGEVFN	ECO:0000213	PubMed	36685521
P0DTC2	CPFGEVFNAT is a linear peptidic epitope (epitope ID 2187459) tested in 2 B cell assays.	IEDB	2187459	336	345	CPFGEVFNAT	ECO:0000213	PubMed	36685521
P0DTC2	DEVRQIAPGQT is a linear peptidic epitope (epitope ID 2187466) tested in 2 B cell assays.	IEDB	2187466	405	415	DEVRQIAPGQT	ECO:0000213	PubMed	36658749
P0DTC2	DISTEIYQAG is a linear peptidic epitope (epitope ID 2187467) tested in 1 B cell assay.	IEDB	2187467	467	476	DISTEIYQAG	ECO:0000213	PubMed	36658749
P0DTC2	DSFVIRGDEV is a linear peptidic epitope (epitope ID 2187470) tested in 1 B cell assay.	IEDB	2187470	398	407	DSFVIRGDEV	ECO:0000213	PubMed	36658749
P0DTC2	FPLQSYGF is a linear peptidic epitope (epitope ID 2187484) tested in 1 B cell assay.	IEDB	2187484	490	497	FPLQSYGF	ECO:0000213	PubMed	36658749
P0DTC2	FSTFKCY is a linear peptidic epitope (epitope ID 2187488) tested in 1 B cell assay.	IEDB	2187488	374	380	FSTFKCY	ECO:0000213	PubMed	36658749
P0DTC2	GFQPTNGVG is a linear peptidic epitope (epitope ID 2187490) tested in 1 B cell assay.	IEDB	2187490	496	504	GFQPTNGVG	ECO:0000213	PubMed	36658749
P0DTC2	ITNLCPFGEV is a linear peptidic epitope (epitope ID 2187499) tested in 1 T cell assay, 3 B cell assays and 1 MHC ligand assay.	IEDB	2187499	332	341	ITNLCPFGEV	ECO:0000213	PubMed	36658749
P0DTC2	LCPFGEV is a linear peptidic epitope (epitope ID 2187509) tested in 1 B cell assay.	IEDB	2187509	335	341	LCPFGEV	ECO:0000213	PubMed	36658749
P0DTC2	NCYFPLQSY is a linear peptidic epitope (epitope ID 2187526) tested in 1 B cell assay.	IEDB	2187526	487	495	NCYFPLQSY	ECO:0000213	PubMed	36658749
P0DTC2	NLVKNKCVNF is a linear peptidic epitope (epitope ID 2187529) tested in 1 B cell assay.	IEDB	2187529	532	541	NLVKNKCVNF	ECO:0000213	PubMed	36658749
P0DTC2	PFGEVFN is a linear peptidic epitope (epitope ID 2187534) tested in 1 B cell assay.	IEDB	2187534	337	343	PFGEVFN	ECO:0000213	PubMed	36658749
P0DTC2	PYRVVVLSFE is a linear peptidic epitope (epitope ID 2187536) tested in 2 B cell assays.	IEDB	2187536	507	516	PYRVVVLSFE	ECO:0000213	PubMed	36685521
P0DTC2	RVQPTESIV is a linear peptidic epitope (epitope ID 2187549) tested in 1 B cell assay.	IEDB	2187549	319	327	RVQPTESIV	ECO:0000213	PubMed	36658749
P0DTC2	RVVVLSFE is a linear peptidic epitope (epitope ID 2187551) tested in 2 B cell assays.	IEDB	2187551	509	516	RVVVLSFE	ECO:0000213	PubMed	36685521
P0DTC2	SNLKPFERD is a linear peptidic epitope (epitope ID 2187553) tested in 1 B cell assay.	IEDB	2187553	459	467	SNLKPFERD	ECO:0000213	PubMed	36658749
P0DTC2	STNLVKNKCVN is a linear peptidic epitope (epitope ID 2187555) tested in 1 B cell assay.	IEDB	2187555	530	540	STNLVKNKCVN	ECO:0000213	PubMed	36658749
P0DTC2	SVYAWNRKRI is a linear peptidic epitope (epitope ID 2187556) tested in 1 B cell assay.	IEDB	2187556	349	358	SVYAWNRKRI	ECO:0000213	PubMed	36658749
P0DTC2	VIRGDEV is a linear peptidic epitope (epitope ID 2187566) tested in 1 B cell assay.	IEDB	2187566	401	407	VIRGDEV	ECO:0000213	PubMed	36658749
P0DTC2	VKNKCVNF is a linear peptidic epitope (epitope ID 2187568) tested in 2 B cell assays.	IEDB	2187568	534	541	VKNKCVNF	ECO:0000213	PubMed	36658749
P0DTC2	VVVLSFELLH is a linear peptidic epitope (epitope ID 2187570) tested in 1 B cell assay.	IEDB	2187570	510	519	VVVLSFELLH	ECO:0000213	PubMed	36658749
P0DTC2	DSFKEEL is a linear peptidic epitope (epitope ID 2188065) tested in 12 B cell assays.	IEDB	2188065	1146	1152	DSFKEEL	ECO:0000213	PubMed	36550570
P0DTC2	YGVSPTKLNDLCF is a linear peptidic epitope (epitope ID 2223095) tested in 4 B cell assays.	IEDB	2223095	380	392	YGVSPTKLNDLCF	ECO:0000213	PubMed	36851165
P0DTC2	ALQIPFAMQM is a linear peptidic epitope (epitope ID 2223973) tested in 5 T cell assays.	IEDB	2223973	893	902	ALQIPFAMQM	ECO:0000213	PubMed	37193826
P0DTC2	EQYIKWPWYI is a linear peptidic epitope (epitope ID 2223989) tested in 1 T cell assay.	IEDB	2223989	1207	1216	EQYIKWPWYI	ECO:0000213	PubMed	37193826
P0DTC2	EQYIKWPWYIW is a linear peptidic epitope (epitope ID 2223990) tested in 1 T cell assay.	IEDB	2223990	1207	1217	EQYIKWPWYIW	ECO:0000213	PubMed	37193826
P0DTC2	FQFCNDPFLG is a linear peptidic epitope (epitope ID 2223998) tested in 1 T cell assay.	IEDB	2223998	133	142	FQFCNDPFLG	ECO:0000213	PubMed	37193826
P0DTC2	KLIANQFNSA is a linear peptidic epitope (epitope ID 2224021) tested in 1 T cell assay.	IEDB	2224021	921	930	KLIANQFNSA	ECO:0000213	PubMed	37193826
P0DTC2	KWPWYIWLGFI is a linear peptidic epitope (epitope ID 2224023) tested in 1 T cell assay.	IEDB	2224023	1211	1221	KWPWYIWLGFI	ECO:0000213	PubMed	37193826
P0DTC2	KYEQYIKWPW is a linear peptidic epitope (epitope ID 2224024) tested in 1 T cell assay.	IEDB	2224024	1205	1214	KYEQYIKWPW	ECO:0000213	PubMed	37193826
P0DTC2	MIAQYTSALL is a linear peptidic epitope (epitope ID 2224035) tested in 2 T cell assays.	IEDB	2224035	869	878	MIAQYTSALL	ECO:0000213	PubMed	37193826
P0DTC2	NSPRRARSVAS is a linear peptidic epitope (epitope ID 2224044) tested in 1 T cell assay.	IEDB	2224044	679	689	NSPRRARSVAS	ECO:0000213	PubMed	37193826
P0DTC2	RVYSSANNCTF is a linear peptidic epitope (epitope ID 2224057) tested in 1 T cell assay.	IEDB	2224057	158	168	RVYSSANNCTF	ECO:0000213	PubMed	37193826
P0DTC2	SPRRARSVAS is a linear peptidic epitope (epitope ID 2224065) tested in 7 T cell assays.	IEDB	2224065	680	689	SPRRARSVAS	ECO:0000213	PubMed	37193826
P0DTC2	SPRRARSVASQ is a linear peptidic epitope (epitope ID 2224066) tested in 1 T cell assay.	IEDB	2224066	680	690	SPRRARSVASQ	ECO:0000213	PubMed	37193826
P0DTC2	VYSSANNCTFE is a linear peptidic epitope (epitope ID 2224085) tested in 1 T cell assay.	IEDB	2224085	159	169	VYSSANNCTFE	ECO:0000213	PubMed	37193826
P0DTC2	YPDKVFRSSV is a linear peptidic epitope (epitope ID 2224095) tested in 7 T cell assays.	IEDB	2224095	38	47	YPDKVFRSSV	ECO:0000213	PubMed	37193826
P0DTC2	YPDKVFRSSVL is a linear peptidic epitope (epitope ID 2224096) tested in 3 T cell assays.	IEDB	2224096	38	48	YPDKVFRSSVL	ECO:0000213	PubMed	37193826
P0DTC2	KTPPIKDFGGFNFSQILPD is a linear peptidic epitope (epitope ID 2231389) tested in 1 B cell assay.	IEDB	2231389	790	808	KTPPIKDFGGFNFSQILPD	ECO:0000213	PubMed	37251407
P0DTC2	KYNENGTITDAVDCALDPLSE is a linear peptidic epitope (epitope ID 2231401) tested in 6 B cell assays.	IEDB	2231401	278	298	KYNENGTITDAVDCALDPLSE	ECO:0000213	PubMed	37251407
P0DTC2	NGVEGFNCYFP is a linear peptidic epitope (epitope ID 2231602) tested in 6 B cell assays.	IEDB	2231602	481	491	NGVEGFNCYFP	ECO:0000213	PubMed	37251407
P0DTC2	NVYADSF is a linear peptidic epitope (epitope ID 2231693) tested in 1 B cell assay.	IEDB	2231693	394	400	NVYADSF	ECO:0000213	PubMed	37251407
P0DTC2	PGTNTSNQVAVLYQDVNC is a linear peptidic epitope (epitope ID 2231718) tested in 1 B cell assay.	IEDB	2231718	600	617	PGTNTSNQVAVLYQDVNC	ECO:0000213	PubMed	37251407
P0DTC2	QYGDCLGDI is a linear peptidic epitope (epitope ID 2231818) tested in 1 B cell assay.	IEDB	2231818	836	844	QYGDCLGDI	ECO:0000213	PubMed	37251407
P0DTC2	SRLDKVEAEVQID is a linear peptidic epitope (epitope ID 2232006) tested in 2 B cell assays.	IEDB	2232006	982	994	SRLDKVEAEVQID	ECO:0000213	PubMed	37251407
P0DTC2	SVYAWNRKRIS is a linear peptidic epitope (epitope ID 2236868) tested in 1 T cell assay and 5 B cell assays.	IEDB	2236868	349	359	SVYAWNRKRIS	ECO:0000213	PubMed	38716629
P0DTC2	GPKKSTNLVKN is a linear peptidic epitope (epitope ID 2237355) tested in 2 B cell assays.	IEDB	2237355	526	536	GPKKSTNLVKN	ECO:0000213	PubMed	37798298
P0DTC2	LKPFERDIST is a linear peptidic epitope (epitope ID 2237591) tested in 7 T cell assays.	IEDB	2237591	461	470	LKPFERDIST	ECO:0000213	PubMed	37809871
P0DTC2	RLFRKSNL is a linear peptidic epitope (epitope ID 2237788) tested in 9 T cell assays.	IEDB	2237788	454	461	RLFRKSNL	ECO:0000213	PubMed	37809871
P0DTC2	VLYENQKL is a linear peptidic epitope (epitope ID 2243367) tested in 2 T cell assays.	IEDB	2243367	915	922	VLYENQKL	ECO:0000213	PubMed	37886945
P0DTC2	EMIAQYTSAL is a linear peptidic epitope (epitope ID 2249080) tested in 1 T cell assay.	IEDB	2249080	868	877	EMIAQYTSAL	ECO:0000213	PubMed	38045681
P0DTC2	FVFKNIDGYF is a linear peptidic epitope (epitope ID 2249084) tested in 1 T cell assay.	IEDB	2249084	192	201	FVFKNIDGYF	ECO:0000213	PubMed	38045681
P0DTC2	IAIVMVTIM is a linear peptidic epitope (epitope ID 2249088) tested in 1 T cell assay.	IEDB	2249088	1225	1233	IAIVMVTIM	ECO:0000213	PubMed	38045681
P0DTC2	MAYRFNGIG is a linear peptidic epitope (epitope ID 2249096) tested in 1 T cell assay.	IEDB	2249096	902	910	MAYRFNGIG	ECO:0000213	PubMed	38045681
P0DTC2	WTAGAAAYYV is a linear peptidic epitope (epitope ID 2249113) tested in 1 T cell assay.	IEDB	2249113	258	267	WTAGAAAYYV	ECO:0000213	PubMed	38045681
P0DTC2	AALQIPFAMQMAYR is a linear peptidic epitope (epitope ID 2249176) tested in 1 MHC ligand assay.	IEDB	2249176	892	905	AALQIPFAMQMAYR	ECO:0000213	PubMed	38117652
P0DTC2	CSNLLLQYGSFCTQ is a linear peptidic epitope (epitope ID 2249521) tested in 1 MHC ligand assay.	IEDB	2249521	749	762	CSNLLLQYGSFCTQ	ECO:0000213	PubMed	38117652
P0DTC2	LIRAAEIRAS is a linear peptidic epitope (epitope ID 2250964) tested in 1 MHC ligand assay.	IEDB	2250964	1012	1021	LIRAAEIRAS	ECO:0000213	PubMed	38117652
P0DTC2	LQIPFAMQMAYRFN is a linear peptidic epitope (epitope ID 2251076) tested in 1 MHC ligand assay.	IEDB	2251076	894	907	LQIPFAMQMAYRFN	ECO:0000213	PubMed	38117652
P0DTC2	QLIRAAEIRAS is a linear peptidic epitope (epitope ID 2251622) tested in 1 MHC ligand assay.	IEDB	2251622	1011	1021	QLIRAAEIRAS	ECO:0000213	PubMed	38117652
P0DTC2	QQLIRAAEIRASA is a linear peptidic epitope (epitope ID 2251642) tested in 1 MHC ligand assay.	IEDB	2251642	1010	1022	QQLIRAAEIRASA	ECO:0000213	PubMed	38117652
P0DTC2	QTQTNSPRRARSV is a linear peptidic epitope (epitope ID 2251677) tested in 1 T cell assay.	IEDB	2251677	675	687	QTQTNSPRRARSV	ECO:0000213	PubMed	38105139
P0DTC2	RALTGIAVEQDKNT is a linear peptidic epitope (epitope ID 2251701) tested in 1 MHC ligand assay.	IEDB	2251701	765	778	RALTGIAVEQDKNT	ECO:0000213	PubMed	38117652
P0DTC2	TDEMIAQYTSALL is a linear peptidic epitope (epitope ID 2252197) tested in 1 MHC ligand assay.	IEDB	2252197	866	878	TDEMIAQYTSALL	ECO:0000213	PubMed	38117652
P0DTC2	TQQLIRAAEIRAS is a linear peptidic epitope (epitope ID 2252341) tested in 1 MHC ligand assay.	IEDB	2252341	1009	1021	TQQLIRAAEIRAS	ECO:0000213	PubMed	38117652
P0DTC2	VRDPQTLEI is a linear peptidic epitope (epitope ID 2253124) tested in 2 T cell assays and 2 MHC ligand assays.	IEDB	2253124	576	584	VRDPQTLEI	ECO:0000213	PubMed	38257752
P0DTC2	DEMIAQYTS is a linear peptidic epitope (epitope ID 2259122) tested in 1 T cell assay.	IEDB	2259122	867	875	DEMIAQYTS	ECO:0000213	PubMed	38781962
P0DTC2	FELLHAPAT is a linear peptidic epitope (epitope ID 2259154) tested in 1 T cell assay.	IEDB	2259154	515	523	FELLHAPAT	ECO:0000213	PubMed	38781962
P0DTC2	GEVFNATRFA is a linear peptidic epitope (epitope ID 2259171) tested in 1 T cell assay.	IEDB	2259171	339	348	GEVFNATRFA	ECO:0000213	PubMed	38781962
P0DTC2	QTQTNSPRR is a linear peptidic epitope (epitope ID 2259223) tested in 1 T cell assay.	IEDB	2259223	675	683	QTQTNSPRR	ECO:0000213	PubMed	38781962
P0DTC2	SETKCTLKS is a linear peptidic epitope (epitope ID 2259235) tested in 1 T cell assay.	IEDB	2259235	297	305	SETKCTLKS	ECO:0000213	PubMed	38781962
P0DTC2	TEIYQAGSTP is a linear peptidic epitope (epitope ID 2259242) tested in 1 T cell assay.	IEDB	2259242	470	479	TEIYQAGSTP	ECO:0000213	PubMed	38781962
P0DTC2	TLDSKTQSLL is a linear peptidic epitope (epitope ID 2259243) tested in 1 T cell assay.	IEDB	2259243	109	118	TLDSKTQSLL	ECO:0000213	PubMed	38781962
P0DTC2	VEKGIYQTS is a linear peptidic epitope (epitope ID 2259244) tested in 1 T cell assay.	IEDB	2259244	308	316	VEKGIYQTS	ECO:0000213	PubMed	38781962
P0DTC2	VQPTESIVRF is a linear peptidic epitope (epitope ID 2259250) tested in 1 T cell assay.	IEDB	2259250	320	329	VQPTESIVRF	ECO:0000213	PubMed	38781962
P0DTC2	FRKSNLKPF is a linear peptidic epitope (epitope ID 2266978) tested in 1 T cell assay.	IEDB	2266978	456	464	FRKSNLKPF	ECO:0000213	PubMed	38866784
P0DTC2	FCNDPFLGVYYHKNNKSWMESEFRVYSSANNC is a linear peptidic epitope (epitope ID 2268477) tested in 1 T cell assay.	IEDB	2268477	135	166	FCNDPFLGVYYHKNNKSWMESEFRVYSSANNC	ECO:0000213	PubMed	39456150
P0DTC2	IYSKHTPINLVRDLPQGFSALEPLVDLP is a linear peptidic epitope (epitope ID 2268517) tested in 1 T cell assay.	IEDB	2268517	203	230	IYSKHTPINLVRDLPQGFSALEPLVDLP	ECO:0000213	PubMed	39456150
P0DTC2	KLQDVVNQNA is a linear peptidic epitope (epitope ID 2268520) tested in 1 T cell assay.	IEDB	2268520	947	956	KLQDVVNQNA	ECO:0000213	PubMed	39456150
P0DTC2	TVYDPLQPEL is a linear peptidic epitope (epitope ID 2268600) tested in 1 T cell assay.	IEDB	2268600	1136	1145	TVYDPLQPEL	ECO:0000213	PubMed	39456150
P0DTC2	VLYQDVNCTEV is a linear peptidic epitope (epitope ID 2268607) tested in 1 T cell assay.	IEDB	2268607	610	620	VLYQDVNCTEV	ECO:0000213	PubMed	39456150
P0DTC2	EIRASANLAAT is a linear peptidic epitope (epitope ID 2269514) tested in 1 T cell assay.	IEDB	2269514	1017	1027	EIRASANLAAT	ECO:0000213	PubMed	38716629
P0DTC2	FIKQYGD is a linear peptidic epitope (epitope ID 2269533) tested in 1 T cell assay.	IEDB	2269533	833	839	FIKQYGD	ECO:0000213	PubMed	38716629
P0DTC2	FKIYSKHTPIN is a linear peptidic epitope (epitope ID 2269537) tested in 4 T cell assays.	IEDB	2269537	201	211	FKIYSKHTPIN	ECO:0000213	PubMed	38716629
P0DTC2	KRFDNPVLPFN is a linear peptidic epitope (epitope ID 2269638) tested in 1 T cell assay.	IEDB	2269638	77	87	KRFDNPVLPFN	ECO:0000213	PubMed	38716629
P0DTC2	KVFRSSVLHST is a linear peptidic epitope (epitope ID 2269648) tested in 1 T cell assay.	IEDB	2269648	41	51	KVFRSSVLHST	ECO:0000213	PubMed	38716629
P0DTC2	LLALHRSYLTP is a linear peptidic epitope (epitope ID 2269657) tested in 4 T cell assays.	IEDB	2269657	241	251	LLALHRSYLTP	ECO:0000213	PubMed	38716629
P0DTC2	LLQYGSFCTQL is a linear peptidic epitope (epitope ID 2269661) tested in 2 T cell assays.	IEDB	2269661	753	763	LLQYGSFCTQL	ECO:0000213	PubMed	38716629
P0DTC2	LVKNKCVNFNF is a linear peptidic epitope (epitope ID 2269683) tested in 2 T cell assays.	IEDB	2269683	533	543	LVKNKCVNFNF	ECO:0000213	PubMed	38716629
P0DTC2	MIAQYTSALLA is a linear peptidic epitope (epitope ID 2269693) tested in 2 T cell assays.	IEDB	2269693	869	879	MIAQYTSALLA	ECO:0000213	PubMed	38716629
P0DTC2	NFTISVTTEIL is a linear peptidic epitope (epitope ID 2269707) tested in 1 T cell assay.	IEDB	2269707	717	727	NFTISVTTEIL	ECO:0000213	PubMed	38716629
P0DTC2	NQFNSAIGKIQ is a linear peptidic epitope (epitope ID 2269723) tested in 2 T cell assays.	IEDB	2269723	925	935	NQFNSAIGKIQ	ECO:0000213	PubMed	38716629
P0DTC2	QNVLYENQKLI is a linear peptidic epitope (epitope ID 2269769) tested in 2 T cell assays.	IEDB	2269769	913	923	QNVLYENQKLI	ECO:0000213	PubMed	38716629
P0DTC2	RFNGIGVTQNV is a linear peptidic epitope (epitope ID 2269777) tested in 2 T cell assays.	IEDB	2269777	905	915	RFNGIGVTQNV	ECO:0000213	PubMed	38716629
P0DTC2	RSVASQSIIAY is a linear peptidic epitope (epitope ID 2269788) tested in 3 T cell assays.	IEDB	2269788	685	695	RSVASQSIIAY	ECO:0000213	PubMed	38716629
P0DTC2	SIVRFPNITNL is a linear peptidic epitope (epitope ID 2269805) tested in 4 T cell assays.	IEDB	2269805	325	335	SIVRFPNITNL	ECO:0000213	PubMed	38716629
P0DTC2	SVTTEILPVSM is a linear peptidic epitope (epitope ID 2269851) tested in 2 T cell assays.	IEDB	2269851	721	731	SVTTEILPVSM	ECO:0000213	PubMed	38716629
P0DTC2	TRGVYYPDKVF is a linear peptidic epitope (epitope ID 2269869) tested in 1 T cell assay.	IEDB	2269869	33	43	TRGVYYPDKVF	ECO:0000213	PubMed	38716629
P0DTC2	VIRGDEVRQIA is a linear peptidic epitope (epitope ID 2269892) tested in 2 T cell assays.	IEDB	2269892	401	411	VIRGDEVRQIA	ECO:0000213	PubMed	38716629
P0DTC2	WRVYSTGSNVF is a linear peptidic epitope (epitope ID 2269932) tested in 1 T cell assay.	IEDB	2269932	633	643	WRVYSTGSNVF	ECO:0000213	PubMed	38716629
P0DTC2	YIKWPWYIWL is a linear peptidic epitope (epitope ID 2269937) tested in 1 T cell assay.	IEDB	2269937	1209	1218	YIKWPWYIWL	ECO:0000213	PubMed	38716629
P0DTC3	ALSKGVHFV is a linear peptidic epitope (epitope ID 1074846) tested in 32 T cell assays and 3 MHC ligand assays.	IEDB	1074846	72	80	ALSKGVHFV	ECO:0000213	PubMed	34793243
P0DTC3	ALSKGVHFV is a linear peptidic epitope (epitope ID 1074846) tested in 32 T cell assays and 3 MHC ligand assays.	IEDB	1074846	72	80	ALSKGVHFV	ECO:0000213	PubMed	35383307
P0DTC3	ALSKGVHFV is a linear peptidic epitope (epitope ID 1074846) tested in 32 T cell assays and 3 MHC ligand assays.	IEDB	1074846	72	80	ALSKGVHFV	ECO:0000213	PubMed	35389886
P0DTC3	ALSKGVHFV is a linear peptidic epitope (epitope ID 1074846) tested in 32 T cell assays and 3 MHC ligand assays.	IEDB	1074846	72	80	ALSKGVHFV	ECO:0000213	PubMed	36254196
P0DTC3	ALSKGVHFV is a linear peptidic epitope (epitope ID 1074846) tested in 32 T cell assays and 3 MHC ligand assays.	IEDB	1074846	72	80	ALSKGVHFV	ECO:0000213	PubMed	36494499
P0DTC3	ALSKGVHFV is a linear peptidic epitope (epitope ID 1074846) tested in 32 T cell assays and 3 MHC ligand assays.	IEDB	1074846	72	80	ALSKGVHFV	ECO:0000213	PubMed	38387105
P0DTC3	ALSKGVHFV is a linear peptidic epitope (epitope ID 1074846) tested in 32 T cell assays and 3 MHC ligand assays.	IEDB	1074846	72	80	ALSKGVHFV	ECO:0000213	PubMed	32999467
P0DTC3	ALSKGVHFV is a linear peptidic epitope (epitope ID 1074846) tested in 32 T cell assays and 3 MHC ligand assays.	IEDB	1074846	72	80	ALSKGVHFV	ECO:0000213	PubMed	33427749
P0DTC3	ALSKGVHFV is a linear peptidic epitope (epitope ID 1074846) tested in 32 T cell assays and 3 MHC ligand assays.	IEDB	1074846	72	80	ALSKGVHFV	ECO:0000213	PubMed	33853928
P0DTC3	IPIQASLPF is a linear peptidic epitope (epitope ID 1074931) tested in 6 T cell assays.	IEDB	1074931	35	43	IPIQASLPF	ECO:0000213	PubMed	34793243
P0DTC3	YYQLYSTQL is a linear peptidic epitope (epitope ID 1087430) tested in 12 T cell assays and 1 MHC ligand assay.	IEDB	1087430	211	219	YYQLYSTQL	ECO:0000213	PubMed	34793243
P0DTC3	YYQLYSTQL is a linear peptidic epitope (epitope ID 1087430) tested in 12 T cell assays and 1 MHC ligand assay.	IEDB	1087430	211	219	YYQLYSTQL	ECO:0000213	PubMed	35389886
P0DTC3	YYQLYSTQL is a linear peptidic epitope (epitope ID 1087430) tested in 12 T cell assays and 1 MHC ligand assay.	IEDB	1087430	211	219	YYQLYSTQL	ECO:0000213	PubMed	32999467
P0DTC3	YYQLYSTQL is a linear peptidic epitope (epitope ID 1087430) tested in 12 T cell assays and 1 MHC ligand assay.	IEDB	1087430	211	219	YYQLYSTQL	ECO:0000213	PubMed	33853928
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	33972535
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	34729465
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	34793243
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	34968416
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	35157735
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	35196796
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	35383307
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	35389886
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	35484232
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	36254196
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	36603583
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	38077128
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	38387105
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	38932408
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	33128877
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	33184509
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	33427749
P0DTC3	FTSDYYQLY is a linear peptidic epitope (epitope ID 1309115) tested in 47 T cell assays and 2 MHC ligand assays.	IEDB	1309115	207	215	FTSDYYQLY	ECO:0000213	PubMed	33853928
P0DTC3	APFLYLYAL is a linear peptidic epitope (epitope ID 1310278) tested in 7 T cell assays.	IEDB	1310278	103	111	APFLYLYAL	ECO:0000213	PubMed	33853928
P0DTC3	FLYLYALVY is a linear peptidic epitope (epitope ID 1310408) tested in 5 T cell assays.	IEDB	1310408	105	113	FLYLYALVY	ECO:0000213	PubMed	33853928
P0DTC3	FMRIFTIGTVTLKQG is a linear peptidic epitope (epitope ID 1310411) tested in 8 T cell assays and 3 MHC ligand assays.	IEDB	1310411	4	18	FMRIFTIGTVTLKQG	ECO:0000213	PubMed	32999467
P0DTC3	SDFVRATATIPIQAS is a linear peptidic epitope (epitope ID 1310789) tested in 7 T cell assays and 3 MHC ligand assays.	IEDB	1310789	26	40	SDFVRATATIPIQAS	ECO:0000213	PubMed	35104433
P0DTC3	VYFLQSINF is a linear peptidic epitope (epitope ID 1310934) tested in 24 T cell assays and 2 MHC ligand assays.	IEDB	1310934	112	120	VYFLQSINF	ECO:0000213	PubMed	34506741
P0DTC3	VYFLQSINF is a linear peptidic epitope (epitope ID 1310934) tested in 24 T cell assays and 2 MHC ligand assays.	IEDB	1310934	112	120	VYFLQSINF	ECO:0000213	PubMed	34793243
P0DTC3	VYFLQSINF is a linear peptidic epitope (epitope ID 1310934) tested in 24 T cell assays and 2 MHC ligand assays.	IEDB	1310934	112	120	VYFLQSINF	ECO:0000213	PubMed	34968416
P0DTC3	VYFLQSINF is a linear peptidic epitope (epitope ID 1310934) tested in 24 T cell assays and 2 MHC ligand assays.	IEDB	1310934	112	120	VYFLQSINF	ECO:0000213	PubMed	35383307
P0DTC3	VYFLQSINF is a linear peptidic epitope (epitope ID 1310934) tested in 24 T cell assays and 2 MHC ligand assays.	IEDB	1310934	112	120	VYFLQSINF	ECO:0000213	PubMed	32999467
P0DTC3	VYFLQSINF is a linear peptidic epitope (epitope ID 1310934) tested in 24 T cell assays and 2 MHC ligand assays.	IEDB	1310934	112	120	VYFLQSINF	ECO:0000213	PubMed	33128877
P0DTC3	VYFLQSINF is a linear peptidic epitope (epitope ID 1310934) tested in 24 T cell assays and 2 MHC ligand assays.	IEDB	1310934	112	120	VYFLQSINF	ECO:0000213	PubMed	33427749
P0DTC3	VYFLQSINF is a linear peptidic epitope (epitope ID 1310934) tested in 24 T cell assays and 2 MHC ligand assays.	IEDB	1310934	112	120	VYFLQSINF	ECO:0000213	PubMed	36526616
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	34627082
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	34793243
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	34968416
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	35196796
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	35383307
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	35389886
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	35484232
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	36134660
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	36254196
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	36494499
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	38077128
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	38387105
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	38932408
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	33128877
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	33184509
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	38045681
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	33427749
P0DTC3	LLYDANYFL is a linear peptidic epitope (epitope ID 1311180) tested in 56 T cell assays and 7 MHC ligand assays.	IEDB	1311180	139	147	LLYDANYFL	ECO:0000213	PubMed	33853928
P0DTC3	YLYALVYFL is a linear peptidic epitope (epitope ID 1311604) tested in 19 T cell assays and 4 MHC ligand assays.	IEDB	1311604	107	115	YLYALVYFL	ECO:0000213	PubMed	34793243
P0DTC3	YLYALVYFL is a linear peptidic epitope (epitope ID 1311604) tested in 19 T cell assays and 4 MHC ligand assays.	IEDB	1311604	107	115	YLYALVYFL	ECO:0000213	PubMed	35484232
P0DTC3	YLYALVYFL is a linear peptidic epitope (epitope ID 1311604) tested in 19 T cell assays and 4 MHC ligand assays.	IEDB	1311604	107	115	YLYALVYFL	ECO:0000213	PubMed	33184509
P0DTC3	YLYALVYFL is a linear peptidic epitope (epitope ID 1311604) tested in 19 T cell assays and 4 MHC ligand assays.	IEDB	1311604	107	115	YLYALVYFL	ECO:0000213	PubMed	33427749
P0DTC3	LYLYALVYF is a linear peptidic epitope (epitope ID 1313129) tested in 7 T cell assays and 1 MHC ligand assay.	IEDB	1313129	106	114	LYLYALVYF	ECO:0000213	PubMed	34506741
P0DTC3	LYLYALVYF is a linear peptidic epitope (epitope ID 1313129) tested in 7 T cell assays and 1 MHC ligand assay.	IEDB	1313129	106	114	LYLYALVYF	ECO:0000213	PubMed	36603583
P0DTC3	SASKIITLK is a linear peptidic epitope (epitope ID 1313530) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1313530	58	66	SASKIITLK	ECO:0000213	PubMed	36603583
P0DTC3	SASKIITLK is a linear peptidic epitope (epitope ID 1313530) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1313530	58	66	SASKIITLK	ECO:0000213	PubMed	33427749
P0DTC3	HSYFTSDYY is a linear peptidic epitope (epitope ID 1318163) tested in 4 T cell assays.	IEDB	1318163	204	212	HSYFTSDYY	ECO:0000213	PubMed	34793243
P0DTC3	LPFGWLIV is a linear peptidic epitope (epitope ID 1321047) tested in 5 T cell assays.	IEDB	1321047	41	48	LPFGWLIV	ECO:0000213	PubMed	36603583
P0DTC3	QSASKIITL is a linear peptidic epitope (epitope ID 1323485) tested in 5 T cell assays.	IEDB	1323485	57	65	QSASKIITL	ECO:0000213	PubMed	33853928
P0DTC3	TVYSHLLLV is a linear peptidic epitope (epitope ID 1326046) tested in 11 T cell assays.	IEDB	1326046	89	97	TVYSHLLLV	ECO:0000213	PubMed	34793243
P0DTC3	TVYSHLLLV is a linear peptidic epitope (epitope ID 1326046) tested in 11 T cell assays.	IEDB	1326046	89	97	TVYSHLLLV	ECO:0000213	PubMed	36969239
P0DTC3	YFTSDYYQLY is a linear peptidic epitope (epitope ID 1327990) tested in 5 T cell assays.	IEDB	1327990	206	215	YFTSDYYQLY	ECO:0000213	PubMed	35157735
P0DTC3	YFTSDYYQLY is a linear peptidic epitope (epitope ID 1327990) tested in 5 T cell assays.	IEDB	1327990	206	215	YFTSDYYQLY	ECO:0000213	PubMed	35196796
P0DTC3	YFTSDYYQLY is a linear peptidic epitope (epitope ID 1327990) tested in 5 T cell assays.	IEDB	1327990	206	215	YFTSDYYQLY	ECO:0000213	PubMed	36302758
P0DTC3	YFTSDYYQLY is a linear peptidic epitope (epitope ID 1327990) tested in 5 T cell assays.	IEDB	1327990	206	215	YFTSDYYQLY	ECO:0000213	PubMed	33853928
P0DTC3	AAGLEAPFLY is a linear peptidic epitope (epitope ID 1330720) tested in 1 T cell assay.	IEDB	1330720	98	107	AAGLEAPFLY	ECO:0000213	PubMed	33853928
P0DTC3	ALLAVFQSA is a linear peptidic epitope (epitope ID 1330879) tested in 4 T cell assays.	IEDB	1330879	51	59	ALLAVFQSA	ECO:0000213	PubMed	34793243
P0DTC3	ALLAVFQSA is a linear peptidic epitope (epitope ID 1330879) tested in 4 T cell assays.	IEDB	1330879	51	59	ALLAVFQSA	ECO:0000213	PubMed	33853928
P0DTC3	CRSKNPLLY is a linear peptidic epitope (epitope ID 1331140) tested in 3 T cell assays.	IEDB	1331140	133	141	CRSKNPLLY	ECO:0000213	PubMed	33853928
P0DTC3	DYYQLYSTQL is a linear peptidic epitope (epitope ID 1331464) tested in 1 T cell assay.	IEDB	1331464	210	219	DYYQLYSTQL	ECO:0000213	PubMed	33853928
P0DTC3	FVTVYSHLL is a linear peptidic epitope (epitope ID 1332010) tested in 2 T cell assays.	IEDB	1332010	87	95	FVTVYSHLL	ECO:0000213	PubMed	34793243
P0DTC3	FVTVYSHLL is a linear peptidic epitope (epitope ID 1332010) tested in 2 T cell assays.	IEDB	1332010	87	95	FVTVYSHLL	ECO:0000213	PubMed	33853928
P0DTC3	IYDEPTTTT is a linear peptidic epitope (epitope ID 1332437) tested in 1 T cell assay.	IEDB	1332437	263	271	IYDEPTTTT	ECO:0000213	PubMed	33853928
P0DTC3	NLLLLFVTV is a linear peptidic epitope (epitope ID 1332930) tested in 5 T cell assays.	IEDB	1332930	82	90	NLLLLFVTV	ECO:0000213	PubMed	35484232
P0DTC3	NLLLLFVTV is a linear peptidic epitope (epitope ID 1332930) tested in 5 T cell assays.	IEDB	1332930	82	90	NLLLLFVTV	ECO:0000213	PubMed	33853928
P0DTC3	NPLLYDANYFL is a linear peptidic epitope (epitope ID 1332969) tested in 1 T cell assay and 2 MHC ligand assays.	IEDB	1332969	137	147	NPLLYDANYFL	ECO:0000213	PubMed	33853928
P0DTC3	SYFTSDYYQLY is a linear peptidic epitope (epitope ID 1333888) tested in 1 T cell assay.	IEDB	1333888	205	215	SYFTSDYYQLY	ECO:0000213	PubMed	33853928
P0DTC3	TLKKRWQLA is a linear peptidic epitope (epitope ID 1333994) tested in 3 T cell assays.	IEDB	1333994	64	72	TLKKRWQLA	ECO:0000213	PubMed	33853928
P0DTC3	VRIIMRLWL is a linear peptidic epitope (epitope ID 1334275) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1334275	121	129	VRIIMRLWL	ECO:0000213	PubMed	33853928
P0DTC3	YFTSDYYQL is a linear peptidic epitope (epitope ID 1334349) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1334349	206	214	YFTSDYYQL	ECO:0000213	PubMed	34793243
P0DTC3	YFTSDYYQL is a linear peptidic epitope (epitope ID 1334349) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1334349	206	214	YFTSDYYQL	ECO:0000213	PubMed	33853928
P0DTC3	FLCWHTNCY is a linear peptidic epitope (epitope ID 1540279) tested in 4 T cell assays and 3 MHC ligand assays.	IEDB	1540279	146	154	FLCWHTNCY	ECO:0000213	PubMed	34793243
P0DTC3	SYFTSDYYQLYSTQL is a linear peptidic epitope (epitope ID 1542650) tested in 1 T cell assay, 4 B cell assays and 3 MHC ligand assays.	IEDB	1542650	205	219	SYFTSDYYQLYSTQL	ECO:0000213	PubMed	36302758
P0DTC3	VVLHSYFTSDYYQLY is a linear peptidic epitope (epitope ID 1543298) tested in 1 T cell assay, 12 B cell assays and 3 MHC ligand assays.	IEDB	1543298	201	215	VVLHSYFTSDYYQLY	ECO:0000213	PubMed	36302758
P0DTC3	WLIVGVALL is a linear peptidic epitope (epitope ID 1597851) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1597851	45	53	WLIVGVALL	ECO:0000213	PubMed	34793243
P0DTC3	ALVYFLQSI is a linear peptidic epitope (epitope ID 2133998) tested in 1 T cell assay.	IEDB	2133998	110	118	ALVYFLQSI	ECO:0000213	PubMed	34793243
P0DTC3	DLFMRIFTI is a linear peptidic epitope (epitope ID 2134030) tested in 4 T cell assays.	IEDB	2134030	2	10	DLFMRIFTI	ECO:0000213	PubMed	34793243
P0DTC3	HLLLVAAGL is a linear peptidic epitope (epitope ID 2134101) tested in 2 T cell assays.	IEDB	2134101	93	101	HLLLVAAGL	ECO:0000213	PubMed	34793243
P0DTC3	LYALVYFLQ is a linear peptidic epitope (epitope ID 2134191) tested in 1 T cell assay.	IEDB	2134191	108	116	LYALVYFLQ	ECO:0000213	PubMed	34793243
P0DTC3	LYDANYFLC is a linear peptidic epitope (epitope ID 2134192) tested in 1 T cell assay.	IEDB	2134192	140	148	LYDANYFLC	ECO:0000213	PubMed	34793243
P0DTC3	SLPFGWLIV is a linear peptidic epitope (epitope ID 2134273) tested in 1 T cell assay.	IEDB	2134273	40	48	SLPFGWLIV	ECO:0000213	PubMed	34793243
P0DTC3	YFLQSINFV is a linear peptidic epitope (epitope ID 2134354) tested in 2 T cell assays.	IEDB	2134354	113	121	YFLQSINFV	ECO:0000213	PubMed	34793243
P0DTC3	QSASKIITLK is a linear peptidic epitope (epitope ID 2157727) tested in 5 T cell assays.	IEDB	2157727	57	66	QSASKIITLK	ECO:0000213	PubMed	36603583
P0DTC3	FLYLYALVYF is a linear peptidic epitope (epitope ID 2249083) tested in 1 T cell assay.	IEDB	2249083	105	114	FLYLYALVYF	ECO:0000213	PubMed	38045681
P0DTC3	IIMRLWLCWK is a linear peptidic epitope (epitope ID 2249090) tested in 1 T cell assay.	IEDB	2249090	123	132	IIMRLWLCWK	ECO:0000213	PubMed	38045681
P0DTC3	SINFVRIIM is a linear peptidic epitope (epitope ID 2249104) tested in 1 T cell assay.	IEDB	2249104	117	125	SINFVRIIM	ECO:0000213	PubMed	38045681
P0DTC4	FLAFVVFLL is a linear peptidic epitope (epitope ID 16501) tested in 21 T cell assays and 19 MHC ligand assays.	IEDB	16501	20	28	FLAFVVFLL	ECO:0000213	PubMed	34728796
P0DTC4	FLAFVVFLL is a linear peptidic epitope (epitope ID 16501) tested in 21 T cell assays and 19 MHC ligand assays.	IEDB	16501	20	28	FLAFVVFLL	ECO:0000213	PubMed	34793243
P0DTC4	FLAFVVFLL is a linear peptidic epitope (epitope ID 16501) tested in 21 T cell assays and 19 MHC ligand assays.	IEDB	16501	20	28	FLAFVVFLL	ECO:0000213	PubMed	35937077
P0DTC4	FLAFVVFLL is a linear peptidic epitope (epitope ID 16501) tested in 21 T cell assays and 19 MHC ligand assays.	IEDB	16501	20	28	FLAFVVFLL	ECO:0000213	PubMed	38605956
P0DTC4	FLAFVVFLL is a linear peptidic epitope (epitope ID 16501) tested in 21 T cell assays and 19 MHC ligand assays.	IEDB	16501	20	28	FLAFVVFLL	ECO:0000213	PubMed	33911008
P0DTC4	FLAFVVFLLV is a linear peptidic epitope (epitope ID 16502) tested in 2 T cell assays and 11 MHC ligand assays.	IEDB	16502	20	29	FLAFVVFLLV	ECO:0000213	PubMed	34728796
P0DTC4	FLAFVVFLLVTLAIL is a linear peptidic epitope (epitope ID 16503) tested in 5 T cell assays and 4 MHC ligand assays.	IEDB	16503	20	34	FLAFVVFLLVTLAIL	ECO:0000213	PubMed	38605956
P0DTC4	FLAFVVFLLVTLAIL is a linear peptidic epitope (epitope ID 16503) tested in 5 T cell assays and 4 MHC ligand assays.	IEDB	16503	20	34	FLAFVVFLLVTLAIL	ECO:0000213	PubMed	33911008
P0DTC4	FLLVTLAIL is a linear peptidic epitope (epitope ID 16762) tested in 10 T cell assays and 18 MHC ligand assays.	IEDB	16762	26	34	FLLVTLAIL	ECO:0000213	PubMed	34728796
P0DTC4	FLLVTLAIL is a linear peptidic epitope (epitope ID 16762) tested in 10 T cell assays and 18 MHC ligand assays.	IEDB	16762	26	34	FLLVTLAIL	ECO:0000213	PubMed	35937077
P0DTC4	FLLVTLAIL is a linear peptidic epitope (epitope ID 16762) tested in 10 T cell assays and 18 MHC ligand assays.	IEDB	16762	26	34	FLLVTLAIL	ECO:0000213	PubMed	38605956
P0DTC4	FLLVTLAIL is a linear peptidic epitope (epitope ID 16762) tested in 10 T cell assays and 18 MHC ligand assays.	IEDB	16762	26	34	FLLVTLAIL	ECO:0000213	PubMed	33911008
P0DTC4	FLLVTLAIL is a linear peptidic epitope (epitope ID 16762) tested in 10 T cell assays and 18 MHC ligand assays.	IEDB	16762	26	34	FLLVTLAIL	ECO:0000213	PubMed	34231935
P0DTC4	FLLVTLAILTALRLC is a linear peptidic epitope (epitope ID 16763) tested in 15 T cell assays and 4 MHC ligand assays.	IEDB	16763	26	40	FLLVTLAILTALRLC	ECO:0000213	PubMed	34529740
P0DTC4	FLLVTLAILTALRLC is a linear peptidic epitope (epitope ID 16763) tested in 15 T cell assays and 4 MHC ligand assays.	IEDB	16763	26	40	FLLVTLAILTALRLC	ECO:0000213	PubMed	38605956
P0DTC4	FLLVTLAILTALRLC is a linear peptidic epitope (epitope ID 16763) tested in 15 T cell assays and 4 MHC ligand assays.	IEDB	16763	26	40	FLLVTLAILTALRLC	ECO:0000213	PubMed	33911008
P0DTC4	FVVFLLVTL is a linear peptidic epitope (epitope ID 18316) tested in 4 T cell assays and 10 MHC ligand assays.	IEDB	18316	23	31	FVVFLLVTL	ECO:0000213	PubMed	34793243
P0DTC4	IVNSVLLFL is a linear peptidic epitope (epitope ID 29377) tested in 6 T cell assays and 11 MHC ligand assays.	IEDB	29377	13	21	IVNSVLLFL	ECO:0000213	PubMed	34728796
P0DTC4	IVNSVLLFL is a linear peptidic epitope (epitope ID 29377) tested in 6 T cell assays and 11 MHC ligand assays.	IEDB	29377	13	21	IVNSVLLFL	ECO:0000213	PubMed	34793243
P0DTC4	LFLAFVVFLL is a linear peptidic epitope (epitope ID 35886) tested in 1 T cell assay and 7 MHC ligand assays.	IEDB	35886	19	28	LFLAFVVFLL	ECO:0000213	PubMed	34728796
P0DTC4	LIVNSVLLFL is a linear peptidic epitope (epitope ID 36752) tested in 2 T cell assays and 13 MHC ligand assays.	IEDB	36752	12	21	LIVNSVLLFL	ECO:0000213	PubMed	34728796
P0DTC4	LTALRLCAY is a linear peptidic epitope (epitope ID 39803) tested in 2 T cell assays and 7 MHC ligand assays.	IEDB	39803	34	42	LTALRLCAY	ECO:0000213	PubMed	34793243
P0DTC4	RLCAYCCNI is a linear peptidic epitope (epitope ID 54490) tested in 2 T cell assays and 11 MHC ligand assays.	IEDB	54490	38	46	RLCAYCCNI	ECO:0000213	PubMed	34793243
P0DTC4	SVLLFLAFV is a linear peptidic epitope (epitope ID 62214) tested in 4 T cell assays and 15 MHC ligand assays.	IEDB	62214	16	24	SVLLFLAFV	ECO:0000213	PubMed	34728796
P0DTC4	SVLLFLAFV is a linear peptidic epitope (epitope ID 62214) tested in 4 T cell assays and 15 MHC ligand assays.	IEDB	62214	16	24	SVLLFLAFV	ECO:0000213	PubMed	34793243
P0DTC4	SVLLFLAFV is a linear peptidic epitope (epitope ID 62214) tested in 4 T cell assays and 15 MHC ligand assays.	IEDB	62214	16	24	SVLLFLAFV	ECO:0000213	PubMed	34231935
P0DTC4	TLAILTALR is a linear peptidic epitope (epitope ID 64718) tested in 2 T cell assays and 7 MHC ligand assays.	IEDB	64718	30	38	TLAILTALR	ECO:0000213	PubMed	34728796
P0DTC4	VLLFLAFVV is a linear peptidic epitope (epitope ID 69591) tested in 4 T cell assays and 13 MHC ligand assays.	IEDB	69591	17	25	VLLFLAFVV	ECO:0000213	PubMed	34728796
P0DTC4	VLLFLAFVV is a linear peptidic epitope (epitope ID 69591) tested in 4 T cell assays and 13 MHC ligand assays.	IEDB	69591	17	25	VLLFLAFVV	ECO:0000213	PubMed	34793243
P0DTC4	VLLFLAFVV is a linear peptidic epitope (epitope ID 69591) tested in 4 T cell assays and 13 MHC ligand assays.	IEDB	69591	17	25	VLLFLAFVV	ECO:0000213	PubMed	35937077
P0DTC4	MYSFVSEETGTLIVN is a linear peptidic epitope (epitope ID 532978) tested in 6 T cell assays, 20 B cell assays and 3 MHC ligand assays.	IEDB	532978	1	15	MYSFVSEETGTLIVN	ECO:0000213	PubMed	34529740
P0DTC4	YVYSRVKNL is a linear peptidic epitope (epitope ID 1075128) tested in 7 T cell assays and 2 MHC ligand assays.	IEDB	1075128	57	65	YVYSRVKNL	ECO:0000213	PubMed	34793243
P0DTC4	YVYSRVKNL is a linear peptidic epitope (epitope ID 1075128) tested in 7 T cell assays and 2 MHC ligand assays.	IEDB	1075128	57	65	YVYSRVKNL	ECO:0000213	PubMed	33853928
P0DTC4	FLAFVVFL is a linear peptidic epitope (epitope ID 1125058) tested in 3 T cell assays.	IEDB	1125058	20	27	FLAFVVFL	ECO:0000213	PubMed	38608022
P0DTC4	FLAFVVFL is a linear peptidic epitope (epitope ID 1125058) tested in 3 T cell assays.	IEDB	1125058	20	27	FLAFVVFL	ECO:0000213	PubMed	32791978
P0DTC4	FYVYSRVKNL is a linear peptidic epitope (epitope ID 1310429) tested in 5 T cell assays.	IEDB	1310429	56	65	FYVYSRVKNL	ECO:0000213	PubMed	34814158
P0DTC4	FYVYSRVKNL is a linear peptidic epitope (epitope ID 1310429) tested in 5 T cell assays.	IEDB	1310429	56	65	FYVYSRVKNL	ECO:0000213	PubMed	32999467
P0DTC4	FYVYSRVKNLNSSRV is a linear peptidic epitope (epitope ID 1310430) tested in 22 T cell assays, 2 B cell assays and 7 MHC ligand assays.	IEDB	1310430	56	70	FYVYSRVKNLNSSRV	ECO:0000213	PubMed	34529740
P0DTC4	FYVYSRVKNLNSSRV is a linear peptidic epitope (epitope ID 1310430) tested in 22 T cell assays, 2 B cell assays and 7 MHC ligand assays.	IEDB	1310430	56	70	FYVYSRVKNLNSSRV	ECO:0000213	PubMed	34814158
P0DTC4	FYVYSRVKNLNSSRV is a linear peptidic epitope (epitope ID 1310430) tested in 22 T cell assays, 2 B cell assays and 7 MHC ligand assays.	IEDB	1310430	56	70	FYVYSRVKNLNSSRV	ECO:0000213	PubMed	37596280
P0DTC4	FYVYSRVKNLNSSRV is a linear peptidic epitope (epitope ID 1310430) tested in 22 T cell assays, 2 B cell assays and 7 MHC ligand assays.	IEDB	1310430	56	70	FYVYSRVKNLNSSRV	ECO:0000213	PubMed	32999467
P0DTC4	LVKPSFYVY is a linear peptidic epitope (epitope ID 1310626) tested in 6 T cell assays.	IEDB	1310626	51	59	LVKPSFYVY	ECO:0000213	PubMed	33853928
P0DTC4	LVKPSFYVYSRVKNL is a linear peptidic epitope (epitope ID 1310627) tested in 24 T cell assays, 12 B cell assays and 25 MHC ligand assays.	IEDB	1310627	51	65	LVKPSFYVYSRVKNL	ECO:0000213	PubMed	34529740
P0DTC4	NIVNVSLVK is a linear peptidic epitope (epitope ID 1310667) tested in 5 T cell assays and 2 MHC ligand assays.	IEDB	1310667	45	53	NIVNVSLVK	ECO:0000213	PubMed	34728796
P0DTC4	AYCCNIVNVSLVKPS is a linear peptidic epitope (epitope ID 1312248) tested in 2 T cell assays, 14 B cell assays and 3 MHC ligand assays.	IEDB	1312248	41	55	AYCCNIVNVSLVKPS	ECO:0000213	PubMed	34529740
P0DTC4	RVKNLNSSRVPDLLV is a linear peptidic epitope (epitope ID 1313510) tested in 3 T cell assays, 22 B cell assays and 4 MHC ligand assays.	IEDB	1313510	61	75	RVKNLNSSRVPDLLV	ECO:0000213	PubMed	34529740
P0DTC4	VSLVKPSFY is a linear peptidic epitope (epitope ID 1392502) tested in 4 T cell assays and 2 MHC ligand assays.	IEDB	1392502	49	57	VSLVKPSFY	ECO:0000213	PubMed	34728796
P0DTC4	YVYSRVKN is a linear peptidic epitope (epitope ID 1406394) tested in 1 T cell assay.	IEDB	1406394	57	64	YVYSRVKN	ECO:0000213	PubMed	34249101
P0DTC4	IVNVSLVKPSFY is a linear peptidic epitope (epitope ID 1455858) tested in 9 B cell assays.	IEDB	1455858	46	57	IVNVSLVKPSFY	ECO:0000213	PubMed	37766081
P0DTC4	KPSFYVYSRVKN is a linear peptidic epitope (epitope ID 1461196) tested in 6 B cell assays.	IEDB	1461196	53	64	KPSFYVYSRVKN	ECO:0000213	PubMed	37766081
P0DTC4	YCCNIVNVSL is a linear peptidic epitope (epitope ID 1596831) tested in 1 MHC ligand assay.	IEDB	1596831	42	51	YCCNIVNVSL	ECO:0000213	PubMed	34166618
P0DTC4	IVNVSLVKPSFYVYS is a linear peptidic epitope (epitope ID 1597717) tested in 1 T cell assay, 6 B cell assays and 3 MHC ligand assays.	IEDB	1597717	46	60	IVNVSLVKPSFYVYS	ECO:0000213	PubMed	34529740
P0DTC4	FVSEETGTL is a linear peptidic epitope (epitope ID 1659432) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1659432	4	12	FVSEETGTL	ECO:0000213	PubMed	34793243
P0DTC4	RLCAYCCNIV is a linear peptidic epitope (epitope ID 1690617) tested in 3 T cell assays and 3 MHC ligand assays.	IEDB	1690617	38	47	RLCAYCCNIV	ECO:0000213	PubMed	34728796
P0DTC4	RLCAYCCNIV is a linear peptidic epitope (epitope ID 1690617) tested in 3 T cell assays and 3 MHC ligand assays.	IEDB	1690617	38	47	RLCAYCCNIV	ECO:0000213	PubMed	35937077
P0DTC4	RVKNLNSSR is a linear peptidic epitope (epitope ID 1691648) tested in 3 T cell assays and 3 MHC ligand assays.	IEDB	1691648	61	69	RVKNLNSSR	ECO:0000213	PubMed	34728796
P0DTC4	RVKNLNSSR is a linear peptidic epitope (epitope ID 1691648) tested in 3 T cell assays and 3 MHC ligand assays.	IEDB	1691648	61	69	RVKNLNSSR	ECO:0000213	PubMed	34814158
P0DTC4	SSRVPDLLV is a linear peptidic epitope (epitope ID 1695722) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1695722	67	75	SSRVPDLLV	ECO:0000213	PubMed	34728796
P0DTC4	TLIVNSVLLF is a linear peptidic epitope (epitope ID 1699030) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1699030	11	20	TLIVNSVLLF	ECO:0000213	PubMed	34728796
P0DTC4	VFLLVTLAI is a linear peptidic epitope (epitope ID 1702826) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1702826	25	33	VFLLVTLAI	ECO:0000213	PubMed	34728796
P0DTC4	VLLFLAFVVF is a linear peptidic epitope (epitope ID 1704255) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1704255	17	26	VLLFLAFVVF	ECO:0000213	PubMed	34728796
P0DTC4	VNSVLLFLAF is a linear peptidic epitope (epitope ID 1704993) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1704993	14	23	VNSVLLFLAF	ECO:0000213	PubMed	34728796
P0DTC4	TLIVNSVLL is a linear peptidic epitope (epitope ID 2134297) tested in 2 T cell assays.	IEDB	2134297	11	19	TLIVNSVLL	ECO:0000213	PubMed	34793243
P0DTC4	VTLAILTAL is a linear peptidic epitope (epitope ID 2134342) tested in 1 T cell assay.	IEDB	2134342	29	37	VTLAILTAL	ECO:0000213	PubMed	34793243
P0DTC4	ILTALRLCAY is a linear peptidic epitope (epitope ID 2249091) tested in 1 T cell assay.	IEDB	2249091	33	42	ILTALRLCAY	ECO:0000213	PubMed	38045681
P0DTC4	TLIVNSVLLFLAF is a linear peptidic epitope (epitope ID 2269364) tested in 1 B cell assay.	IEDB	2269364	11	23	TLIVNSVLLFLAF	ECO:0000213	PubMed	39598409
P0DTC5	ATSRTLSYY is a linear peptidic epitope (epitope ID 5149) tested in 25 T cell assays and 13 MHC ligand assays.	IEDB	5149	171	179	ATSRTLSYY	ECO:0000213	PubMed	34793243
P0DTC5	ATSRTLSYY is a linear peptidic epitope (epitope ID 5149) tested in 25 T cell assays and 13 MHC ligand assays.	IEDB	5149	171	179	ATSRTLSYY	ECO:0000213	PubMed	35104433
P0DTC5	ATSRTLSYY is a linear peptidic epitope (epitope ID 5149) tested in 25 T cell assays and 13 MHC ligand assays.	IEDB	5149	171	179	ATSRTLSYY	ECO:0000213	PubMed	35389886
P0DTC5	ATSRTLSYY is a linear peptidic epitope (epitope ID 5149) tested in 25 T cell assays and 13 MHC ligand assays.	IEDB	5149	171	179	ATSRTLSYY	ECO:0000213	PubMed	36254196
P0DTC5	ATSRTLSYY is a linear peptidic epitope (epitope ID 5149) tested in 25 T cell assays and 13 MHC ligand assays.	IEDB	5149	171	179	ATSRTLSYY	ECO:0000213	PubMed	38866784
P0DTC5	ATSRTLSYY is a linear peptidic epitope (epitope ID 5149) tested in 25 T cell assays and 13 MHC ligand assays.	IEDB	5149	171	179	ATSRTLSYY	ECO:0000213	PubMed	33128877
P0DTC5	ATSRTLSYY is a linear peptidic epitope (epitope ID 5149) tested in 25 T cell assays and 13 MHC ligand assays.	IEDB	5149	171	179	ATSRTLSYY	ECO:0000213	PubMed	33972535
P0DTC5	ATSRTLSYYK is a linear peptidic epitope (epitope ID 5150) tested in 21 T cell assays and 8 MHC ligand assays.	IEDB	5150	171	180	ATSRTLSYYK	ECO:0000213	PubMed	34609506
P0DTC5	ATSRTLSYYK is a linear peptidic epitope (epitope ID 5150) tested in 21 T cell assays and 8 MHC ligand assays.	IEDB	5150	171	180	ATSRTLSYYK	ECO:0000213	PubMed	34728796
P0DTC5	ATSRTLSYYK is a linear peptidic epitope (epitope ID 5150) tested in 21 T cell assays and 8 MHC ligand assays.	IEDB	5150	171	180	ATSRTLSYYK	ECO:0000213	PubMed	35389886
P0DTC5	ATSRTLSYYK is a linear peptidic epitope (epitope ID 5150) tested in 21 T cell assays and 8 MHC ligand assays.	IEDB	5150	171	180	ATSRTLSYYK	ECO:0000213	PubMed	36254196
P0DTC5	ATSRTLSYYK is a linear peptidic epitope (epitope ID 5150) tested in 21 T cell assays and 8 MHC ligand assays.	IEDB	5150	171	180	ATSRTLSYYK	ECO:0000213	PubMed	36603583
P0DTC5	ATSRTLSYYK is a linear peptidic epitope (epitope ID 5150) tested in 21 T cell assays and 8 MHC ligand assays.	IEDB	5150	171	180	ATSRTLSYYK	ECO:0000213	PubMed	38387105
P0DTC5	ATSRTLSYYK is a linear peptidic epitope (epitope ID 5150) tested in 21 T cell assays and 8 MHC ligand assays.	IEDB	5150	171	180	ATSRTLSYYK	ECO:0000213	PubMed	38866784
P0DTC5	ATSRTLSYYK is a linear peptidic epitope (epitope ID 5150) tested in 21 T cell assays and 8 MHC ligand assays.	IEDB	5150	171	180	ATSRTLSYYK	ECO:0000213	PubMed	38932408
P0DTC5	ATSRTLSYYK is a linear peptidic epitope (epitope ID 5150) tested in 21 T cell assays and 8 MHC ligand assays.	IEDB	5150	171	180	ATSRTLSYYK	ECO:0000213	PubMed	33128877
P0DTC5	FLWLLWPVT is a linear peptidic epitope (epitope ID 16972) tested in 2 T cell assays and 10 MHC ligand assays.	IEDB	16972	53	61	FLWLLWPVT	ECO:0000213	PubMed	34793243
P0DTC5	FLWLLWPVTL is a linear peptidic epitope (epitope ID 16973) tested in 8 T cell assays and 12 MHC ligand assays.	IEDB	16973	53	62	FLWLLWPVTL	ECO:0000213	PubMed	34725257
P0DTC5	FLWLLWPVTL is a linear peptidic epitope (epitope ID 16973) tested in 8 T cell assays and 12 MHC ligand assays.	IEDB	16973	53	62	FLWLLWPVTL	ECO:0000213	PubMed	33853928
P0DTC5	FVLAAVYRI is a linear peptidic epitope (epitope ID 18219) tested in 26 T cell assays and 17 MHC ligand assays.	IEDB	18219	65	73	FVLAAVYRI	ECO:0000213	PubMed	34312620
P0DTC5	FVLAAVYRI is a linear peptidic epitope (epitope ID 18219) tested in 26 T cell assays and 17 MHC ligand assays.	IEDB	18219	65	73	FVLAAVYRI	ECO:0000213	PubMed	34725257
P0DTC5	FVLAAVYRI is a linear peptidic epitope (epitope ID 18219) tested in 26 T cell assays and 17 MHC ligand assays.	IEDB	18219	65	73	FVLAAVYRI	ECO:0000213	PubMed	34728796
P0DTC5	FVLAAVYRI is a linear peptidic epitope (epitope ID 18219) tested in 26 T cell assays and 17 MHC ligand assays.	IEDB	18219	65	73	FVLAAVYRI	ECO:0000213	PubMed	34793243
P0DTC5	FVLAAVYRI is a linear peptidic epitope (epitope ID 18219) tested in 26 T cell assays and 17 MHC ligand assays.	IEDB	18219	65	73	FVLAAVYRI	ECO:0000213	PubMed	35937077
P0DTC5	FVLAAVYRI is a linear peptidic epitope (epitope ID 18219) tested in 26 T cell assays and 17 MHC ligand assays.	IEDB	18219	65	73	FVLAAVYRI	ECO:0000213	PubMed	34231935
P0DTC5	FVLAAVYRI is a linear peptidic epitope (epitope ID 18219) tested in 26 T cell assays and 17 MHC ligand assays.	IEDB	18219	65	73	FVLAAVYRI	ECO:0000213	PubMed	33853928
P0DTC5	IKDLPKEITVATSRT is a linear peptidic epitope (epitope ID 26759) tested in 7 T cell assays, 14 B cell assays and 23 MHC ligand assays.	IEDB	26759	161	175	IKDLPKEITVATSRT	ECO:0000213	PubMed	34529740
P0DTC5	IKDLPKEITVATSRT is a linear peptidic epitope (epitope ID 26759) tested in 7 T cell assays, 14 B cell assays and 23 MHC ligand assays.	IEDB	26759	161	175	IKDLPKEITVATSRT	ECO:0000213	PubMed	38781962
P0DTC5	LWLLWPVTL is a linear peptidic epitope (epitope ID 40677) tested in 9 T cell assays and 8 MHC ligand assays.	IEDB	40677	54	62	LWLLWPVTL	ECO:0000213	PubMed	34793243
P0DTC5	LWLLWPVTL is a linear peptidic epitope (epitope ID 40677) tested in 9 T cell assays and 8 MHC ligand assays.	IEDB	40677	54	62	LWLLWPVTL	ECO:0000213	PubMed	36603583
P0DTC5	LWLLWPVTL is a linear peptidic epitope (epitope ID 40677) tested in 9 T cell assays and 8 MHC ligand assays.	IEDB	40677	54	62	LWLLWPVTL	ECO:0000213	PubMed	34086357
P0DTC5	LWLLWPVTL is a linear peptidic epitope (epitope ID 40677) tested in 9 T cell assays and 8 MHC ligand assays.	IEDB	40677	54	62	LWLLWPVTL	ECO:0000213	PubMed	36526616
P0DTC5	LWPVTLACF is a linear peptidic epitope (epitope ID 40685) tested in 4 T cell assays and 9 MHC ligand assays.	IEDB	40685	57	65	LWPVTLACF	ECO:0000213	PubMed	34728796
P0DTC5	LWPVTLACF is a linear peptidic epitope (epitope ID 40685) tested in 4 T cell assays and 9 MHC ligand assays.	IEDB	40685	57	65	LWPVTLACF	ECO:0000213	PubMed	34086357
P0DTC5	PKEITVATSRTLSYY is a linear peptidic epitope (epitope ID 48051) tested in 10 T cell assays, 6 B cell assays and 7 MHC ligand assays.	IEDB	48051	165	179	PKEITVATSRTLSYY	ECO:0000213	PubMed	35699447
P0DTC5	QWNLVIGFLF is a linear peptidic epitope (epitope ID 52851) tested in 3 T cell assays and 9 MHC ligand assays.	IEDB	52851	19	28	QWNLVIGFLF	ECO:0000213	PubMed	34728796
P0DTC5	QWNLVIGFLF is a linear peptidic epitope (epitope ID 52851) tested in 3 T cell assays and 9 MHC ligand assays.	IEDB	52851	19	28	QWNLVIGFLF	ECO:0000213	PubMed	36603583
P0DTC5	RYRIGNYKL is a linear peptidic epitope (epitope ID 56634) tested in 22 T cell assays and 10 MHC ligand assays.	IEDB	56634	198	206	RYRIGNYKL	ECO:0000213	PubMed	34728796
P0DTC5	RYRIGNYKL is a linear peptidic epitope (epitope ID 56634) tested in 22 T cell assays and 10 MHC ligand assays.	IEDB	56634	198	206	RYRIGNYKL	ECO:0000213	PubMed	34793243
P0DTC5	RYRIGNYKL is a linear peptidic epitope (epitope ID 56634) tested in 22 T cell assays and 10 MHC ligand assays.	IEDB	56634	198	206	RYRIGNYKL	ECO:0000213	PubMed	35389886
P0DTC5	RYRIGNYKL is a linear peptidic epitope (epitope ID 56634) tested in 22 T cell assays and 10 MHC ligand assays.	IEDB	56634	198	206	RYRIGNYKL	ECO:0000213	PubMed	34086357
P0DTC5	RYRIGNYKL is a linear peptidic epitope (epitope ID 56634) tested in 22 T cell assays and 10 MHC ligand assays.	IEDB	56634	198	206	RYRIGNYKL	ECO:0000213	PubMed	33853928
P0DTC5	RYRIGNYKL is a linear peptidic epitope (epitope ID 56634) tested in 22 T cell assays and 10 MHC ligand assays.	IEDB	56634	198	206	RYRIGNYKL	ECO:0000213	PubMed	36526616
P0DTC5	SFNPETNIL is a linear peptidic epitope (epitope ID 57856) tested in 2 T cell assays and 13 MHC ligand assays.	IEDB	57856	111	119	SFNPETNIL	ECO:0000213	PubMed	33853928
P0DTC5	SMWSFNPET is a linear peptidic epitope (epitope ID 59778) tested in 9 T cell assays and 12 MHC ligand assays.	IEDB	59778	108	116	SMWSFNPET	ECO:0000213	PubMed	34793243
P0DTC5	SMWSFNPET is a linear peptidic epitope (epitope ID 59778) tested in 9 T cell assays and 12 MHC ligand assays.	IEDB	59778	108	116	SMWSFNPET	ECO:0000213	PubMed	38105139
P0DTC5	SMWSFNPET is a linear peptidic epitope (epitope ID 59778) tested in 9 T cell assays and 12 MHC ligand assays.	IEDB	59778	108	116	SMWSFNPET	ECO:0000213	PubMed	38214610
P0DTC5	SMWSFNPET is a linear peptidic epitope (epitope ID 59778) tested in 9 T cell assays and 12 MHC ligand assays.	IEDB	59778	108	116	SMWSFNPET	ECO:0000213	PubMed	33853928
P0DTC5	TLACFVLAA is a linear peptidic epitope (epitope ID 64709) tested in 8 T cell assays and 11 MHC ligand assays.	IEDB	64709	61	69	TLACFVLAA	ECO:0000213	PubMed	34210785
P0DTC5	TLACFVLAA is a linear peptidic epitope (epitope ID 64709) tested in 8 T cell assays and 11 MHC ligand assays.	IEDB	64709	61	69	TLACFVLAA	ECO:0000213	PubMed	34793243
P0DTC5	TLACFVLAA is a linear peptidic epitope (epitope ID 64709) tested in 8 T cell assays and 11 MHC ligand assays.	IEDB	64709	61	69	TLACFVLAA	ECO:0000213	PubMed	38105139
P0DTC5	TLACFVLAAV is a linear peptidic epitope (epitope ID 64710) tested in 24 T cell assays, 3 B cell assays, 21 MHC ligand assays and has 3D structure(s) 3i6k.	IEDB	64710	61	70	TLACFVLAAV	ECO:0000213	PubMed	34728796
P0DTC5	TLACFVLAAV is a linear peptidic epitope (epitope ID 64710) tested in 24 T cell assays, 3 B cell assays, 21 MHC ligand assays and has 3D structure(s) 3i6k.	IEDB	64710	61	70	TLACFVLAAV	ECO:0000213	PubMed	35104433
P0DTC5	TLACFVLAAV is a linear peptidic epitope (epitope ID 64710) tested in 24 T cell assays, 3 B cell assays, 21 MHC ligand assays and has 3D structure(s) 3i6k.	IEDB	64710	61	70	TLACFVLAAV	ECO:0000213	PubMed	35937077
P0DTC5	TLACFVLAAV is a linear peptidic epitope (epitope ID 64710) tested in 24 T cell assays, 3 B cell assays, 21 MHC ligand assays and has 3D structure(s) 3i6k.	IEDB	64710	61	70	TLACFVLAAV	ECO:0000213	PubMed	38608022
P0DTC5	TLACFVLAAV is a linear peptidic epitope (epitope ID 64710) tested in 24 T cell assays, 3 B cell assays, 21 MHC ligand assays and has 3D structure(s) 3i6k.	IEDB	64710	61	70	TLACFVLAAV	ECO:0000213	PubMed	34231935
P0DTC5	TSRTLSYYK is a linear peptidic epitope (epitope ID 66407) tested in 1 T cell assay and 6 MHC ligand assays.	IEDB	66407	172	180	TSRTLSYYK	ECO:0000213	PubMed	34728796
P0DTC5	TVATSRTLSY is a linear peptidic epitope (epitope ID 66952) tested in 7 T cell assays and 7 MHC ligand assays.	IEDB	66952	169	178	TVATSRTLSY	ECO:0000213	PubMed	33972535
P0DTC5	TVATSRTLSY is a linear peptidic epitope (epitope ID 66952) tested in 7 T cell assays and 7 MHC ligand assays.	IEDB	66952	169	178	TVATSRTLSY	ECO:0000213	PubMed	33853928
P0DTC5	WLLWPVTLA is a linear peptidic epitope (epitope ID 72759) tested in 5 T cell assays and 10 MHC ligand assays.	IEDB	72759	55	63	WLLWPVTLA	ECO:0000213	PubMed	34793243
P0DTC5	WLLWPVTLA is a linear peptidic epitope (epitope ID 72759) tested in 5 T cell assays and 10 MHC ligand assays.	IEDB	72759	55	63	WLLWPVTLA	ECO:0000213	PubMed	38105139
P0DTC5	WLLWPVTLA is a linear peptidic epitope (epitope ID 72759) tested in 5 T cell assays and 10 MHC ligand assays.	IEDB	72759	55	63	WLLWPVTLA	ECO:0000213	PubMed	32913053
P0DTC5	EITVATSRTLSYYKL is a linear peptidic epitope (epitope ID 531518) tested in 2 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	531518	167	181	EITVATSRTLSYYKL	ECO:0000213	PubMed	38105139
P0DTC5	LWPVTLACFVLAAVY is a linear peptidic epitope (epitope ID 532894) tested in 3 T cell assays, 6 B cell assays and 4 MHC ligand assays.	IEDB	532894	57	71	LWPVTLACFVLAAVY	ECO:0000213	PubMed	35699447
P0DTC5	HLRIAGHHLGR is a linear peptidic epitope (epitope ID 1074919) tested in 5 T cell assays and 3 B cell assays.	IEDB	1074919	148	158	HLRIAGHHLGR	ECO:0000213	PubMed	34529740
P0DTC5	HLRIAGHHLGR is a linear peptidic epitope (epitope ID 1074919) tested in 5 T cell assays and 3 B cell assays.	IEDB	1074919	148	158	HLRIAGHHLGR	ECO:0000213	PubMed	37766081
P0DTC5	RLFARTRSMW is a linear peptidic epitope (epitope ID 1075030) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1075030	101	110	RLFARTRSMW	ECO:0000213	PubMed	35486722
P0DTC5	SELVIGAVIL is a linear peptidic epitope (epitope ID 1075044) tested in 16 T cell assays and 1 MHC ligand assay.	IEDB	1075044	136	145	SELVIGAVIL	ECO:0000213	PubMed	34968416
P0DTC5	SELVIGAVIL is a linear peptidic epitope (epitope ID 1075044) tested in 16 T cell assays and 1 MHC ligand assay.	IEDB	1075044	136	145	SELVIGAVIL	ECO:0000213	PubMed	35484232
P0DTC5	SELVIGAVIL is a linear peptidic epitope (epitope ID 1075044) tested in 16 T cell assays and 1 MHC ligand assay.	IEDB	1075044	136	145	SELVIGAVIL	ECO:0000213	PubMed	36494499
P0DTC5	SELVIGAVIL is a linear peptidic epitope (epitope ID 1075044) tested in 16 T cell assays and 1 MHC ligand assay.	IEDB	1075044	136	145	SELVIGAVIL	ECO:0000213	PubMed	32999467
P0DTC5	WICLLQFAY is a linear peptidic epitope (epitope ID 1075115) tested in 4 T cell assays.	IEDB	1075115	31	39	WICLLQFAY	ECO:0000213	PubMed	34793243
P0DTC5	FLFLTWICL is a linear peptidic epitope (epitope ID 1125059) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1125059	26	34	FLFLTWICL	ECO:0000213	PubMed	34210785
P0DTC5	FLFLTWICL is a linear peptidic epitope (epitope ID 1125059) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1125059	26	34	FLFLTWICL	ECO:0000213	PubMed	38608022
P0DTC5	FLFLTWICL is a linear peptidic epitope (epitope ID 1125059) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1125059	26	34	FLFLTWICL	ECO:0000213	PubMed	32791978
P0DTC5	FLFLTWICL is a linear peptidic epitope (epitope ID 1125059) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1125059	26	34	FLFLTWICL	ECO:0000213	PubMed	32913053
P0DTC5	FLYIIKLIFL is a linear peptidic epitope (epitope ID 1125061) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1125061	45	54	FLYIIKLIFL	ECO:0000213	PubMed	34728796
P0DTC5	KLLEQWNLV is a linear peptidic epitope (epitope ID 1309124) tested in 22 T cell assays and 10 MHC ligand assays.	IEDB	1309124	15	23	KLLEQWNLV	ECO:0000213	PubMed	34145459
P0DTC5	KLLEQWNLV is a linear peptidic epitope (epitope ID 1309124) tested in 22 T cell assays and 10 MHC ligand assays.	IEDB	1309124	15	23	KLLEQWNLV	ECO:0000213	PubMed	34210785
P0DTC5	KLLEQWNLV is a linear peptidic epitope (epitope ID 1309124) tested in 22 T cell assays and 10 MHC ligand assays.	IEDB	1309124	15	23	KLLEQWNLV	ECO:0000213	PubMed	34728796
P0DTC5	KLLEQWNLV is a linear peptidic epitope (epitope ID 1309124) tested in 22 T cell assays and 10 MHC ligand assays.	IEDB	1309124	15	23	KLLEQWNLV	ECO:0000213	PubMed	35937077
P0DTC5	KLLEQWNLV is a linear peptidic epitope (epitope ID 1309124) tested in 22 T cell assays and 10 MHC ligand assays.	IEDB	1309124	15	23	KLLEQWNLV	ECO:0000213	PubMed	32913053
P0DTC5	FIASFRLFARTRSMW is a linear peptidic epitope (epitope ID 1310394) tested in 9 T cell assays and 4 MHC ligand assays.	IEDB	1310394	96	110	FIASFRLFARTRSMW	ECO:0000213	PubMed	34529740
P0DTC5	FIASFRLFARTRSMW is a linear peptidic epitope (epitope ID 1310394) tested in 9 T cell assays and 4 MHC ligand assays.	IEDB	1310394	96	110	FIASFRLFARTRSMW	ECO:0000213	PubMed	38781962
P0DTC5	KEITVATSRTLSYYK is a linear peptidic epitope (epitope ID 1310529) tested in 39 T cell assays, 6 B cell assays and 42 MHC ligand assays.	IEDB	1310529	166	180	KEITVATSRTLSYYK	ECO:0000213	PubMed	34529740
P0DTC5	KEITVATSRTLSYYK is a linear peptidic epitope (epitope ID 1310529) tested in 39 T cell assays, 6 B cell assays and 42 MHC ligand assays.	IEDB	1310529	166	180	KEITVATSRTLSYYK	ECO:0000213	PubMed	38781962
P0DTC5	LSYYKLGASQRVAGD is a linear peptidic epitope (epitope ID 1310622) tested in 84 T cell assays, 50 MHC ligand assays and has 3D structure(s) 8cme.	IEDB	1310622	176	190	LSYYKLGASQRVAGD	ECO:0000213	PubMed	34529740
P0DTC5	LSYYKLGASQRVAGD is a linear peptidic epitope (epitope ID 1310622) tested in 84 T cell assays, 50 MHC ligand assays and has 3D structure(s) 8cme.	IEDB	1310622	176	190	LSYYKLGASQRVAGD	ECO:0000213	PubMed	34814158
P0DTC5	LSYYKLGASQRVAGD is a linear peptidic epitope (epitope ID 1310622) tested in 84 T cell assays, 50 MHC ligand assays and has 3D structure(s) 8cme.	IEDB	1310622	176	190	LSYYKLGASQRVAGD	ECO:0000213	PubMed	35389886
P0DTC5	LSYYKLGASQRVAGD is a linear peptidic epitope (epitope ID 1310622) tested in 84 T cell assays, 50 MHC ligand assays and has 3D structure(s) 8cme.	IEDB	1310622	176	190	LSYYKLGASQRVAGD	ECO:0000213	PubMed	35486722
P0DTC5	LSYYKLGASQRVAGD is a linear peptidic epitope (epitope ID 1310622) tested in 84 T cell assays, 50 MHC ligand assays and has 3D structure(s) 8cme.	IEDB	1310622	176	190	LSYYKLGASQRVAGD	ECO:0000213	PubMed	37596280
P0DTC5	LSYYKLGASQRVAGD is a linear peptidic epitope (epitope ID 1310622) tested in 84 T cell assays, 50 MHC ligand assays and has 3D structure(s) 8cme.	IEDB	1310622	176	190	LSYYKLGASQRVAGD	ECO:0000213	PubMed	38605956
P0DTC5	LSYYKLGASQRVAGD is a linear peptidic epitope (epitope ID 1310622) tested in 84 T cell assays, 50 MHC ligand assays and has 3D structure(s) 8cme.	IEDB	1310622	176	190	LSYYKLGASQRVAGD	ECO:0000213	PubMed	38781962
P0DTC5	LSYYKLGASQRVAGD is a linear peptidic epitope (epitope ID 1310622) tested in 84 T cell assays, 50 MHC ligand assays and has 3D structure(s) 8cme.	IEDB	1310622	176	190	LSYYKLGASQRVAGD	ECO:0000213	PubMed	32999467
P0DTC5	LSYYKLGASQRVAGD is a linear peptidic epitope (epitope ID 1310622) tested in 84 T cell assays, 50 MHC ligand assays and has 3D structure(s) 8cme.	IEDB	1310622	176	190	LSYYKLGASQRVAGD	ECO:0000213	PubMed	33911008
P0DTC5	MWLSYFIASFRLFAR is a linear peptidic epitope (epitope ID 1310651) tested in 24 T cell assays, 18 B cell assays and 22 MHC ligand assays.	IEDB	1310651	91	105	MWLSYFIASFRLFAR	ECO:0000213	PubMed	34529740
P0DTC5	MWLSYFIASFRLFAR is a linear peptidic epitope (epitope ID 1310651) tested in 24 T cell assays, 18 B cell assays and 22 MHC ligand assays.	IEDB	1310651	91	105	MWLSYFIASFRLFAR	ECO:0000213	PubMed	38781962
P0DTC5	NRFLYIIKL is a linear peptidic epitope (epitope ID 1310684) tested in 13 T cell assays.	IEDB	1310684	43	51	NRFLYIIKL	ECO:0000213	PubMed	35389886
P0DTC5	NRFLYIIKL is a linear peptidic epitope (epitope ID 1310684) tested in 13 T cell assays.	IEDB	1310684	43	51	NRFLYIIKL	ECO:0000213	PubMed	32999467
P0DTC5	NRFLYIIKL is a linear peptidic epitope (epitope ID 1310684) tested in 13 T cell assays.	IEDB	1310684	43	51	NRFLYIIKL	ECO:0000213	PubMed	33853928
P0DTC5	NRNRFLYIIKLIFLW is a linear peptidic epitope (epitope ID 1310685) tested in 11 T cell assays, 14 B cell assays and 7 MHC ligand assays.	IEDB	1310685	41	55	NRNRFLYIIKLIFLW	ECO:0000213	PubMed	34529740
P0DTC5	NRNRFLYIIKLIFLW is a linear peptidic epitope (epitope ID 1310685) tested in 11 T cell assays, 14 B cell assays and 7 MHC ligand assays.	IEDB	1310685	41	55	NRNRFLYIIKLIFLW	ECO:0000213	PubMed	35699447
P0DTC5	SELVIGAVILRGHLR is a linear peptidic epitope (epitope ID 1310793) tested in 14 T cell assays, 6 B cell assays and 20 MHC ligand assays.	IEDB	1310793	136	150	SELVIGAVILRGHLR	ECO:0000213	PubMed	34529740
P0DTC5	SELVIGAVILRGHLR is a linear peptidic epitope (epitope ID 1310793) tested in 14 T cell assays, 6 B cell assays and 20 MHC ligand assays.	IEDB	1310793	136	150	SELVIGAVILRGHLR	ECO:0000213	PubMed	38117652
P0DTC5	SYFIASFRLF is a linear peptidic epitope (epitope ID 1310831) tested in 8 T cell assays and 1 MHC ligand assay.	IEDB	1310831	94	103	SYFIASFRLF	ECO:0000213	PubMed	34728796
P0DTC5	TLACFVLAAVYRINW is a linear peptidic epitope (epitope ID 1310849) tested in 5 T cell assays, 20 B cell assays and 4 MHC ligand assays.	IEDB	1310849	61	75	TLACFVLAAVYRINW	ECO:0000213	PubMed	34529740
P0DTC5	WICLLQFAYANRNRF is a linear peptidic epitope (epitope ID 1310941) tested in 7 T cell assays, 18 B cell assays and 4 MHC ligand assays.	IEDB	1310941	31	45	WICLLQFAYANRNRF	ECO:0000213	PubMed	34529740
P0DTC5	AVYRINWITGGIAIA is a linear peptidic epitope (epitope ID 1312246) tested in 2 T cell assays, 6 B cell assays and 4 MHC ligand assays.	IEDB	1312246	69	83	AVYRINWITGGIAIA	ECO:0000213	PubMed	35157735
P0DTC5	ELVIGAVILRGHLRI is a linear peptidic epitope (epitope ID 1312367) tested in 2 T cell assays, 6 B cell assays and 4 MHC ligand assays.	IEDB	1312367	137	151	ELVIGAVILRGHLRI	ECO:0000213	PubMed	35699447
P0DTC5	FLYIIKLIFLWLLWP is a linear peptidic epitope (epitope ID 1312469) tested in 2 T cell assays, 6 B cell assays and 4 MHC ligand assays.	IEDB	1312469	45	59	FLYIIKLIFLWLLWP	ECO:0000213	PubMed	35699447
P0DTC5	FVLAAVYRINWITGG is a linear peptidic epitope (epitope ID 1312509) tested in 2 T cell assays, 6 B cell assays and 4 MHC ligand assays.	IEDB	1312509	65	79	FVLAAVYRINWITGG	ECO:0000213	PubMed	35699447
P0DTC5	GAVILRGHLRIAGHH is a linear peptidic epitope (epitope ID 1312531) tested in 9 T cell assays, 14 B cell assays and 4 MHC ligand assays.	IEDB	1312531	141	155	GAVILRGHLRIAGHH	ECO:0000213	PubMed	34529740
P0DTC5	GAVILRGHLRIAGHH is a linear peptidic epitope (epitope ID 1312531) tested in 9 T cell assays, 14 B cell assays and 4 MHC ligand assays.	IEDB	1312531	141	155	GAVILRGHLRIAGHH	ECO:0000213	PubMed	38781962
P0DTC5	GAVILRGHLRIAGHH is a linear peptidic epitope (epitope ID 1312531) tested in 9 T cell assays, 14 B cell assays and 4 MHC ligand assays.	IEDB	1312531	141	155	GAVILRGHLRIAGHH	ECO:0000213	PubMed	35699447
P0DTC5	GLMWLSYFIASFRLF is a linear peptidic epitope (epitope ID 1312565) tested in 2 T cell assays, 6 B cell assays and 4 MHC ligand assays.	IEDB	1312565	89	103	GLMWLSYFIASFRLF	ECO:0000213	PubMed	35699447
P0DTC5	IGNYKLNTDHSSSSD is a linear peptidic epitope (epitope ID 1312697) tested in 5 T cell assays, 14 B cell assays and 5 MHC ligand assays.	IEDB	1312697	201	215	IGNYKLNTDHSSSSD	ECO:0000213	PubMed	34529740
P0DTC5	IGNYKLNTDHSSSSD is a linear peptidic epitope (epitope ID 1312697) tested in 5 T cell assays, 14 B cell assays and 5 MHC ligand assays.	IEDB	1312697	201	215	IGNYKLNTDHSSSSD	ECO:0000213	PubMed	38781962
P0DTC5	LGASQRVAGDSGFAA is a linear peptidic epitope (epitope ID 1312973) tested in 3 T cell assays, 20 B cell assays and 4 MHC ligand assays.	IEDB	1312973	181	195	LGASQRVAGDSGFAA	ECO:0000213	PubMed	34529740
P0DTC5	LRGHLRIAGHHLGRC is a linear peptidic epitope (epitope ID 1313076) tested in 11 T cell assays, 12 B cell assays and 5 MHC ligand assays.	IEDB	1313076	145	159	LRGHLRIAGHHLGRC	ECO:0000213	PubMed	35157735
P0DTC5	LRGHLRIAGHHLGRC is a linear peptidic epitope (epitope ID 1313076) tested in 11 T cell assays, 12 B cell assays and 5 MHC ligand assays.	IEDB	1313076	145	159	LRGHLRIAGHHLGRC	ECO:0000213	PubMed	38117652
P0DTC5	LRGHLRIAGHHLGRC is a linear peptidic epitope (epitope ID 1313076) tested in 11 T cell assays, 12 B cell assays and 5 MHC ligand assays.	IEDB	1313076	145	159	LRGHLRIAGHHLGRC	ECO:0000213	PubMed	33104167
P0DTC5	LRGHLRIAGHHLGRC is a linear peptidic epitope (epitope ID 1313076) tested in 11 T cell assays, 12 B cell assays and 5 MHC ligand assays.	IEDB	1313076	145	159	LRGHLRIAGHHLGRC	ECO:0000213	PubMed	35699447
P0DTC5	LRIAGHHLGRCDIKD is a linear peptidic epitope (epitope ID 1313077) tested in 9 T cell assays, 6 B cell assays and 4 MHC ligand assays.	IEDB	1313077	149	163	LRIAGHHLGRCDIKD	ECO:0000213	PubMed	35699447
P0DTC5	MADSNGTITVEELKK is a linear peptidic epitope (epitope ID 1313131) tested in 4 T cell assays, 21 B cell assays and 4 MHC ligand assays.	IEDB	1313131	1	15	MADSNGTITVEELKK	ECO:0000213	PubMed	34529740
P0DTC5	NGTITVEELKKLLEQ is a linear peptidic epitope (epitope ID 1313207) tested in 1 T cell assay, 13 B cell assays and 4 MHC ligand assays.	IEDB	1313207	5	19	NGTITVEELKKLLEQ	ECO:0000213	PubMed	36646780
P0DTC5	NILLNVPLHGTILTR is a linear peptidic epitope (epitope ID 1313208) tested in 2 T cell assays, 6 B cell assays and 6 MHC ligand assays.	IEDB	1313208	117	131	NILLNVPLHGTILTR	ECO:0000213	PubMed	35699447
P0DTC5	NVPLHGTILTRPLLE is a linear peptidic epitope (epitope ID 1313260) tested in 3 T cell assays, 20 B cell assays and 5 MHC ligand assays.	IEDB	1313260	121	135	NVPLHGTILTRPLLE	ECO:0000213	PubMed	34529740
P0DTC5	RLFARTRSMWSFNPE is a linear peptidic epitope (epitope ID 1313451) tested in 6 T cell assays, 14 B cell assays and 7 MHC ligand assays.	IEDB	1313451	101	115	RLFARTRSMWSFNPE	ECO:0000213	PubMed	34529740
P0DTC5	SRTLSYYKLGASQRV is a linear peptidic epitope (epitope ID 1313663) tested in 4 T cell assays, 6 B cell assays and 5 MHC ligand assays.	IEDB	1313663	173	187	SRTLSYYKLGASQRV	ECO:0000213	PubMed	35699447
P0DTC5	SYFIASFRL is a linear peptidic epitope (epitope ID 1313718) tested in 8 T cell assays and 1 MHC ligand assay.	IEDB	1313718	94	102	SYFIASFRL	ECO:0000213	PubMed	34086357
P0DTC5	SYFIASFRL is a linear peptidic epitope (epitope ID 1313718) tested in 8 T cell assays and 1 MHC ligand assay.	IEDB	1313718	94	102	SYFIASFRL	ECO:0000213	PubMed	36526616
P0DTC5	SYYKLGASQRVAGDS is a linear peptidic epitope (epitope ID 1313724) tested in 7 T cell assays, 6 B cell assays and 8 MHC ligand assays.	IEDB	1313724	177	191	SYYKLGASQRVAGDS	ECO:0000213	PubMed	35699447
P0DTC5	TVEELKKLLEQWNLV is a linear peptidic epitope (epitope ID 1313811) tested in 1 T cell assay, 8 B cell assays and 4 MHC ligand assays.	IEDB	1313811	9	23	TVEELKKLLEQWNLV	ECO:0000213	PubMed	36646780
P0DTC5	YFIASFRLF is a linear peptidic epitope (epitope ID 1313989) tested in 8 T cell assays and 1 MHC ligand assay.	IEDB	1313989	95	103	YFIASFRLF	ECO:0000213	PubMed	36603583
P0DTC5	YFIASFRLF is a linear peptidic epitope (epitope ID 1313989) tested in 8 T cell assays and 1 MHC ligand assay.	IEDB	1313989	95	103	YFIASFRLF	ECO:0000213	PubMed	36526616
P0DTC5	ATSRTLSYYKLGASQ is a linear peptidic epitope (epitope ID 1315000) tested in 7 T cell assays, 12 B cell assays and 5 MHC ligand assays.	IEDB	1315000	171	185	ATSRTLSYYKLGASQ	ECO:0000213	PubMed	34529740
P0DTC5	CLVGLMWLSYFIASF is a linear peptidic epitope (epitope ID 1315219) tested in 10 T cell assays and 19 MHC ligand assays.	IEDB	1315219	86	100	CLVGLMWLSYFIASF	ECO:0000213	PubMed	34529740
P0DTC5	CLVGLMWLSYFIASF is a linear peptidic epitope (epitope ID 1315219) tested in 10 T cell assays and 19 MHC ligand assays.	IEDB	1315219	86	100	CLVGLMWLSYFIASF	ECO:0000213	PubMed	38781962
P0DTC5	EELKKLLEQWNLVIG is a linear peptidic epitope (epitope ID 1315749) tested in 5 T cell assays, 12 B cell assays and 4 MHC ligand assays.	IEDB	1315749	11	25	EELKKLLEQWNLVIG	ECO:0000213	PubMed	34529740
P0DTC5	FAYANRNRF is a linear peptidic epitope (epitope ID 1316317) tested in 3 T cell assays.	IEDB	1316317	37	45	FAYANRNRF	ECO:0000213	PubMed	34145459
P0DTC5	FAYANRNRF is a linear peptidic epitope (epitope ID 1316317) tested in 3 T cell assays.	IEDB	1316317	37	45	FAYANRNRF	ECO:0000213	PubMed	33853928
P0DTC5	GTILTRPLLESELVI is a linear peptidic epitope (epitope ID 1317854) tested in 3 T cell assays and 6 MHC ligand assays.	IEDB	1317854	126	140	GTILTRPLLESELVI	ECO:0000213	PubMed	34529740
P0DTC5	IAGHHLGRCDIKDLP is a linear peptidic epitope (epitope ID 1318293) tested in 4 T cell assays, 18 B cell assays and 19 MHC ligand assays.	IEDB	1318293	151	165	IAGHHLGRCDIKDLP	ECO:0000213	PubMed	34529740
P0DTC5	ITGGIAIAMACLVGL is a linear peptidic epitope (epitope ID 1319003) tested in 4 T cell assays, 6 B cell assays and 4 MHC ligand assays.	IEDB	1319003	76	90	ITGGIAIAMACLVGL	ECO:0000213	PubMed	34529740
P0DTC5	ITGGIAIAMACLVGL is a linear peptidic epitope (epitope ID 1319003) tested in 4 T cell assays, 6 B cell assays and 4 MHC ligand assays.	IEDB	1319003	76	90	ITGGIAIAMACLVGL	ECO:0000213	PubMed	38781962
P0DTC5	LGRCDIKDLPKEITV is a linear peptidic epitope (epitope ID 1320465) tested in 3 T cell assays and 19 MHC ligand assays.	IEDB	1320465	156	170	LGRCDIKDLPKEITV	ECO:0000213	PubMed	34529740
P0DTC5	LGRCDIKDLPKEITV is a linear peptidic epitope (epitope ID 1320465) tested in 3 T cell assays and 19 MHC ligand assays.	IEDB	1320465	156	170	LGRCDIKDLPKEITV	ECO:0000213	PubMed	38781962
P0DTC5	LIFLWLLWPVTLACF is a linear peptidic epitope (epitope ID 1320511) tested in 5 T cell assays, 12 B cell assays and 4 MHC ligand assays.	IEDB	1320511	51	65	LIFLWLLWPVTLACF	ECO:0000213	PubMed	34529740
P0DTC5	LLEQWNLVIGFLFLT is a linear peptidic epitope (epitope ID 1320697) tested in 4 T cell assays, 6 B cell assays and 4 MHC ligand assays.	IEDB	1320697	16	30	LLEQWNLVIGFLFLT	ECO:0000213	PubMed	34529740
P0DTC5	LLWPVTLACFVLAAV is a linear peptidic epitope (epitope ID 1320905) tested in 5 T cell assays and 4 MHC ligand assays.	IEDB	1320905	56	70	LLWPVTLACFVLAAV	ECO:0000213	PubMed	34529740
P0DTC5	LNTDHSSSSDNIALL is a linear peptidic epitope (epitope ID 1321028) tested in 3 T cell assays and 5 MHC ligand assays.	IEDB	1321028	206	220	LNTDHSSSSDNIALL	ECO:0000213	PubMed	34529740
P0DTC5	LPKEITVAT is a linear peptidic epitope (epitope ID 1321060) tested in 17 T cell assays.	IEDB	1321060	164	172	LPKEITVAT	ECO:0000213	PubMed	34793243
P0DTC5	LSYFIASFR is a linear peptidic epitope (epitope ID 1321267) tested in 6 T cell assays and 2 MHC ligand assays.	IEDB	1321267	93	101	LSYFIASFR	ECO:0000213	PubMed	34728796
P0DTC5	LVIGAVILR is a linear peptidic epitope (epitope ID 1321469) tested in 5 T cell assays and 2 MHC ligand assays.	IEDB	1321469	138	146	LVIGAVILR	ECO:0000213	PubMed	34728796
P0DTC5	QFAYANRNRFLYIIK is a linear peptidic epitope (epitope ID 1323210) tested in 6 T cell assays and 19 MHC ligand assays.	IEDB	1323210	36	50	QFAYANRNRFLYIIK	ECO:0000213	PubMed	34529740
P0DTC5	RGHLRIAGHHLGRCD is a linear peptidic epitope (epitope ID 1323796) tested in 33 T cell assays and 43 MHC ligand assays.	IEDB	1323796	146	160	RGHLRIAGHHLGRCD	ECO:0000213	PubMed	34529740
P0DTC5	RGHLRIAGHHLGRCD is a linear peptidic epitope (epitope ID 1323796) tested in 33 T cell assays and 43 MHC ligand assays.	IEDB	1323796	146	160	RGHLRIAGHHLGRCD	ECO:0000213	PubMed	38117652
P0DTC5	RGHLRIAGHHLGRCD is a linear peptidic epitope (epitope ID 1323796) tested in 33 T cell assays and 43 MHC ligand assays.	IEDB	1323796	146	160	RGHLRIAGHHLGRCD	ECO:0000213	PubMed	38781962
P0DTC5	RLFARTRSM is a linear peptidic epitope (epitope ID 1323857) tested in 5 T cell assays and 2 MHC ligand assays.	IEDB	1323857	101	109	RLFARTRSM	ECO:0000213	PubMed	34793243
P0DTC5	RNRFLYIIK is a linear peptidic epitope (epitope ID 1323998) tested in 8 T cell assays and 1 MHC ligand assay.	IEDB	1323998	42	50	RNRFLYIIK	ECO:0000213	PubMed	34728796
P0DTC5	RNRFLYIIK is a linear peptidic epitope (epitope ID 1323998) tested in 8 T cell assays and 1 MHC ligand assay.	IEDB	1323998	42	50	RNRFLYIIK	ECO:0000213	PubMed	35699447
P0DTC5	RVAGDSGFAAY is a linear peptidic epitope (epitope ID 1324090) tested in 8 T cell assays.	IEDB	1324090	186	196	RVAGDSGFAAY	ECO:0000213	PubMed	35383307
P0DTC5	RVAGDSGFAAY is a linear peptidic epitope (epitope ID 1324090) tested in 8 T cell assays.	IEDB	1324090	186	196	RVAGDSGFAAY	ECO:0000213	PubMed	37468623
P0DTC5	RVAGDSGFAAY is a linear peptidic epitope (epitope ID 1324090) tested in 8 T cell assays.	IEDB	1324090	186	196	RVAGDSGFAAY	ECO:0000213	PubMed	33853928
P0DTC5	RVAGDSGFAAYSRYR is a linear peptidic epitope (epitope ID 1324092) tested in 4 T cell assays and 4 MHC ligand assays.	IEDB	1324092	186	200	RVAGDSGFAAYSRYR	ECO:0000213	PubMed	34529740
P0DTC5	SFNPETNILLNVPLH is a linear peptidic epitope (epitope ID 1324411) tested in 4 T cell assays, 12 B cell assays and 6 MHC ligand assays.	IEDB	1324411	111	125	SFNPETNILLNVPLH	ECO:0000213	PubMed	34529740
P0DTC5	SGFAAYSRYRIGNYK is a linear peptidic epitope (epitope ID 1324427) tested in 7 T cell assays, 12 B cell assays and 19 MHC ligand assays.	IEDB	1324427	191	205	SGFAAYSRYRIGNYK	ECO:0000213	PubMed	34529740
P0DTC5	TRSMWSFNPETNILL is a linear peptidic epitope (epitope ID 1325865) tested in 7 T cell assays, 6 B cell assays and 5 MHC ligand assays.	IEDB	1325865	106	120	TRSMWSFNPETNILL	ECO:0000213	PubMed	34529740
P0DTC5	VATSRTLSY is a linear peptidic epitope (epitope ID 1326262) tested in 10 T cell assays and 10 MHC ligand assays.	IEDB	1326262	170	178	VATSRTLSY	ECO:0000213	PubMed	34171305
P0DTC5	VATSRTLSY is a linear peptidic epitope (epitope ID 1326262) tested in 10 T cell assays and 10 MHC ligand assays.	IEDB	1326262	170	178	VATSRTLSY	ECO:0000213	PubMed	33853928
P0DTC5	VLAAVYRINWITGGI is a linear peptidic epitope (epitope ID 1326559) tested in 10 T cell assays and 19 MHC ligand assays.	IEDB	1326559	66	80	VLAAVYRINWITGGI	ECO:0000213	PubMed	34529740
P0DTC5	VLAAVYRINWITGGI is a linear peptidic epitope (epitope ID 1326559) tested in 10 T cell assays and 19 MHC ligand assays.	IEDB	1326559	66	80	VLAAVYRINWITGGI	ECO:0000213	PubMed	38781962
P0DTC5	YANRNRFLY is a linear peptidic epitope (epitope ID 1327887) tested in 6 T cell assays.	IEDB	1327887	39	47	YANRNRFLY	ECO:0000213	PubMed	34793243
P0DTC5	YANRNRFLY is a linear peptidic epitope (epitope ID 1327887) tested in 6 T cell assays.	IEDB	1327887	39	47	YANRNRFLY	ECO:0000213	PubMed	35389886
P0DTC5	YRINWITGGIAIAMA is a linear peptidic epitope (epitope ID 1328509) tested in 26 T cell assays, 12 B cell assays and 19 MHC ligand assays.	IEDB	1328509	71	85	YRINWITGGIAIAMA	ECO:0000213	PubMed	34529740
P0DTC5	YRINWITGGIAIAMA is a linear peptidic epitope (epitope ID 1328509) tested in 26 T cell assays, 12 B cell assays and 19 MHC ligand assays.	IEDB	1328509	71	85	YRINWITGGIAIAMA	ECO:0000213	PubMed	38105139
P0DTC5	YRINWITGGIAIAMA is a linear peptidic epitope (epitope ID 1328509) tested in 26 T cell assays, 12 B cell assays and 19 MHC ligand assays.	IEDB	1328509	71	85	YRINWITGGIAIAMA	ECO:0000213	PubMed	38781962
P0DTC5	YSRYRIGNYK is a linear peptidic epitope (epitope ID 1328646) tested in 3 T cell assays and 2 MHC ligand assays.	IEDB	1328646	196	205	YSRYRIGNYK	ECO:0000213	PubMed	34728796
P0DTC5	YSRYRIGNYKLNTDH is a linear peptidic epitope (epitope ID 1328647) tested in 5 T cell assays, 6 B cell assays and 4 MHC ligand assays.	IEDB	1328647	196	210	YSRYRIGNYKLNTDH	ECO:0000213	PubMed	34529740
P0DTC5	YSRYRIGNYKLNTDH is a linear peptidic epitope (epitope ID 1328647) tested in 5 T cell assays, 6 B cell assays and 4 MHC ligand assays.	IEDB	1328647	196	210	YSRYRIGNYKLNTDH	ECO:0000213	PubMed	38781962
P0DTC5	GLMWLSYFI is a linear peptidic epitope (epitope ID 1330469) tested in 33 T cell assays and 10 MHC ligand assays.	IEDB	1330469	89	97	GLMWLSYFI	ECO:0000213	PubMed	33664060
P0DTC5	GLMWLSYFI is a linear peptidic epitope (epitope ID 1330469) tested in 33 T cell assays and 10 MHC ligand assays.	IEDB	1330469	89	97	GLMWLSYFI	ECO:0000213	PubMed	34210785
P0DTC5	GLMWLSYFI is a linear peptidic epitope (epitope ID 1330469) tested in 33 T cell assays and 10 MHC ligand assays.	IEDB	1330469	89	97	GLMWLSYFI	ECO:0000213	PubMed	34725257
P0DTC5	GLMWLSYFI is a linear peptidic epitope (epitope ID 1330469) tested in 33 T cell assays and 10 MHC ligand assays.	IEDB	1330469	89	97	GLMWLSYFI	ECO:0000213	PubMed	34728796
P0DTC5	GLMWLSYFI is a linear peptidic epitope (epitope ID 1330469) tested in 33 T cell assays and 10 MHC ligand assays.	IEDB	1330469	89	97	GLMWLSYFI	ECO:0000213	PubMed	34793243
P0DTC5	GLMWLSYFI is a linear peptidic epitope (epitope ID 1330469) tested in 33 T cell assays and 10 MHC ligand assays.	IEDB	1330469	89	97	GLMWLSYFI	ECO:0000213	PubMed	35937077
P0DTC5	GLMWLSYFI is a linear peptidic epitope (epitope ID 1330469) tested in 33 T cell assays and 10 MHC ligand assays.	IEDB	1330469	89	97	GLMWLSYFI	ECO:0000213	PubMed	36254196
P0DTC5	GLMWLSYFI is a linear peptidic epitope (epitope ID 1330469) tested in 33 T cell assays and 10 MHC ligand assays.	IEDB	1330469	89	97	GLMWLSYFI	ECO:0000213	PubMed	38605956
P0DTC5	GLMWLSYFI is a linear peptidic epitope (epitope ID 1330469) tested in 33 T cell assays and 10 MHC ligand assays.	IEDB	1330469	89	97	GLMWLSYFI	ECO:0000213	PubMed	33911008
P0DTC5	GLMWLSYFI is a linear peptidic epitope (epitope ID 1330469) tested in 33 T cell assays and 10 MHC ligand assays.	IEDB	1330469	89	97	GLMWLSYFI	ECO:0000213	PubMed	34231935
P0DTC5	GLMWLSYFI is a linear peptidic epitope (epitope ID 1330469) tested in 33 T cell assays and 10 MHC ligand assays.	IEDB	1330469	89	97	GLMWLSYFI	ECO:0000213	PubMed	33853928
P0DTC5	ANRNRFLYI is a linear peptidic epitope (epitope ID 1330954) tested in 2 T cell assays.	IEDB	1330954	40	48	ANRNRFLYI	ECO:0000213	PubMed	33853928
P0DTC5	AYANRNRF is a linear peptidic epitope (epitope ID 1331115) tested in 1 T cell assay.	IEDB	1331115	38	45	AYANRNRF	ECO:0000213	PubMed	33853928
P0DTC5	AYANRNRFL is a linear peptidic epitope (epitope ID 1331116) tested in 1 T cell assay.	IEDB	1331116	38	46	AYANRNRFL	ECO:0000213	PubMed	33853928
P0DTC5	FRLFARTRSM is a linear peptidic epitope (epitope ID 1331987) tested in 1 T cell assay.	IEDB	1331987	100	109	FRLFARTRSM	ECO:0000213	PubMed	33853928
P0DTC5	HLRIAGHHL is a linear peptidic epitope (epitope ID 1332258) tested in 9 T cell assays and 5 MHC ligand assays.	IEDB	1332258	148	156	HLRIAGHHL	ECO:0000213	PubMed	34728796
P0DTC5	HLRIAGHHL is a linear peptidic epitope (epitope ID 1332258) tested in 9 T cell assays and 5 MHC ligand assays.	IEDB	1332258	148	156	HLRIAGHHL	ECO:0000213	PubMed	35389886
P0DTC5	HLRIAGHHL is a linear peptidic epitope (epitope ID 1332258) tested in 9 T cell assays and 5 MHC ligand assays.	IEDB	1332258	148	156	HLRIAGHHL	ECO:0000213	PubMed	33853928
P0DTC5	HLRIAGHHL is a linear peptidic epitope (epitope ID 1332258) tested in 9 T cell assays and 5 MHC ligand assays.	IEDB	1332258	148	156	HLRIAGHHL	ECO:0000213	PubMed	35699447
P0DTC5	IFLWLLWPV is a linear peptidic epitope (epitope ID 1332347) tested in 6 T cell assays and 1 MHC ligand assay.	IEDB	1332347	52	60	IFLWLLWPV	ECO:0000213	PubMed	34793243
P0DTC5	IFLWLLWPV is a linear peptidic epitope (epitope ID 1332347) tested in 6 T cell assays and 1 MHC ligand assay.	IEDB	1332347	52	60	IFLWLLWPV	ECO:0000213	PubMed	38605956
P0DTC5	IFLWLLWPV is a linear peptidic epitope (epitope ID 1332347) tested in 6 T cell assays and 1 MHC ligand assay.	IEDB	1332347	52	60	IFLWLLWPV	ECO:0000213	PubMed	33911008
P0DTC5	LLWPVTLAC is a linear peptidic epitope (epitope ID 1332668) tested in 3 T cell assays.	IEDB	1332668	56	64	LLWPVTLAC	ECO:0000213	PubMed	34793243
P0DTC5	LLWPVTLAC is a linear peptidic epitope (epitope ID 1332668) tested in 3 T cell assays.	IEDB	1332668	56	64	LLWPVTLAC	ECO:0000213	PubMed	33853928
P0DTC5	RFLYIIKLIF is a linear peptidic epitope (epitope ID 1333300) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1333300	44	53	RFLYIIKLIF	ECO:0000213	PubMed	34728796
P0DTC5	RFLYIIKLIF is a linear peptidic epitope (epitope ID 1333300) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1333300	44	53	RFLYIIKLIF	ECO:0000213	PubMed	33853928
P0DTC5	RNRFLYIIKL is a linear peptidic epitope (epitope ID 1333365) tested in 1 T cell assay.	IEDB	1333365	42	51	RNRFLYIIKL	ECO:0000213	PubMed	33853928
P0DTC5	SQRVAGDSGF is a linear peptidic epitope (epitope ID 1333772) tested in 1 T cell assay.	IEDB	1333772	184	193	SQRVAGDSGF	ECO:0000213	PubMed	33853928
P0DTC5	VATSRTLSYY is a linear peptidic epitope (epitope ID 1334141) tested in 1 T cell assay.	IEDB	1334141	170	179	VATSRTLSYY	ECO:0000213	PubMed	33853928
P0DTC5	HSSSSDNIALLVQ is a linear peptidic epitope (epitope ID 1382255) tested in 2 B cell assays and 2 MHC ligand assays.	IEDB	1382255	210	222	HSSSSDNIALLVQ	ECO:0000213	PubMed	38117652
P0DTC5	TDHSSSSDNIALLVQ is a linear peptidic epitope (epitope ID 1389375) tested in 2 T cell assays, 10 B cell assays and 6 MHC ligand assays.	IEDB	1389375	208	222	TDHSSSSDNIALLVQ	ECO:0000213	PubMed	34529740
P0DTC5	TDHSSSSDNIALLVQ is a linear peptidic epitope (epitope ID 1389375) tested in 2 T cell assays, 10 B cell assays and 6 MHC ligand assays.	IEDB	1389375	208	222	TDHSSSSDNIALLVQ	ECO:0000213	PubMed	38117652
P0DTC5	RLFARTRS is a linear peptidic epitope (epitope ID 1403183) tested in 1 T cell assay.	IEDB	1403183	101	108	RLFARTRS	ECO:0000213	PubMed	34249101
P0DTC5	ELVIGAVILRGH is a linear peptidic epitope (epitope ID 1428700) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1428700	137	148	ELVIGAVILRGH	ECO:0000213	PubMed	38117652
P0DTC5	GHLRIAGHHLGR is a linear peptidic epitope (epitope ID 1440720) tested in 6 B cell assays and 1 MHC ligand assay.	IEDB	1440720	147	158	GHLRIAGHHLGR	ECO:0000213	PubMed	38117652
P0DTC5	LACFVLAAV is a linear peptidic epitope (epitope ID 1463734) tested in 2 T cell assays and 3 B cell assays.	IEDB	1463734	62	70	LACFVLAAV	ECO:0000213	PubMed	34793243
P0DTC5	LVIGAVILRGHL is a linear peptidic epitope (epitope ID 1474168) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1474168	138	149	LVIGAVILRGHL	ECO:0000213	PubMed	38117652
P0DTC5	ESELVIGAVILRGHL is a linear peptidic epitope (epitope ID 1540144) tested in 1 T cell assay, 4 B cell assays and 7 MHC ligand assays.	IEDB	1540144	135	149	ESELVIGAVILRGHL	ECO:0000213	PubMed	38105139
P0DTC5	ESELVIGAVILRGHL is a linear peptidic epitope (epitope ID 1540144) tested in 1 T cell assay, 4 B cell assays and 7 MHC ligand assays.	IEDB	1540144	135	149	ESELVIGAVILRGHL	ECO:0000213	PubMed	38117652
P0DTC5	TLSYYKLGASQRVAG is a linear peptidic epitope (epitope ID 1542842) tested in 6 T cell assays, 10 B cell assays and 10 MHC ligand assays.	IEDB	1542842	175	189	TLSYYKLGASQRVAG	ECO:0000213	PubMed	38117652
P0DTC5	LSYYKLGASQRVAG is a linear peptidic epitope (epitope ID 1596708) tested in 5 MHC ligand assays.	IEDB	1596708	176	189	LSYYKLGASQRVAG	ECO:0000213	PubMed	38117652
P0DTC5	RTLSYYKLGASQRVA is a linear peptidic epitope (epitope ID 1596769) tested in 1 T cell assay and 10 MHC ligand assays.	IEDB	1596769	174	188	RTLSYYKLGASQRVA	ECO:0000213	PubMed	38105139
P0DTC5	RTLSYYKLGASQRVA is a linear peptidic epitope (epitope ID 1596769) tested in 1 T cell assay and 10 MHC ligand assays.	IEDB	1596769	174	188	RTLSYYKLGASQRVA	ECO:0000213	PubMed	38117652
P0DTC5	TLSYYKLGASQRVA is a linear peptidic epitope (epitope ID 1596814) tested in 5 MHC ligand assays.	IEDB	1596814	175	188	TLSYYKLGASQRVA	ECO:0000213	PubMed	38117652
P0DTC5	FLFLTWICLL is a linear peptidic epitope (epitope ID 1597685) tested in 2 T cell assays and 5 MHC ligand assays.	IEDB	1597685	26	35	FLFLTWICLL	ECO:0000213	PubMed	34728796
P0DTC5	FLFLTWICLL is a linear peptidic epitope (epitope ID 1597685) tested in 2 T cell assays and 5 MHC ligand assays.	IEDB	1597685	26	35	FLFLTWICLL	ECO:0000213	PubMed	35937077
P0DTC5	GTITVEELKKLLEQW is a linear peptidic epitope (epitope ID 1597701) tested in 2 T cell assays and 4 MHC ligand assays.	IEDB	1597701	6	20	GTITVEELKKLLEQW	ECO:0000213	PubMed	34529740
P0DTC5	YYKLGASQRVA is a linear peptidic epitope (epitope ID 1597864) tested in 1 T cell assay.	IEDB	1597864	178	188	YYKLGASQRVA	ECO:0000213	PubMed	34529740
P0DTC5	LLWPVTLACFV is a linear peptidic epitope (epitope ID 1634839) tested in 2 T cell assays.	IEDB	1634839	56	66	LLWPVTLACFV	ECO:0000213	PubMed	34725257
P0DTC5	AMACLVGLM is a linear peptidic epitope (epitope ID 1645199) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1645199	83	91	AMACLVGLM	ECO:0000213	PubMed	34728796
P0DTC5	FIASFRLFA is a linear peptidic epitope (epitope ID 1657163) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1657163	96	104	FIASFRLFA	ECO:0000213	PubMed	34728796
P0DTC5	FIASFRLFA is a linear peptidic epitope (epitope ID 1657163) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1657163	96	104	FIASFRLFA	ECO:0000213	PubMed	34793243
P0DTC5	FLWLLWPVTLACFVLA is a linear peptidic epitope (epitope ID 1657930) tested in 2 T cell assays and 2 B cell assays.	IEDB	1657930	53	68	FLWLLWPVTLACFVLA	ECO:0000213	PubMed	34696201
P0DTC5	IAMACLVGL is a linear peptidic epitope (epitope ID 1665467) tested in 4 T cell assays and 2 MHC ligand assays.	IEDB	1665467	82	90	IAMACLVGL	ECO:0000213	PubMed	34728796
P0DTC5	ILRGHLRIA is a linear peptidic epitope (epitope ID 1667165) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1667165	144	152	ILRGHLRIA	ECO:0000213	PubMed	34728796
P0DTC5	LYIIKLIFLW is a linear peptidic epitope (epitope ID 1679107) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1679107	46	55	LYIIKLIFLW	ECO:0000213	PubMed	34728796
P0DTC5	RTRSMWSFN is a linear peptidic epitope (epitope ID 1691523) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1691523	105	113	RTRSMWSFN	ECO:0000213	PubMed	34728796
P0DTC5	SFRLFARTR is a linear peptidic epitope (epitope ID 1693062) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1693062	99	107	SFRLFARTR	ECO:0000213	PubMed	34728796
P0DTC5	VTLACFVLA is a linear peptidic epitope (epitope ID 1706301) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1706301	60	68	VTLACFVLA	ECO:0000213	PubMed	34728796
P0DTC5	YYKLGASQR is a linear peptidic epitope (epitope ID 1711481) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1711481	178	186	YYKLGASQR	ECO:0000213	PubMed	34728796
P0DTC5	HLRIAGHHLGRCDIK is a linear peptidic epitope (epitope ID 2001099) tested in 6 T cell assays, 6 B cell assays and 4 MHC ligand assays.	IEDB	2001099	148	162	HLRIAGHHLGRCDIK	ECO:0000213	PubMed	39066169
P0DTC5	SQRVAGDSGFAAYSR is a linear peptidic epitope (epitope ID 2001318) tested in 1 T cell assay, 6 B cell assays and 4 MHC ligand assays.	IEDB	2001318	184	198	SQRVAGDSGFAAYSR	ECO:0000213	PubMed	38105139
P0DTC5	SYFIASFRLFARTRS is a linear peptidic epitope (epitope ID 2001328) tested in 1 T cell assay, 6 B cell assays and 4 MHC ligand assays.	IEDB	2001328	94	108	SYFIASFRLFARTRS	ECO:0000213	PubMed	38105139
P0DTC5	ILRGHLRIAGHHLGR is a linear peptidic epitope (epitope ID 2131916) tested in 5 T cell assays and 5 MHC ligand assays.	IEDB	2131916	144	158	ILRGHLRIAGHHLGR	ECO:0000213	PubMed	38117652
P0DTC5	RGHLRIAGHHLGR is a linear peptidic epitope (epitope ID 2132984) tested in 2 MHC ligand assays.	IEDB	2132984	146	158	RGHLRIAGHHLGR	ECO:0000213	PubMed	38117652
P0DTC5	LMWLSYFIA is a linear peptidic epitope (epitope ID 2134169) tested in 2 T cell assays.	IEDB	2134169	90	98	LMWLSYFIA	ECO:0000213	PubMed	34793243
P0DTC5	LVGLMWLSY is a linear peptidic epitope (epitope ID 2134188) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	2134188	87	95	LVGLMWLSY	ECO:0000213	PubMed	34793243
P0DTC5	PVTLACFVL is a linear peptidic epitope (epitope ID 2134233) tested in 1 T cell assay.	IEDB	2134233	59	67	PVTLACFVL	ECO:0000213	PubMed	34793243
P0DTC5	QWNLVIGFL is a linear peptidic epitope (epitope ID 2134247) tested in 3 T cell assays.	IEDB	2134247	19	27	QWNLVIGFL	ECO:0000213	PubMed	34793243
P0DTC5	RFLYIIKLI is a linear peptidic epitope (epitope ID 2134251) tested in 5 T cell assays.	IEDB	2134251	44	52	RFLYIIKLI	ECO:0000213	PubMed	34793243
P0DTC5	RFLYIIKLI is a linear peptidic epitope (epitope ID 2134251) tested in 5 T cell assays.	IEDB	2134251	44	52	RFLYIIKLI	ECO:0000213	PubMed	36603583
P0DTC5	SSDNIALLV is a linear peptidic epitope (epitope ID 2134280) tested in 3 T cell assays and 2 MHC ligand assays.	IEDB	2134280	213	221	SSDNIALLV	ECO:0000213	PubMed	34793243
P0DTC5	WPVTLACFV is a linear peptidic epitope (epitope ID 2134348) tested in 2 T cell assays.	IEDB	2134348	58	66	WPVTLACFV	ECO:0000213	PubMed	34793243
P0DTC5	LYIIKLIFL is a linear peptidic epitope (epitope ID 2154383) tested in 4 T cell assays.	IEDB	2154383	46	54	LYIIKLIFL	ECO:0000213	PubMed	36526616
P0DTC5	NRNRFLYII is a linear peptidic epitope (epitope ID 2157722) tested in 2 T cell assays.	IEDB	2157722	41	49	NRNRFLYII	ECO:0000213	PubMed	36603583
P0DTC5	GTITVEELKKL is a linear peptidic epitope (epitope ID 2243448) tested in 3 B cell assays.	IEDB	2243448	6	16	GTITVEELKKL	ECO:0000213	PubMed	37766081
P0DTC5	ELVIGAVILRGHLR is a linear peptidic epitope (epitope ID 2249833) tested in 1 MHC ligand assay.	IEDB	2249833	137	150	ELVIGAVILRGHLR	ECO:0000213	PubMed	38117652
P0DTC5	ESELVIGAVILRGH is a linear peptidic epitope (epitope ID 2249878) tested in 1 MHC ligand assay.	IEDB	2249878	135	148	ESELVIGAVILRGH	ECO:0000213	PubMed	38117652
P0DTC5	GAVILRGHLR is a linear peptidic epitope (epitope ID 2250057) tested in 1 MHC ligand assay.	IEDB	2250057	141	150	GAVILRGHLR	ECO:0000213	PubMed	38117652
P0DTC5	IGAVILRGH is a linear peptidic epitope (epitope ID 2250476) tested in 1 MHC ligand assay.	IEDB	2250476	140	148	IGAVILRGH	ECO:0000213	PubMed	38117652
P0DTC5	IGAVILRGHL is a linear peptidic epitope (epitope ID 2250477) tested in 1 MHC ligand assay.	IEDB	2250477	140	149	IGAVILRGHL	ECO:0000213	PubMed	38117652
P0DTC5	IGAVILRGHLR is a linear peptidic epitope (epitope ID 2250478) tested in 1 MHC ligand assay.	IEDB	2250478	140	150	IGAVILRGHLR	ECO:0000213	PubMed	38117652
P0DTC5	LLWPVTLACF is a linear peptidic epitope (epitope ID 2251030) tested in 1 T cell assay.	IEDB	2251030	56	65	LLWPVTLACF	ECO:0000213	PubMed	38105139
P0DTC5	LRGHLRIAGHHLGR is a linear peptidic epitope (epitope ID 2251090) tested in 1 MHC ligand assay.	IEDB	2251090	145	158	LRGHLRIAGHHLGR	ECO:0000213	PubMed	38117652
P0DTC5	LVIGAVILRGH is a linear peptidic epitope (epitope ID 2251144) tested in 1 MHC ligand assay.	IEDB	2251144	138	148	LVIGAVILRGH	ECO:0000213	PubMed	38117652
P0DTC5	LVIGAVILRGHLR is a linear peptidic epitope (epitope ID 2251145) tested in 1 MHC ligand assay.	IEDB	2251145	138	150	LVIGAVILRGHLR	ECO:0000213	PubMed	38117652
P0DTC5	NVPLHGTILTRPLL is a linear peptidic epitope (epitope ID 2251426) tested in 1 MHC ligand assay.	IEDB	2251426	121	134	NVPLHGTILTRPLL	ECO:0000213	PubMed	38117652
P0DTC5	RCDIKDLPKEITVA is a linear peptidic epitope (epitope ID 2251710) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	2251710	158	171	RCDIKDLPKEITVA	ECO:0000213	PubMed	38117652
P0DTC5	SELVIGAVILR is a linear peptidic epitope (epitope ID 2251960) tested in 1 MHC ligand assay.	IEDB	2251960	136	146	SELVIGAVILR	ECO:0000213	PubMed	38117652
P0DTC5	SELVIGAVILRGH is a linear peptidic epitope (epitope ID 2251961) tested in 1 MHC ligand assay.	IEDB	2251961	136	148	SELVIGAVILRGH	ECO:0000213	PubMed	38117652
P0DTC5	SELVIGAVILRGHL is a linear peptidic epitope (epitope ID 2251962) tested in 1 MHC ligand assay.	IEDB	2251962	136	149	SELVIGAVILRGHL	ECO:0000213	PubMed	38117652
P0DTC5	VIGAVILRGH is a linear peptidic epitope (epitope ID 2252516) tested in 1 MHC ligand assay.	IEDB	2252516	139	148	VIGAVILRGH	ECO:0000213	PubMed	38117652
P0DTC5	LSYFIASF is a linear peptidic epitope (epitope ID 2269205) tested in 1 B cell assay.	IEDB	2269205	93	100	LSYFIASF	ECO:0000213	PubMed	39598409
P0DTC6	HLVDFQVTI is a linear peptidic epitope (epitope ID 24313) tested in 21 T cell assays and 13 MHC ligand assays.	IEDB	24313	3	11	HLVDFQVTI	ECO:0000213	PubMed	34145459
P0DTC6	HLVDFQVTI is a linear peptidic epitope (epitope ID 24313) tested in 21 T cell assays and 13 MHC ligand assays.	IEDB	24313	3	11	HLVDFQVTI	ECO:0000213	PubMed	35389886
P0DTC6	HLVDFQVTI is a linear peptidic epitope (epitope ID 24313) tested in 21 T cell assays and 13 MHC ligand assays.	IEDB	24313	3	11	HLVDFQVTI	ECO:0000213	PubMed	36254196
P0DTC6	HLVDFQVTI is a linear peptidic epitope (epitope ID 24313) tested in 21 T cell assays and 13 MHC ligand assays.	IEDB	24313	3	11	HLVDFQVTI	ECO:0000213	PubMed	38605956
P0DTC6	HLVDFQVTI is a linear peptidic epitope (epitope ID 24313) tested in 21 T cell assays and 13 MHC ligand assays.	IEDB	24313	3	11	HLVDFQVTI	ECO:0000213	PubMed	33911008
P0DTC6	HLVDFQVTI is a linear peptidic epitope (epitope ID 24313) tested in 21 T cell assays and 13 MHC ligand assays.	IEDB	24313	3	11	HLVDFQVTI	ECO:0000213	PubMed	33853928
P0DTC6	IWNLDYIINLIIKNL is a linear peptidic epitope (epitope ID 1310517) tested in 8 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1310517	26	40	IWNLDYIINLIIKNL	ECO:0000213	PubMed	32999467
P0DTC6	KVSIWNLDY is a linear peptidic epitope (epitope ID 1310558) tested in 4 T cell assays.	IEDB	1310558	23	31	KVSIWNLDY	ECO:0000213	PubMed	34793243
P0DTC6	RTFKVSIWNLDY is a linear peptidic epitope (epitope ID 1310776) tested in 2 T cell assays and 6 B cell assays.	IEDB	1310776	20	31	RTFKVSIWNLDY	ECO:0000213	PubMed	32999467
P0DTC6	SIWNLDYIINL is a linear peptidic epitope (epitope ID 1310804) tested in 3 T cell assays.	IEDB	1310804	25	35	SIWNLDYIINL	ECO:0000213	PubMed	33853928
P0DTC6	AEILLIIMRTFKVSI is a linear peptidic epitope (epitope ID 1330789) tested in 14 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1330789	12	26	AEILLIIMRTFKVSI	ECO:0000213	PubMed	38605956
P0DTC6	AEILLIIMRTFKVSI is a linear peptidic epitope (epitope ID 1330789) tested in 14 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1330789	12	26	AEILLIIMRTFKVSI	ECO:0000213	PubMed	33911008
P0DTC6	HLVDFQVTIA is a linear peptidic epitope (epitope ID 1332260) tested in 1 T cell assay.	IEDB	1332260	3	12	HLVDFQVTIA	ECO:0000213	PubMed	33853928
P0DTC6	LIIMRTFKV is a linear peptidic epitope (epitope ID 1332625) tested in 4 T cell assays.	IEDB	1332625	16	24	LIIMRTFKV	ECO:0000213	PubMed	34793243
P0DTC6	LIIMRTFKV is a linear peptidic epitope (epitope ID 1332625) tested in 4 T cell assays.	IEDB	1332625	16	24	LIIMRTFKV	ECO:0000213	PubMed	33853928
P0DTC6	TFKVSIWNL is a linear peptidic epitope (epitope ID 1333954) tested in 11 T cell assays.	IEDB	1333954	21	29	TFKVSIWNL	ECO:0000213	PubMed	34145459
P0DTC6	TFKVSIWNL is a linear peptidic epitope (epitope ID 1333954) tested in 11 T cell assays.	IEDB	1333954	21	29	TFKVSIWNL	ECO:0000213	PubMed	33853928
P0DTC6	LLIIMRTFK is a linear peptidic epitope (epitope ID 1597178) tested in 1 T cell assay.	IEDB	1597178	15	23	LLIIMRTFK	ECO:0000213	PubMed	34506741
P0DTC6	NLDYIINLI is a linear peptidic epitope (epitope ID 2134209) tested in 1 T cell assay.	IEDB	2134209	28	36	NLDYIINLI	ECO:0000213	PubMed	34793243
P0DTC6	SIWNLDYII is a linear peptidic epitope (epitope ID 2134271) tested in 1 T cell assay.	IEDB	2134271	25	33	SIWNLDYII	ECO:0000213	PubMed	34793243
P0DTC6	YIINLIIKNLSKS is a linear peptidic epitope (epitope ID 2252835) tested in 1 MHC ligand assay.	IEDB	2252835	31	43	YIINLIIKNLSKS	ECO:0000213	PubMed	38117652
P0DTC7	HPLADNKFAL is a linear peptidic epitope (epitope ID 24466) tested in 3 T cell assays and 5 MHC ligand assays.	IEDB	24466	47	56	HPLADNKFAL	ECO:0000213	PubMed	33853928
P0DTC7	KLFIRQEEV is a linear peptidic epitope (epitope ID 31846) tested in 5 T cell assays and 22 MHC ligand assays.	IEDB	31846	85	93	KLFIRQEEV	ECO:0000213	PubMed	34793243
P0DTC7	YEGNSPFHPL is a linear peptidic epitope (epitope ID 73668) tested in 4 T cell assays and 6 MHC ligand assays.	IEDB	73668	40	49	YEGNSPFHPL	ECO:0000213	PubMed	32999467
P0DTC7	IRQEEVQEL is a linear peptidic epitope (epitope ID 1310507) tested in 7 T cell assays and 10 MHC ligand assays.	IEDB	1310507	88	96	IRQEEVQEL	ECO:0000213	PubMed	34171305
P0DTC7	MKIILFLALITLATC is a linear peptidic epitope (epitope ID 1310643) tested in 7 T cell assays, 9 B cell assays and 6 MHC ligand assays.	IEDB	1310643	1	15	MKIILFLALITLATC	ECO:0000213	PubMed	38605956
P0DTC7	MKIILFLALITLATC is a linear peptidic epitope (epitope ID 1310643) tested in 7 T cell assays, 9 B cell assays and 6 MHC ligand assays.	IEDB	1310643	1	15	MKIILFLALITLATC	ECO:0000213	PubMed	33911008
P0DTC7	QEEVQELYSPIFLIV is a linear peptidic epitope (epitope ID 1310732) tested in 3 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1310732	90	104	QEEVQELYSPIFLIV	ECO:0000213	PubMed	32999467
P0DTC7	QLRARSVSPK is a linear peptidic epitope (epitope ID 1310741) tested in 7 T cell assays.	IEDB	1310741	76	85	QLRARSVSPK	ECO:0000213	PubMed	35389886
P0DTC7	QLRARSVSPK is a linear peptidic epitope (epitope ID 1310741) tested in 7 T cell assays.	IEDB	1310741	76	85	QLRARSVSPK	ECO:0000213	PubMed	36494499
P0DTC7	QLRARSVSPK is a linear peptidic epitope (epitope ID 1310741) tested in 7 T cell assays.	IEDB	1310741	76	85	QLRARSVSPK	ECO:0000213	PubMed	32999467
P0DTC7	VKHVYQLRARSVSPK is a linear peptidic epitope (epitope ID 1310893) tested in 7 T cell assays, 8 B cell assays and 3 MHC ligand assays.	IEDB	1310893	71	85	VKHVYQLRARSVSPK	ECO:0000213	PubMed	38105139
P0DTC7	RARSVSPKL is a linear peptidic epitope (epitope ID 1330565) tested in 6 T cell assays.	IEDB	1330565	78	86	RARSVSPKL	ECO:0000213	PubMed	35484232
P0DTC7	RARSVSPKL is a linear peptidic epitope (epitope ID 1330565) tested in 6 T cell assays.	IEDB	1330565	78	86	RARSVSPKL	ECO:0000213	PubMed	33427749
P0DTC7	EGNSPFHPL is a linear peptidic epitope (epitope ID 1331581) tested in 1 T cell assay.	IEDB	1331581	41	49	EGNSPFHPL	ECO:0000213	PubMed	33853928
P0DTC7	FACPDGVKHVY is a linear peptidic epitope (epitope ID 1331926) tested in 1 T cell assay.	IEDB	1331926	65	75	FACPDGVKHVY	ECO:0000213	PubMed	33853928
P0DTC7	FIRQEEVQELY is a linear peptidic epitope (epitope ID 1331954) tested in 2 T cell assays.	IEDB	1331954	87	97	FIRQEEVQELY	ECO:0000213	PubMed	33853928
P0DTC7	IILFLALITLATCEL is a linear peptidic epitope (epitope ID 1332359) tested in 5 T cell assays and 3 MHC ligand assays.	IEDB	1332359	3	17	IILFLALITLATCEL	ECO:0000213	PubMed	38605956
P0DTC7	IILFLALITLATCEL is a linear peptidic epitope (epitope ID 1332359) tested in 5 T cell assays and 3 MHC ligand assays.	IEDB	1332359	3	17	IILFLALITLATCEL	ECO:0000213	PubMed	33911008
P0DTC7	KFALTCFSTQF is a linear peptidic epitope (epitope ID 1332462) tested in 1 T cell assay.	IEDB	1332462	53	63	KFALTCFSTQF	ECO:0000213	PubMed	33853928
P0DTC7	LLKEPCSSGTY is a linear peptidic epitope (epitope ID 1332642) tested in 1 T cell assay.	IEDB	1332642	30	40	LLKEPCSSGTY	ECO:0000213	PubMed	33853928
P0DTC7	SPIFLIVAA is a linear peptidic epitope (epitope ID 1333721) tested in 3 T cell assays.	IEDB	1333721	98	106	SPIFLIVAA	ECO:0000213	PubMed	33853928
P0DTC7	SPIFLIVAAIVFITL is a linear peptidic epitope (epitope ID 1333722) tested in 5 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1333722	98	112	SPIFLIVAAIVFITL	ECO:0000213	PubMed	38605956
P0DTC7	SPIFLIVAAIVFITL is a linear peptidic epitope (epitope ID 1333722) tested in 5 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1333722	98	112	SPIFLIVAAIVFITL	ECO:0000213	PubMed	33911008
P0DTC7	ELYHYQECV is a linear peptidic epitope (epitope ID 2134041) tested in 1 T cell assay.	IEDB	2134041	16	24	ELYHYQECV	ECO:0000213	PubMed	34793243
P0DTC7	ELYSPIFLI is a linear peptidic epitope (epitope ID 2134042) tested in 2 T cell assays.	IEDB	2134042	95	103	ELYSPIFLI	ECO:0000213	PubMed	34793243
P0DTC7	FAFACPDGV is a linear peptidic epitope (epitope ID 2134047) tested in 2 T cell assays.	IEDB	2134047	63	71	FAFACPDGV	ECO:0000213	PubMed	34793243
P0DTC7	ITLATCELY is a linear peptidic epitope (epitope ID 2134125) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	2134125	10	18	ITLATCELY	ECO:0000213	PubMed	34793243
P0DTC7	KIILFLALI is a linear peptidic epitope (epitope ID 2134135) tested in 2 T cell assays.	IEDB	2134135	2	10	KIILFLALI	ECO:0000213	PubMed	34793243
P0DTC7	TLCFTLKRKTE is a linear peptidic epitope (epitope ID 2150872) tested in 10 B cell assays.	IEDB	2150872	111	121	TLCFTLKRKTE	ECO:0000213	PubMed	36618358
P0DTC8	EPKLGSLVV is a linear peptidic epitope (epitope ID 1310370) tested in 5 T cell assays.	IEDB	1310370	92	100	EPKLGSLVV	ECO:0000213	PubMed	33853928
P0DTC8	EYHDVRVVL is a linear peptidic epitope (epitope ID 1310379) tested in 3 T cell assays.	IEDB	1310379	110	118	EYHDVRVVL	ECO:0000213	PubMed	33853928
P0DTC8	EYHDVRVVLDF is a linear peptidic epitope (epitope ID 1310380) tested in 3 T cell assays.	IEDB	1310380	110	120	EYHDVRVVLDF	ECO:0000213	PubMed	33853928
P0DTC8	FLGIITTVAAFHQEC is a linear peptidic epitope (epitope ID 1310404) tested in 6 T cell assays, 6 B cell assays and 3 MHC ligand assays.	IEDB	1310404	6	20	FLGIITTVAAFHQEC	ECO:0000213	PubMed	34003073
P0DTC8	FYSKWYIRVGARKSA is a linear peptidic epitope (epitope ID 1310428) tested in 22 T cell assays, 10 B cell assays and 18 MHC ligand assays.	IEDB	1310428	41	55	FYSKWYIRVGARKSA	ECO:0000213	PubMed	34003073
P0DTC8	LEYHDVRVVL is a linear peptidic epitope (epitope ID 1310570) tested in 2 T cell assays.	IEDB	1310570	109	118	LEYHDVRVVL	ECO:0000213	PubMed	32999467
P0DTC8	SKWYIRVGARKSAPL is a linear peptidic epitope (epitope ID 1310806) tested in 25 T cell assays and 4 MHC ligand assays.	IEDB	1310806	43	57	SKWYIRVGARKSAPL	ECO:0000213	PubMed	34814158
P0DTC8	SKWYIRVGARKSAPL is a linear peptidic epitope (epitope ID 1310806) tested in 25 T cell assays and 4 MHC ligand assays.	IEDB	1310806	43	57	SKWYIRVGARKSAPL	ECO:0000213	PubMed	35104433
P0DTC8	SKWYIRVGARKSAPL is a linear peptidic epitope (epitope ID 1310806) tested in 25 T cell assays and 4 MHC ligand assays.	IEDB	1310806	43	57	SKWYIRVGARKSAPL	ECO:0000213	PubMed	37596280
P0DTC8	SKWYIRVGARKSAPL is a linear peptidic epitope (epitope ID 1310806) tested in 25 T cell assays and 4 MHC ligand assays.	IEDB	1310806	43	57	SKWYIRVGARKSAPL	ECO:0000213	PubMed	32999467
P0DTC8	SKWYIRVGARKSAPL is a linear peptidic epitope (epitope ID 1310806) tested in 25 T cell assays and 4 MHC ligand assays.	IEDB	1310806	43	57	SKWYIRVGARKSAPL	ECO:0000213	PubMed	35857619
P0DTC8	YIDIGNYTV is a linear peptidic epitope (epitope ID 1310957) tested in 16 T cell assays and 3 MHC ligand assays.	IEDB	1310957	73	81	YIDIGNYTV	ECO:0000213	PubMed	34793243
P0DTC8	YIDIGNYTV is a linear peptidic epitope (epitope ID 1310957) tested in 16 T cell assays and 3 MHC ligand assays.	IEDB	1310957	73	81	YIDIGNYTV	ECO:0000213	PubMed	38605956
P0DTC8	YIDIGNYTV is a linear peptidic epitope (epitope ID 1310957) tested in 16 T cell assays and 3 MHC ligand assays.	IEDB	1310957	73	81	YIDIGNYTV	ECO:0000213	PubMed	33911008
P0DTC8	YIRVGARKSAPLIEL is a linear peptidic epitope (epitope ID 1310959) tested in 9 T cell assays, 6 B cell assays and 3 MHC ligand assays.	IEDB	1310959	46	60	YIRVGARKSAPLIEL	ECO:0000213	PubMed	34003073
P0DTC8	ARKSAPLIELCVDEA is a linear peptidic epitope (epitope ID 1314804) tested in 1 T cell assay, 10 B cell assays and 6 MHC ligand assays.	IEDB	1314804	51	65	ARKSAPLIELCVDEA	ECO:0000213	PubMed	34003073
P0DTC8	CVDEAGSKSPIQYID is a linear peptidic epitope (epitope ID 1315238) tested in 1 T cell assay, 10 B cell assays and 8 MHC ligand assays.	IEDB	1315238	61	75	CVDEAGSKSPIQYID	ECO:0000213	PubMed	34003073
P0DTC8	EDFLEYHDVRVVLDF is a linear peptidic epitope (epitope ID 1315736) tested in 5 T cell assays, 6 B cell assays and 4 MHC ligand assays.	IEDB	1315736	106	120	EDFLEYHDVRVVLDF	ECO:0000213	PubMed	34003073
P0DTC8	FHQECSLQSCTQHQP is a linear peptidic epitope (epitope ID 1316445) tested in 1 T cell assay, 6 B cell assays and 4 MHC ligand assays.	IEDB	1316445	16	30	FHQECSLQSCTQHQP	ECO:0000213	PubMed	34003073
P0DTC8	FTINCQEPKLGSLVV is a linear peptidic epitope (epitope ID 1317059) tested in 3 T cell assays, 6 B cell assays and 21 MHC ligand assays.	IEDB	1317059	86	100	FTINCQEPKLGSLVV	ECO:0000213	PubMed	34003073
P0DTC8	GSLVVRCSFYEDFLE is a linear peptidic epitope (epitope ID 1317791) tested in 5 T cell assays, 6 B cell assays and 20 MHC ligand assays.	IEDB	1317791	96	110	GSLVVRCSFYEDFLE	ECO:0000213	PubMed	34003073
P0DTC8	IGNYTVSCLPFTINC is a linear peptidic epitope (epitope ID 1318448) tested in 5 T cell assays, 6 B cell assays and 20 MHC ligand assays.	IEDB	1318448	76	90	IGNYTVSCLPFTINC	ECO:0000213	PubMed	34003073
P0DTC8	IQYIDIGNYTVSCLP is a linear peptidic epitope (epitope ID 1318892) tested in 5 T cell assays, 10 B cell assays and 10 MHC ligand assays.	IEDB	1318892	71	85	IQYIDIGNYTVSCLP	ECO:0000213	PubMed	34003073
P0DTC8	PCPIHFYSKWYIRVG is a linear peptidic epitope (epitope ID 1322874) tested in 10 T cell assays, 6 B cell assays and 18 MHC ligand assays.	IEDB	1322874	36	50	PCPIHFYSKWYIRVG	ECO:0000213	PubMed	34003073
P0DTC8	PLIELCVDEAGSKSP is a linear peptidic epitope (epitope ID 1322962) tested in 1 T cell assay, 6 B cell assays and 4 MHC ligand assays.	IEDB	1322962	56	70	PLIELCVDEAGSKSP	ECO:0000213	PubMed	34003073
P0DTC8	QEPKLGSLVVRCSFY is a linear peptidic epitope (epitope ID 1323204) tested in 2 T cell assays, 10 B cell assays and 4 MHC ligand assays.	IEDB	1323204	91	105	QEPKLGSLVVRCSFY	ECO:0000213	PubMed	34003073
P0DTC8	RCSFYEDFLEYHDVR is a linear peptidic epitope (epitope ID 1323753) tested in 4 T cell assays, 10 B cell assays and 18 MHC ligand assays.	IEDB	1323753	101	115	RCSFYEDFLEYHDVR	ECO:0000213	PubMed	34003073
P0DTC8	SLQSCTQHQPYVVDD is a linear peptidic epitope (epitope ID 1324722) tested in 1 T cell assay, 10 B cell assays and 3 MHC ligand assays.	IEDB	1324722	21	35	SLQSCTQHQPYVVDD	ECO:0000213	PubMed	34003073
P0DTC8	TQHQPYVVDDPCPIH is a linear peptidic epitope (epitope ID 1325852) tested in 2 T cell assays, 6 B cell assays and 20 MHC ligand assays.	IEDB	1325852	26	40	TQHQPYVVDDPCPIH	ECO:0000213	PubMed	34003073
P0DTC8	TTVAAFHQECSLQSC is a linear peptidic epitope (epitope ID 1325992) tested in 2 T cell assays, 10 B cell assays and 5 MHC ligand assays.	IEDB	1325992	11	25	TTVAAFHQECSLQSC	ECO:0000213	PubMed	34003073
P0DTC8	YVVDDPCPIHFYSKW is a linear peptidic epitope (epitope ID 1328882) tested in 3 T cell assays, 10 B cell assays and 19 MHC ligand assays.	IEDB	1328882	31	45	YVVDDPCPIHFYSKW	ECO:0000213	PubMed	34003073
P0DTC8	FLGIITTV is a linear peptidic epitope (epitope ID 1331963) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1331963	6	13	FLGIITTV	ECO:0000213	PubMed	33853928
P0DTC8	KLGSLVVRC is a linear peptidic epitope (epitope ID 1332486) tested in 1 T cell assay.	IEDB	1332486	94	102	KLGSLVVRC	ECO:0000213	PubMed	33853928
P0DTC8	MKFLVFLGIITTVAA is a linear peptidic epitope (epitope ID 1332793) tested in 10 T cell assays, 10 B cell assays and 3 MHC ligand assays.	IEDB	1332793	1	15	MKFLVFLGIITTVAA	ECO:0000213	PubMed	38605956
P0DTC8	MKFLVFLGIITTVAA is a linear peptidic epitope (epitope ID 1332793) tested in 10 T cell assays, 10 B cell assays and 3 MHC ligand assays.	IEDB	1332793	1	15	MKFLVFLGIITTVAA	ECO:0000213	PubMed	33911008
P0DTC8	MKFLVFLGIITTVAA is a linear peptidic epitope (epitope ID 1332793) tested in 10 T cell assays, 10 B cell assays and 3 MHC ligand assays.	IEDB	1332793	1	15	MKFLVFLGIITTVAA	ECO:0000213	PubMed	34003073
P0DTC8	QSCTQHQPY is a linear peptidic epitope (epitope ID 1333223) tested in 1 T cell assay.	IEDB	1333223	23	31	QSCTQHQPY	ECO:0000213	PubMed	33853928
P0DTC8	VDDPCPIHFY is a linear peptidic epitope (epitope ID 1334148) tested in 1 T cell assay.	IEDB	1334148	33	42	VDDPCPIHFY	ECO:0000213	PubMed	33853928
P0DTC8	YVVDDPCPI is a linear peptidic epitope (epitope ID 1334426) tested in 7 T cell assays and 1 MHC ligand assay.	IEDB	1334426	31	39	YVVDDPCPI	ECO:0000213	PubMed	34793243
P0DTC8	YVVDDPCPI is a linear peptidic epitope (epitope ID 1334426) tested in 7 T cell assays and 1 MHC ligand assay.	IEDB	1334426	31	39	YVVDDPCPI	ECO:0000213	PubMed	38605956
P0DTC8	YVVDDPCPI is a linear peptidic epitope (epitope ID 1334426) tested in 7 T cell assays and 1 MHC ligand assay.	IEDB	1334426	31	39	YVVDDPCPI	ECO:0000213	PubMed	33911008
P0DTC8	GSKSPIQYIDIGNYT is a linear peptidic epitope (epitope ID 1392195) tested in 6 B cell assays and 8 MHC ligand assays.	IEDB	1392195	66	80	GSKSPIQYIDIGNYT	ECO:0000213	PubMed	34003073
P0DTC8	VSCLPFTINCQEPKL is a linear peptidic epitope (epitope ID 1392500) tested in 10 B cell assays and 4 MHC ligand assays.	IEDB	1392500	81	95	VSCLPFTINCQEPKL	ECO:0000213	PubMed	34003073
P0DTC8	YHDVRVVLDFI is a linear peptidic epitope (epitope ID 1392528) tested in 1 T cell assay, 10 B cell assays and 1 MHC ligand assay.	IEDB	1392528	111	121	YHDVRVVLDFI	ECO:0000213	PubMed	34003073
P0DTC8	FLEYHDVRV is a linear peptidic epitope (epitope ID 1597011) tested in 2 T cell assays.	IEDB	1597011	108	116	FLEYHDVRV	ECO:0000213	PubMed	34506741
P0DTC8	FLEYHDVRV is a linear peptidic epitope (epitope ID 1597011) tested in 2 T cell assays.	IEDB	1597011	108	116	FLEYHDVRV	ECO:0000213	PubMed	34793243
P0DTC8	FLGIITTVA is a linear peptidic epitope (epitope ID 2134058) tested in 1 T cell assay.	IEDB	2134058	6	14	FLGIITTVA	ECO:0000213	PubMed	34793243
P0DTC8	FYSKWYIRV is a linear peptidic epitope (epitope ID 2134085) tested in 1 T cell assay.	IEDB	2134085	41	49	FYSKWYIRV	ECO:0000213	PubMed	34793243
P0DTC8	TVSCLPFTI is a linear peptidic epitope (epitope ID 2134315) tested in 1 T cell assay.	IEDB	2134315	80	88	TVSCLPFTI	ECO:0000213	PubMed	34793243
P0DTC8	YTVSCLPFT is a linear peptidic epitope (epitope ID 2134377) tested in 1 T cell assay.	IEDB	2134377	79	87	YTVSCLPFT	ECO:0000213	PubMed	34793243
P0DTC9	ALALLLLDR is a linear peptidic epitope (epitope ID 2431) tested in 1 T cell assay and 9 MHC ligand assays.	IEDB	2431	218	226	ALALLLLDR	ECO:0000213	PubMed	34793243
P0DTC9	ALALLLLDRL is a linear peptidic epitope (epitope ID 2432) tested in 5 T cell assays and 5 MHC ligand assays.	IEDB	2432	218	227	ALALLLLDRL	ECO:0000213	PubMed	34630356
P0DTC9	ALNTPKDHI is a linear peptidic epitope (epitope ID 2802) tested in 21 T cell assays, 6 MHC ligand assays and has 3D structure(s) 7kgs.	IEDB	2802	138	146	ALNTPKDHI	ECO:0000213	PubMed	34793243
P0DTC9	ALNTPKDHI is a linear peptidic epitope (epitope ID 2802) tested in 21 T cell assays, 6 MHC ligand assays and has 3D structure(s) 7kgs.	IEDB	2802	138	146	ALNTPKDHI	ECO:0000213	PubMed	37872153
P0DTC9	ALNTPKDHI is a linear peptidic epitope (epitope ID 2802) tested in 21 T cell assays, 6 MHC ligand assays and has 3D structure(s) 7kgs.	IEDB	2802	138	146	ALNTPKDHI	ECO:0000213	PubMed	33521593
P0DTC9	APSASAFFGM is a linear peptidic epitope (epitope ID 3810) tested in 6 T cell assays and 7 MHC ligand assays.	IEDB	3810	308	317	APSASAFFGM	ECO:0000213	PubMed	33853928
P0DTC9	AQFAPSASA is a linear peptidic epitope (epitope ID 3956) tested in 4 T cell assays and 13 MHC ligand assays.	IEDB	3956	305	313	AQFAPSASA	ECO:0000213	PubMed	34968416
P0DTC9	AQFAPSASA is a linear peptidic epitope (epitope ID 3956) tested in 4 T cell assays and 13 MHC ligand assays.	IEDB	3956	305	313	AQFAPSASA	ECO:0000213	PubMed	32913053
P0DTC9	ASAFFGMSR is a linear peptidic epitope (epitope ID 4307) tested in 11 T cell assays and 6 MHC ligand assays.	IEDB	4307	311	319	ASAFFGMSR	ECO:0000213	PubMed	36254196
P0DTC9	ASAFFGMSR is a linear peptidic epitope (epitope ID 4307) tested in 11 T cell assays and 6 MHC ligand assays.	IEDB	4307	311	319	ASAFFGMSR	ECO:0000213	PubMed	33128877
P0DTC9	ATEGALNTPK is a linear peptidic epitope (epitope ID 4936) tested in 19 T cell assays and 7 MHC ligand assays.	IEDB	4936	134	143	ATEGALNTPK	ECO:0000213	PubMed	34968416
P0DTC9	ATEGALNTPK is a linear peptidic epitope (epitope ID 4936) tested in 19 T cell assays and 7 MHC ligand assays.	IEDB	4936	134	143	ATEGALNTPK	ECO:0000213	PubMed	35196796
P0DTC9	ATEGALNTPK is a linear peptidic epitope (epitope ID 4936) tested in 19 T cell assays and 7 MHC ligand assays.	IEDB	4936	134	143	ATEGALNTPK	ECO:0000213	PubMed	35389886
P0DTC9	ATEGALNTPK is a linear peptidic epitope (epitope ID 4936) tested in 19 T cell assays and 7 MHC ligand assays.	IEDB	4936	134	143	ATEGALNTPK	ECO:0000213	PubMed	36254196
P0DTC9	ATEGALNTPK is a linear peptidic epitope (epitope ID 4936) tested in 19 T cell assays and 7 MHC ligand assays.	IEDB	4936	134	143	ATEGALNTPK	ECO:0000213	PubMed	38077128
P0DTC9	ATEGALNTPK is a linear peptidic epitope (epitope ID 4936) tested in 19 T cell assays and 7 MHC ligand assays.	IEDB	4936	134	143	ATEGALNTPK	ECO:0000213	PubMed	38387105
P0DTC9	ATEGALNTPK is a linear peptidic epitope (epitope ID 4936) tested in 19 T cell assays and 7 MHC ligand assays.	IEDB	4936	134	143	ATEGALNTPK	ECO:0000213	PubMed	39496850
P0DTC9	ATEGALNTPK is a linear peptidic epitope (epitope ID 4936) tested in 19 T cell assays and 7 MHC ligand assays.	IEDB	4936	134	143	ATEGALNTPK	ECO:0000213	PubMed	32999467
P0DTC9	ATEGALNTPK is a linear peptidic epitope (epitope ID 4936) tested in 19 T cell assays and 7 MHC ligand assays.	IEDB	4936	134	143	ATEGALNTPK	ECO:0000213	PubMed	33128877
P0DTC9	FPRGQGVPI is a linear peptidic epitope (epitope ID 17385) tested in 22 T cell assays, 2 B cell assays and 29 MHC ligand assays.	IEDB	17385	66	74	FPRGQGVPI	ECO:0000213	PubMed	33945786
P0DTC9	FPRGQGVPI is a linear peptidic epitope (epitope ID 17385) tested in 22 T cell assays, 2 B cell assays and 29 MHC ligand assays.	IEDB	17385	66	74	FPRGQGVPI	ECO:0000213	PubMed	35196796
P0DTC9	FPRGQGVPI is a linear peptidic epitope (epitope ID 17385) tested in 22 T cell assays, 2 B cell assays and 29 MHC ligand assays.	IEDB	17385	66	74	FPRGQGVPI	ECO:0000213	PubMed	35328398
P0DTC9	FPRGQGVPI is a linear peptidic epitope (epitope ID 17385) tested in 22 T cell assays, 2 B cell assays and 29 MHC ligand assays.	IEDB	17385	66	74	FPRGQGVPI	ECO:0000213	PubMed	36254196
P0DTC9	FPRGQGVPI is a linear peptidic epitope (epitope ID 17385) tested in 22 T cell assays, 2 B cell assays and 29 MHC ligand assays.	IEDB	17385	66	74	FPRGQGVPI	ECO:0000213	PubMed	38781962
P0DTC9	FPRGQGVPI is a linear peptidic epitope (epitope ID 17385) tested in 22 T cell assays, 2 B cell assays and 29 MHC ligand assays.	IEDB	17385	66	74	FPRGQGVPI	ECO:0000213	PubMed	32999467
P0DTC9	FPRGQGVPI is a linear peptidic epitope (epitope ID 17385) tested in 22 T cell assays, 2 B cell assays and 29 MHC ligand assays.	IEDB	17385	66	74	FPRGQGVPI	ECO:0000213	PubMed	33184509
P0DTC9	FPRGQGVPI is a linear peptidic epitope (epitope ID 17385) tested in 22 T cell assays, 2 B cell assays and 29 MHC ligand assays.	IEDB	17385	66	74	FPRGQGVPI	ECO:0000213	PubMed	33853928
P0DTC9	GMSRIGMEV is a linear peptidic epitope (epitope ID 21347) tested in 41 T cell assays, 14 MHC ligand assays and has 3D structure(s) 7kgp.	IEDB	21347	316	324	GMSRIGMEV	ECO:0000213	PubMed	34210785
P0DTC9	GMSRIGMEV is a linear peptidic epitope (epitope ID 21347) tested in 41 T cell assays, 14 MHC ligand assays and has 3D structure(s) 7kgp.	IEDB	21347	316	324	GMSRIGMEV	ECO:0000213	PubMed	34222571
P0DTC9	GMSRIGMEV is a linear peptidic epitope (epitope ID 21347) tested in 41 T cell assays, 14 MHC ligand assays and has 3D structure(s) 7kgp.	IEDB	21347	316	324	GMSRIGMEV	ECO:0000213	PubMed	34728796
P0DTC9	GMSRIGMEV is a linear peptidic epitope (epitope ID 21347) tested in 41 T cell assays, 14 MHC ligand assays and has 3D structure(s) 7kgp.	IEDB	21347	316	324	GMSRIGMEV	ECO:0000213	PubMed	35937077
P0DTC9	GMSRIGMEV is a linear peptidic epitope (epitope ID 21347) tested in 41 T cell assays, 14 MHC ligand assays and has 3D structure(s) 7kgp.	IEDB	21347	316	324	GMSRIGMEV	ECO:0000213	PubMed	37872153
P0DTC9	GMSRIGMEV is a linear peptidic epitope (epitope ID 21347) tested in 41 T cell assays, 14 MHC ligand assays and has 3D structure(s) 7kgp.	IEDB	21347	316	324	GMSRIGMEV	ECO:0000213	PubMed	38214610
P0DTC9	GMSRIGMEV is a linear peptidic epitope (epitope ID 21347) tested in 41 T cell assays, 14 MHC ligand assays and has 3D structure(s) 7kgp.	IEDB	21347	316	324	GMSRIGMEV	ECO:0000213	PubMed	38608022
P0DTC9	GMSRIGMEV is a linear peptidic epitope (epitope ID 21347) tested in 41 T cell assays, 14 MHC ligand assays and has 3D structure(s) 7kgp.	IEDB	21347	316	324	GMSRIGMEV	ECO:0000213	PubMed	38866784
P0DTC9	GMSRIGMEV is a linear peptidic epitope (epitope ID 21347) tested in 41 T cell assays, 14 MHC ligand assays and has 3D structure(s) 7kgp.	IEDB	21347	316	324	GMSRIGMEV	ECO:0000213	PubMed	33184509
P0DTC9	GMSRIGMEV is a linear peptidic epitope (epitope ID 21347) tested in 41 T cell assays, 14 MHC ligand assays and has 3D structure(s) 7kgp.	IEDB	21347	316	324	GMSRIGMEV	ECO:0000213	PubMed	32913053
P0DTC9	GMSRIGMEV is a linear peptidic epitope (epitope ID 21347) tested in 41 T cell assays, 14 MHC ligand assays and has 3D structure(s) 7kgp.	IEDB	21347	316	324	GMSRIGMEV	ECO:0000213	PubMed	33521593
P0DTC9	GMSRIGMEV is a linear peptidic epitope (epitope ID 21347) tested in 41 T cell assays, 14 MHC ligand assays and has 3D structure(s) 7kgp.	IEDB	21347	316	324	GMSRIGMEV	ECO:0000213	PubMed	33853928
P0DTC9	ILLNKHIDA is a linear peptidic epitope (epitope ID 27182) tested in 24 T cell assays, 6 MHC ligand assays and has 3D structure(s) 7kgo.	IEDB	27182	351	359	ILLNKHIDA	ECO:0000213	PubMed	37872153
P0DTC9	ILLNKHIDA is a linear peptidic epitope (epitope ID 27182) tested in 24 T cell assays, 6 MHC ligand assays and has 3D structure(s) 7kgo.	IEDB	27182	351	359	ILLNKHIDA	ECO:0000213	PubMed	33521593
P0DTC9	ILLNKHIDAYKTFPP is a linear peptidic epitope (epitope ID 27183) tested in 17 T cell assays, 8 B cell assays and 20 MHC ligand assays.	IEDB	27183	351	365	ILLNKHIDAYKTFPP	ECO:0000213	PubMed	34529740
P0DTC9	KTFPPTEPK is a linear peptidic epitope (epitope ID 33667) tested in 78 T cell assays, 40 MHC ligand assays and has 3D structure(s) 1x7q.	IEDB	33667	361	369	KTFPPTEPK	ECO:0000213	PubMed	34222571
P0DTC9	KTFPPTEPK is a linear peptidic epitope (epitope ID 33667) tested in 78 T cell assays, 40 MHC ligand assays and has 3D structure(s) 1x7q.	IEDB	33667	361	369	KTFPPTEPK	ECO:0000213	PubMed	34609506
P0DTC9	KTFPPTEPK is a linear peptidic epitope (epitope ID 33667) tested in 78 T cell assays, 40 MHC ligand assays and has 3D structure(s) 1x7q.	IEDB	33667	361	369	KTFPPTEPK	ECO:0000213	PubMed	35389886
P0DTC9	KTFPPTEPK is a linear peptidic epitope (epitope ID 33667) tested in 78 T cell assays, 40 MHC ligand assays and has 3D structure(s) 1x7q.	IEDB	33667	361	369	KTFPPTEPK	ECO:0000213	PubMed	35484232
P0DTC9	KTFPPTEPK is a linear peptidic epitope (epitope ID 33667) tested in 78 T cell assays, 40 MHC ligand assays and has 3D structure(s) 1x7q.	IEDB	33667	361	369	KTFPPTEPK	ECO:0000213	PubMed	35750048
P0DTC9	KTFPPTEPK is a linear peptidic epitope (epitope ID 33667) tested in 78 T cell assays, 40 MHC ligand assays and has 3D structure(s) 1x7q.	IEDB	33667	361	369	KTFPPTEPK	ECO:0000213	PubMed	36254196
P0DTC9	KTFPPTEPK is a linear peptidic epitope (epitope ID 33667) tested in 78 T cell assays, 40 MHC ligand assays and has 3D structure(s) 1x7q.	IEDB	33667	361	369	KTFPPTEPK	ECO:0000213	PubMed	36494499
P0DTC9	KTFPPTEPK is a linear peptidic epitope (epitope ID 33667) tested in 78 T cell assays, 40 MHC ligand assays and has 3D structure(s) 1x7q.	IEDB	33667	361	369	KTFPPTEPK	ECO:0000213	PubMed	38077128
P0DTC9	KTFPPTEPK is a linear peptidic epitope (epitope ID 33667) tested in 78 T cell assays, 40 MHC ligand assays and has 3D structure(s) 1x7q.	IEDB	33667	361	369	KTFPPTEPK	ECO:0000213	PubMed	38387105
P0DTC9	KTFPPTEPK is a linear peptidic epitope (epitope ID 33667) tested in 78 T cell assays, 40 MHC ligand assays and has 3D structure(s) 1x7q.	IEDB	33667	361	369	KTFPPTEPK	ECO:0000213	PubMed	38866784
P0DTC9	KTFPPTEPK is a linear peptidic epitope (epitope ID 33667) tested in 78 T cell assays, 40 MHC ligand assays and has 3D structure(s) 1x7q.	IEDB	33667	361	369	KTFPPTEPK	ECO:0000213	PubMed	38932408
P0DTC9	KTFPPTEPK is a linear peptidic epitope (epitope ID 33667) tested in 78 T cell assays, 40 MHC ligand assays and has 3D structure(s) 1x7q.	IEDB	33667	361	369	KTFPPTEPK	ECO:0000213	PubMed	39284068
P0DTC9	KTFPPTEPK is a linear peptidic epitope (epitope ID 33667) tested in 78 T cell assays, 40 MHC ligand assays and has 3D structure(s) 1x7q.	IEDB	33667	361	369	KTFPPTEPK	ECO:0000213	PubMed	39496850
P0DTC9	KTFPPTEPK is a linear peptidic epitope (epitope ID 33667) tested in 78 T cell assays, 40 MHC ligand assays and has 3D structure(s) 1x7q.	IEDB	33667	361	369	KTFPPTEPK	ECO:0000213	PubMed	32887977
P0DTC9	KTFPPTEPK is a linear peptidic epitope (epitope ID 33667) tested in 78 T cell assays, 40 MHC ligand assays and has 3D structure(s) 1x7q.	IEDB	33667	361	369	KTFPPTEPK	ECO:0000213	PubMed	33427749
P0DTC9	KTFPPTEPK is a linear peptidic epitope (epitope ID 33667) tested in 78 T cell assays, 40 MHC ligand assays and has 3D structure(s) 1x7q.	IEDB	33667	361	369	KTFPPTEPK	ECO:0000213	PubMed	33853928
P0DTC9	KTFPPTEPKK is a linear peptidic epitope (epitope ID 33668) tested in 15 T cell assays and 6 MHC ligand assays.	IEDB	33668	361	370	KTFPPTEPKK	ECO:0000213	PubMed	34968416
P0DTC9	KTFPPTEPKK is a linear peptidic epitope (epitope ID 33668) tested in 15 T cell assays and 6 MHC ligand assays.	IEDB	33668	361	370	KTFPPTEPKK	ECO:0000213	PubMed	35389886
P0DTC9	KTFPPTEPKK is a linear peptidic epitope (epitope ID 33668) tested in 15 T cell assays and 6 MHC ligand assays.	IEDB	33668	361	370	KTFPPTEPKK	ECO:0000213	PubMed	35484232
P0DTC9	KTFPPTEPKK is a linear peptidic epitope (epitope ID 33668) tested in 15 T cell assays and 6 MHC ligand assays.	IEDB	33668	361	370	KTFPPTEPKK	ECO:0000213	PubMed	32999467
P0DTC9	KTFPPTEPKKDKKKK is a linear peptidic epitope (epitope ID 33669) tested in 5 T cell assays, 21 B cell assays and 5 MHC ligand assays.	IEDB	33669	361	375	KTFPPTEPKKDKKKK	ECO:0000213	PubMed	34529740
P0DTC9	KTFPPTEPKKDKKKK is a linear peptidic epitope (epitope ID 33669) tested in 5 T cell assays, 21 B cell assays and 5 MHC ligand assays.	IEDB	33669	361	375	KTFPPTEPKKDKKKK	ECO:0000213	PubMed	36646780
P0DTC9	LALLLLDRL is a linear peptidic epitope (epitope ID 34851) tested in 41 T cell assays, 5 B cell assays and 10 MHC ligand assays.	IEDB	34851	219	227	LALLLLDRL	ECO:0000213	PubMed	34222571
P0DTC9	LALLLLDRL is a linear peptidic epitope (epitope ID 34851) tested in 41 T cell assays, 5 B cell assays and 10 MHC ligand assays.	IEDB	34851	219	227	LALLLLDRL	ECO:0000213	PubMed	34728796
P0DTC9	LALLLLDRL is a linear peptidic epitope (epitope ID 34851) tested in 41 T cell assays, 5 B cell assays and 10 MHC ligand assays.	IEDB	34851	219	227	LALLLLDRL	ECO:0000213	PubMed	35104433
P0DTC9	LALLLLDRL is a linear peptidic epitope (epitope ID 34851) tested in 41 T cell assays, 5 B cell assays and 10 MHC ligand assays.	IEDB	34851	219	227	LALLLLDRL	ECO:0000213	PubMed	37036004
P0DTC9	LALLLLDRL is a linear peptidic epitope (epitope ID 34851) tested in 41 T cell assays, 5 B cell assays and 10 MHC ligand assays.	IEDB	34851	219	227	LALLLLDRL	ECO:0000213	PubMed	37872153
P0DTC9	LALLLLDRL is a linear peptidic epitope (epitope ID 34851) tested in 41 T cell assays, 5 B cell assays and 10 MHC ligand assays.	IEDB	34851	219	227	LALLLLDRL	ECO:0000213	PubMed	38866784
P0DTC9	LALLLLDRL is a linear peptidic epitope (epitope ID 34851) tested in 41 T cell assays, 5 B cell assays and 10 MHC ligand assays.	IEDB	34851	219	227	LALLLLDRL	ECO:0000213	PubMed	33184509
P0DTC9	LALLLLDRL is a linear peptidic epitope (epitope ID 34851) tested in 41 T cell assays, 5 B cell assays and 10 MHC ligand assays.	IEDB	34851	219	227	LALLLLDRL	ECO:0000213	PubMed	33521593
P0DTC9	LALLLLDRL is a linear peptidic epitope (epitope ID 34851) tested in 41 T cell assays, 5 B cell assays and 10 MHC ligand assays.	IEDB	34851	219	227	LALLLLDRL	ECO:0000213	PubMed	39591116
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	32979941
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	34210785
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	34222571
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	34627082
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	34728796
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	34793243
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	34814158
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	34968416
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	35104433
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	35389886
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	35484232
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	35937077
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	36134660
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	36254196
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	36494499
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	37872153
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	38214610
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	38539271
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	38608022
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	38781962
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	33128877
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	33184509
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	34070152
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	32791978
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	33427749
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	33521593
P0DTC9	LLLDRLNQL is a linear peptidic epitope (epitope ID 37473) tested in 92 T cell assays, 17 MHC ligand assays and has 3D structure(s) 8dnt and 7kgq.	IEDB	37473	222	230	LLLDRLNQL	ECO:0000213	PubMed	33853928
P0DTC9	LLLLDRLNQL is a linear peptidic epitope (epitope ID 37515) tested in 20 T cell assays and 2 MHC ligand assays.	IEDB	37515	221	230	LLLLDRLNQL	ECO:0000213	PubMed	34814158
P0DTC9	LLLLDRLNQL is a linear peptidic epitope (epitope ID 37515) tested in 20 T cell assays and 2 MHC ligand assays.	IEDB	37515	221	230	LLLLDRLNQL	ECO:0000213	PubMed	35389886
P0DTC9	LLLLDRLNQL is a linear peptidic epitope (epitope ID 37515) tested in 20 T cell assays and 2 MHC ligand assays.	IEDB	37515	221	230	LLLLDRLNQL	ECO:0000213	PubMed	38932408
P0DTC9	LLLLDRLNQL is a linear peptidic epitope (epitope ID 37515) tested in 20 T cell assays and 2 MHC ligand assays.	IEDB	37515	221	230	LLLLDRLNQL	ECO:0000213	PubMed	32999467
P0DTC9	LLLLDRLNQL is a linear peptidic epitope (epitope ID 37515) tested in 20 T cell assays and 2 MHC ligand assays.	IEDB	37515	221	230	LLLLDRLNQL	ECO:0000213	PubMed	33853928
P0DTC9	LLNKHIDAYKTFPPTEPK is a linear peptidic epitope (epitope ID 37611) tested in 13 T cell assays.	IEDB	37611	352	369	LLNKHIDAYKTFPPTEPK	ECO:0000213	PubMed	32887977
P0DTC9	LQLPQGTTL is a linear peptidic epitope (epitope ID 38881) tested in 19 T cell assays, 10 MHC ligand assays and has 3D structure(s) 7kgr.	IEDB	38881	159	167	LQLPQGTTL	ECO:0000213	PubMed	37872153
P0DTC9	LQLPQGTTL is a linear peptidic epitope (epitope ID 38881) tested in 19 T cell assays, 10 MHC ligand assays and has 3D structure(s) 7kgr.	IEDB	38881	159	167	LQLPQGTTL	ECO:0000213	PubMed	33521593
P0DTC9	LSPRWYFYY is a linear peptidic epitope (epitope ID 39576) tested in 7 T cell assays, 1 B cell assay and 12 MHC ligand assays.	IEDB	39576	104	112	LSPRWYFYY	ECO:0000213	PubMed	34793243
P0DTC9	LSPRWYFYY is a linear peptidic epitope (epitope ID 39576) tested in 7 T cell assays, 1 B cell assay and 12 MHC ligand assays.	IEDB	39576	104	112	LSPRWYFYY	ECO:0000213	PubMed	34968416
P0DTC9	LSPRWYFYY is a linear peptidic epitope (epitope ID 39576) tested in 7 T cell assays, 1 B cell assay and 12 MHC ligand assays.	IEDB	39576	104	112	LSPRWYFYY	ECO:0000213	PubMed	36603583
P0DTC9	LSPRWYFYY is a linear peptidic epitope (epitope ID 39576) tested in 7 T cell assays, 1 B cell assay and 12 MHC ligand assays.	IEDB	39576	104	112	LSPRWYFYY	ECO:0000213	PubMed	39591116
P0DTC9	MEVTPSGTW is a linear peptidic epitope (epitope ID 41460) tested in 15 T cell assays and 9 MHC ligand assays.	IEDB	41460	322	330	MEVTPSGTW	ECO:0000213	PubMed	35389886
P0DTC9	MEVTPSGTW is a linear peptidic epitope (epitope ID 41460) tested in 15 T cell assays and 9 MHC ligand assays.	IEDB	41460	322	330	MEVTPSGTW	ECO:0000213	PubMed	39284068
P0DTC9	MEVTPSGTW is a linear peptidic epitope (epitope ID 41460) tested in 15 T cell assays and 9 MHC ligand assays.	IEDB	41460	322	330	MEVTPSGTW	ECO:0000213	PubMed	33184509
P0DTC9	MSRIGMEVTPSGTWL is a linear peptidic epitope (epitope ID 42648) tested in 10 T cell assays, 8 B cell assays and 8 MHC ligand assays.	IEDB	42648	317	331	MSRIGMEVTPSGTWL	ECO:0000213	PubMed	33104167
P0DTC9	QLPQGTTLPK is a linear peptidic epitope (epitope ID 51482) tested in 2 T cell assays and 6 MHC ligand assays.	IEDB	51482	160	169	QLPQGTTLPK	ECO:0000213	PubMed	36254196
P0DTC9	QQQGQTVTK is a linear peptidic epitope (epitope ID 52114) tested in 5 T cell assays and 6 MHC ligand assays.	IEDB	52114	240	248	QQQGQTVTK	ECO:0000213	PubMed	34728796
P0DTC9	QQQGQTVTK is a linear peptidic epitope (epitope ID 52114) tested in 5 T cell assays and 6 MHC ligand assays.	IEDB	52114	240	248	QQQGQTVTK	ECO:0000213	PubMed	35389886
P0DTC9	QQQQGQTVTK is a linear peptidic epitope (epitope ID 52129) tested in 4 T cell assays and 5 MHC ligand assays.	IEDB	52129	239	248	QQQQGQTVTK	ECO:0000213	PubMed	39496850
P0DTC9	SAFFGMSRIG is a linear peptidic epitope (epitope ID 56774) tested in 1 T cell assay and 6 MHC ligand assays.	IEDB	56774	312	321	SAFFGMSRIG	ECO:0000213	PubMed	34630356
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	32979941
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	33945786
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	33995351
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	34793243
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	34853448
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	34968416
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	35157735
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	35196796
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	35389886
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	35484232
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	35750048
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	36254196
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	37036004
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	37275518
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	38077128
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	38387105
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	38932408
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	39284068
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	39418521
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	33128877
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	33184509
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	33427749
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	33853928
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	35699447
P0DTC9	SPRWYFYYL is a linear peptidic epitope (epitope ID 60242) tested in 127 T cell assays, 1 B cell assay, 9 MHC ligand assays and has 3D structure(s) 7lgd.	IEDB	60242	105	113	SPRWYFYYL	ECO:0000213	PubMed	39591116
P0DTC9	SPRWYFYYLGTGPEA is a linear peptidic epitope (epitope ID 60243) tested in 12 T cell assays, 5 B cell assays and 5 MHC ligand assays.	IEDB	60243	105	119	SPRWYFYYLGTGPEA	ECO:0000213	PubMed	34061349
P0DTC9	SPRWYFYYLGTGPEA is a linear peptidic epitope (epitope ID 60243) tested in 12 T cell assays, 5 B cell assays and 5 MHC ligand assays.	IEDB	60243	105	119	SPRWYFYYLGTGPEA	ECO:0000213	PubMed	35699447
P0DTC9	TPSGTWLTY is a linear peptidic epitope (epitope ID 65763) tested in 19 T cell assays and 29 MHC ligand assays.	IEDB	65763	325	333	TPSGTWLTY	ECO:0000213	PubMed	35157735
P0DTC9	TPSGTWLTY is a linear peptidic epitope (epitope ID 65763) tested in 19 T cell assays and 29 MHC ligand assays.	IEDB	65763	325	333	TPSGTWLTY	ECO:0000213	PubMed	36151076
P0DTC9	TPSGTWLTY is a linear peptidic epitope (epitope ID 65763) tested in 19 T cell assays and 29 MHC ligand assays.	IEDB	65763	325	333	TPSGTWLTY	ECO:0000213	PubMed	36254196
P0DTC9	TPSGTWLTY is a linear peptidic epitope (epitope ID 65763) tested in 19 T cell assays and 29 MHC ligand assays.	IEDB	65763	325	333	TPSGTWLTY	ECO:0000213	PubMed	38932408
P0DTC9	TTLPKGFYAEGSRGG is a linear peptidic epitope (epitope ID 66707) tested in 4 T cell assays, 5 B cell assays and 5 MHC ligand assays.	IEDB	66707	165	179	TTLPKGFYAEGSRGG	ECO:0000213	PubMed	36646780
P0DTC9	VILLNKHIDAYKTFP is a linear peptidic epitope (epitope ID 69035) tested in 13 T cell assays, 7 B cell assays and 5 MHC ligand assays.	IEDB	69035	350	364	VILLNKHIDAYKTFP	ECO:0000213	PubMed	34630356
P0DTC9	VLQLPQGTTL is a linear peptidic epitope (epitope ID 69720) tested in 5 T cell assays and 3 MHC ligand assays.	IEDB	69720	158	167	VLQLPQGTTL	ECO:0000213	PubMed	33853928
P0DTC9	VTPSGTWLTY is a linear peptidic epitope (epitope ID 71461) tested in 5 T cell assays and 8 MHC ligand assays.	IEDB	71461	324	333	VTPSGTWLTY	ECO:0000213	PubMed	38105139
P0DTC9	ILLNKHID is a linear peptidic epitope (epitope ID 125100) tested in 5 T cell assays and 2 MHC ligand assays.	IEDB	125100	351	358	ILLNKHID	ECO:0000213	PubMed	33521593
P0DTC9	WYFYYLGTGP is a linear peptidic epitope (epitope ID 151502) tested in 1 T cell assay and 1 B cell assay.	IEDB	151502	108	117	WYFYYLGTGP	ECO:0000213	PubMed	33995351
P0DTC9	MEVTPSGTWL is a linear peptidic epitope (epitope ID 190494) tested in 52 T cell assays and 4 MHC ligand assays.	IEDB	190494	322	331	MEVTPSGTWL	ECO:0000213	PubMed	33664060
P0DTC9	MEVTPSGTWL is a linear peptidic epitope (epitope ID 190494) tested in 52 T cell assays and 4 MHC ligand assays.	IEDB	190494	322	331	MEVTPSGTWL	ECO:0000213	PubMed	34968416
P0DTC9	MEVTPSGTWL is a linear peptidic epitope (epitope ID 190494) tested in 52 T cell assays and 4 MHC ligand assays.	IEDB	190494	322	331	MEVTPSGTWL	ECO:0000213	PubMed	35157735
P0DTC9	MEVTPSGTWL is a linear peptidic epitope (epitope ID 190494) tested in 52 T cell assays and 4 MHC ligand assays.	IEDB	190494	322	331	MEVTPSGTWL	ECO:0000213	PubMed	35196796
P0DTC9	MEVTPSGTWL is a linear peptidic epitope (epitope ID 190494) tested in 52 T cell assays and 4 MHC ligand assays.	IEDB	190494	322	331	MEVTPSGTWL	ECO:0000213	PubMed	35389886
P0DTC9	MEVTPSGTWL is a linear peptidic epitope (epitope ID 190494) tested in 52 T cell assays and 4 MHC ligand assays.	IEDB	190494	322	331	MEVTPSGTWL	ECO:0000213	PubMed	35484232
P0DTC9	MEVTPSGTWL is a linear peptidic epitope (epitope ID 190494) tested in 52 T cell assays and 4 MHC ligand assays.	IEDB	190494	322	331	MEVTPSGTWL	ECO:0000213	PubMed	35750048
P0DTC9	MEVTPSGTWL is a linear peptidic epitope (epitope ID 190494) tested in 52 T cell assays and 4 MHC ligand assays.	IEDB	190494	322	331	MEVTPSGTWL	ECO:0000213	PubMed	36254196
P0DTC9	MEVTPSGTWL is a linear peptidic epitope (epitope ID 190494) tested in 52 T cell assays and 4 MHC ligand assays.	IEDB	190494	322	331	MEVTPSGTWL	ECO:0000213	PubMed	36494499
P0DTC9	MEVTPSGTWL is a linear peptidic epitope (epitope ID 190494) tested in 52 T cell assays and 4 MHC ligand assays.	IEDB	190494	322	331	MEVTPSGTWL	ECO:0000213	PubMed	38105139
P0DTC9	MEVTPSGTWL is a linear peptidic epitope (epitope ID 190494) tested in 52 T cell assays and 4 MHC ligand assays.	IEDB	190494	322	331	MEVTPSGTWL	ECO:0000213	PubMed	38608022
P0DTC9	MEVTPSGTWL is a linear peptidic epitope (epitope ID 190494) tested in 52 T cell assays and 4 MHC ligand assays.	IEDB	190494	322	331	MEVTPSGTWL	ECO:0000213	PubMed	38866784
P0DTC9	MEVTPSGTWL is a linear peptidic epitope (epitope ID 190494) tested in 52 T cell assays and 4 MHC ligand assays.	IEDB	190494	322	331	MEVTPSGTWL	ECO:0000213	PubMed	32887977
P0DTC9	MEVTPSGTWL is a linear peptidic epitope (epitope ID 190494) tested in 52 T cell assays and 4 MHC ligand assays.	IEDB	190494	322	331	MEVTPSGTWL	ECO:0000213	PubMed	32999467
P0DTC9	MEVTPSGTWL is a linear peptidic epitope (epitope ID 190494) tested in 52 T cell assays and 4 MHC ligand assays.	IEDB	190494	322	331	MEVTPSGTWL	ECO:0000213	PubMed	33184509
P0DTC9	MEVTPSGTWL is a linear peptidic epitope (epitope ID 190494) tested in 52 T cell assays and 4 MHC ligand assays.	IEDB	190494	322	331	MEVTPSGTWL	ECO:0000213	PubMed	34389625
P0DTC9	FAPSASAFF is a linear peptidic epitope (epitope ID 923297) tested in 4 T cell assays and 5 MHC ligand assays.	IEDB	923297	307	315	FAPSASAFF	ECO:0000213	PubMed	35104433
P0DTC9	FAPSASAFF is a linear peptidic epitope (epitope ID 923297) tested in 4 T cell assays and 5 MHC ligand assays.	IEDB	923297	307	315	FAPSASAFF	ECO:0000213	PubMed	38781962
P0DTC9	FAPSASAFF is a linear peptidic epitope (epitope ID 923297) tested in 4 T cell assays and 5 MHC ligand assays.	IEDB	923297	307	315	FAPSASAFF	ECO:0000213	PubMed	34249101
P0DTC9	KHWPQIAQF is a linear peptidic epitope (epitope ID 923444) tested in 4 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	923444	299	307	KHWPQIAQF	ECO:0000213	PubMed	38781962
P0DTC9	KHWPQIAQF is a linear peptidic epitope (epitope ID 923444) tested in 4 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	923444	299	307	KHWPQIAQF	ECO:0000213	PubMed	39591116
P0DTC9	FSKQLQQSM is a linear peptidic epitope (epitope ID 1074895) tested in 6 T cell assays.	IEDB	1074895	403	411	FSKQLQQSM	ECO:0000213	PubMed	34249101
P0DTC9	GMSRIGMEVTPSGTW is a linear peptidic epitope (epitope ID 1074911) tested in 8 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1074911	316	330	GMSRIGMEVTPSGTW	ECO:0000213	PubMed	34529740
P0DTC9	GMSRIGMEVTPSGTW is a linear peptidic epitope (epitope ID 1074911) tested in 8 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1074911	316	330	GMSRIGMEVTPSGTW	ECO:0000213	PubMed	38781962
P0DTC9	KAYNVTQAF is a linear peptidic epitope (epitope ID 1074947) tested in 16 T cell assays and 4 MHC ligand assays.	IEDB	1074947	266	274	KAYNVTQAF	ECO:0000213	PubMed	35389886
P0DTC9	KAYNVTQAF is a linear peptidic epitope (epitope ID 1074947) tested in 16 T cell assays and 4 MHC ligand assays.	IEDB	1074947	266	274	KAYNVTQAF	ECO:0000213	PubMed	38866784
P0DTC9	KAYNVTQAF is a linear peptidic epitope (epitope ID 1074947) tested in 16 T cell assays and 4 MHC ligand assays.	IEDB	1074947	266	274	KAYNVTQAF	ECO:0000213	PubMed	34249101
P0DTC9	LPAADLDDF is a linear peptidic epitope (epitope ID 1074978) tested in 5 T cell assays.	IEDB	1074978	395	403	LPAADLDDF	ECO:0000213	PubMed	35389886
P0DTC9	LSPRWYFYYL is a linear peptidic epitope (epitope ID 1074988) tested in 41 T cell assays and 1 MHC ligand assay.	IEDB	1074988	104	113	LSPRWYFYYL	ECO:0000213	PubMed	34728796
P0DTC9	LPNNTASWF is a linear peptidic epitope (epitope ID 1087377) tested in 12 T cell assays and 1 MHC ligand assay.	IEDB	1087377	45	53	LPNNTASWF	ECO:0000213	PubMed	34793243
P0DTC9	LPNNTASWF is a linear peptidic epitope (epitope ID 1087377) tested in 12 T cell assays and 1 MHC ligand assay.	IEDB	1087377	45	53	LPNNTASWF	ECO:0000213	PubMed	38781962
P0DTC9	DLDDFSKQL is a linear peptidic epitope (epitope ID 1125053) tested in 3 T cell assays.	IEDB	1125053	399	407	DLDDFSKQL	ECO:0000213	PubMed	38781962
P0DTC9	KLDDKDPNF is a linear peptidic epitope (epitope ID 1125078) tested in 10 T cell assays and 2 MHC ligand assays.	IEDB	1125078	338	346	KLDDKDPNF	ECO:0000213	PubMed	34222571
P0DTC9	KLDDKDPNF is a linear peptidic epitope (epitope ID 1125078) tested in 10 T cell assays and 2 MHC ligand assays.	IEDB	1125078	338	346	KLDDKDPNF	ECO:0000213	PubMed	34793243
P0DTC9	KLDDKDPNF is a linear peptidic epitope (epitope ID 1125078) tested in 10 T cell assays and 2 MHC ligand assays.	IEDB	1125078	338	346	KLDDKDPNF	ECO:0000213	PubMed	38608022
P0DTC9	KLDDKDPNF is a linear peptidic epitope (epitope ID 1125078) tested in 10 T cell assays and 2 MHC ligand assays.	IEDB	1125078	338	346	KLDDKDPNF	ECO:0000213	PubMed	38781962
P0DTC9	KLDDKDPNF is a linear peptidic epitope (epitope ID 1125078) tested in 10 T cell assays and 2 MHC ligand assays.	IEDB	1125078	338	346	KLDDKDPNF	ECO:0000213	PubMed	32791978
P0DTC9	YLGTGPEAGL is a linear peptidic epitope (epitope ID 1125146) tested in 7 T cell assays and 2 MHC ligand assays.	IEDB	1125146	112	121	YLGTGPEAGL	ECO:0000213	PubMed	34627082
P0DTC9	YLGTGPEAGL is a linear peptidic epitope (epitope ID 1125146) tested in 7 T cell assays and 2 MHC ligand assays.	IEDB	1125146	112	121	YLGTGPEAGL	ECO:0000213	PubMed	38608022
P0DTC9	YLGTGPEAGL is a linear peptidic epitope (epitope ID 1125146) tested in 7 T cell assays and 2 MHC ligand assays.	IEDB	1125146	112	121	YLGTGPEAGL	ECO:0000213	PubMed	32791978
P0DTC9	DDQIGYYRRATRRIR is a linear peptidic epitope (epitope ID 1131160) tested in 39 T cell assays, 10 B cell assays and 42 MHC ligand assays.	IEDB	1131160	81	95	DDQIGYYRRATRRIR	ECO:0000213	PubMed	34529740
P0DTC9	DDQIGYYRRATRRIR is a linear peptidic epitope (epitope ID 1131160) tested in 39 T cell assays, 10 B cell assays and 42 MHC ligand assays.	IEDB	1131160	81	95	DDQIGYYRRATRRIR	ECO:0000213	PubMed	34061349
P0DTC9	KAYNVTQAFGRRGPE is a linear peptidic epitope (epitope ID 1150853) tested in 23 T cell assays, 4 B cell assays and 29 MHC ligand assays.	IEDB	1150853	266	280	KAYNVTQAFGRRGPE	ECO:0000213	PubMed	34529740
P0DTC9	KAYNVTQAFGRRGPE is a linear peptidic epitope (epitope ID 1150853) tested in 23 T cell assays, 4 B cell assays and 29 MHC ligand assays.	IEDB	1150853	266	280	KAYNVTQAFGRRGPE	ECO:0000213	PubMed	38117652
P0DTC9	LIRQGTDYKHWPQIA is a linear peptidic epitope (epitope ID 1156855) tested in 4 T cell assays, 8 B cell assays and 6 MHC ligand assays.	IEDB	1156855	291	305	LIRQGTDYKHWPQIA	ECO:0000213	PubMed	34529740
P0DTC9	MKDLSPRWYFYYLGT is a linear peptidic epitope (epitope ID 1160253) tested in 9 T cell assays, 10 B cell assays and 5 MHC ligand assays.	IEDB	1160253	101	115	MKDLSPRWYFYYLGT	ECO:0000213	PubMed	34529740
P0DTC9	MKDLSPRWYFYYLGT is a linear peptidic epitope (epitope ID 1160253) tested in 9 T cell assays, 10 B cell assays and 5 MHC ligand assays.	IEDB	1160253	101	115	MKDLSPRWYFYYLGT	ECO:0000213	PubMed	38781962
P0DTC9	MKDLSPRWYFYYLGT is a linear peptidic epitope (epitope ID 1160253) tested in 9 T cell assays, 10 B cell assays and 5 MHC ligand assays.	IEDB	1160253	101	115	MKDLSPRWYFYYLGT	ECO:0000213	PubMed	35699447
P0DTC9	PRWYFYYLGTGPEAG is a linear peptidic epitope (epitope ID 1163444) tested in 30 T cell assays, 10 B cell assays and 27 MHC ligand assays.	IEDB	1163444	106	120	PRWYFYYLGTGPEAG	ECO:0000213	PubMed	34529740
P0DTC9	PRWYFYYLGTGPEAG is a linear peptidic epitope (epitope ID 1163444) tested in 30 T cell assays, 10 B cell assays and 27 MHC ligand assays.	IEDB	1163444	106	120	PRWYFYYLGTGPEAG	ECO:0000213	PubMed	38781962
P0DTC9	SWFTALTQHGKEDLK is a linear peptidic epitope (epitope ID 1172352) tested in 23 T cell assays, 8 B cell assays and 44 MHC ligand assays.	IEDB	1172352	51	65	SWFTALTQHGKEDLK	ECO:0000213	PubMed	34529740
P0DTC9	SWFTALTQHGKEDLK is a linear peptidic epitope (epitope ID 1172352) tested in 23 T cell assays, 8 B cell assays and 44 MHC ligand assays.	IEDB	1172352	51	65	SWFTALTQHGKEDLK	ECO:0000213	PubMed	32668444
P0DTC9	WPQIAQFAPSASAFF is a linear peptidic epitope (epitope ID 1179921) tested in 20 T cell assays, 16 B cell assays and 25 MHC ligand assays.	IEDB	1179921	301	315	WPQIAQFAPSASAFF	ECO:0000213	PubMed	34529740
P0DTC9	WPQIAQFAPSASAFF is a linear peptidic epitope (epitope ID 1179921) tested in 20 T cell assays, 16 B cell assays and 25 MHC ligand assays.	IEDB	1179921	301	315	WPQIAQFAPSASAFF	ECO:0000213	PubMed	35699447
P0DTC9	LSPRWYFYYLGTGPEAGL is a linear peptidic epitope (epitope ID 1309129) tested in 12 T cell assays.	IEDB	1309129	104	121	LSPRWYFYYLGTGPEAGL	ECO:0000213	PubMed	32887977
P0DTC9	NTASWFTAL is a linear peptidic epitope (epitope ID 1309134) tested in 5 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	1309134	48	56	NTASWFTAL	ECO:0000213	PubMed	34728796
P0DTC9	NTASWFTAL is a linear peptidic epitope (epitope ID 1309134) tested in 5 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	1309134	48	56	NTASWFTAL	ECO:0000213	PubMed	32913053
P0DTC9	NTASWFTAL is a linear peptidic epitope (epitope ID 1309134) tested in 5 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	1309134	48	56	NTASWFTAL	ECO:0000213	PubMed	34249101
P0DTC9	NTASWFTAL is a linear peptidic epitope (epitope ID 1309134) tested in 5 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	1309134	48	56	NTASWFTAL	ECO:0000213	PubMed	39591116
P0DTC9	QRNAPRITF is a linear peptidic epitope (epitope ID 1309136) tested in 26 T cell assays and 1 MHC ligand assay.	IEDB	1309136	9	17	QRNAPRITF	ECO:0000213	PubMed	34968416
P0DTC9	QRNAPRITF is a linear peptidic epitope (epitope ID 1309136) tested in 26 T cell assays and 1 MHC ligand assay.	IEDB	1309136	9	17	QRNAPRITF	ECO:0000213	PubMed	35196796
P0DTC9	QRNAPRITF is a linear peptidic epitope (epitope ID 1309136) tested in 26 T cell assays and 1 MHC ligand assay.	IEDB	1309136	9	17	QRNAPRITF	ECO:0000213	PubMed	36254196
P0DTC9	QRNAPRITF is a linear peptidic epitope (epitope ID 1309136) tested in 26 T cell assays and 1 MHC ligand assay.	IEDB	1309136	9	17	QRNAPRITF	ECO:0000213	PubMed	38781962
P0DTC9	QRNAPRITF is a linear peptidic epitope (epitope ID 1309136) tested in 26 T cell assays and 1 MHC ligand assay.	IEDB	1309136	9	17	QRNAPRITF	ECO:0000213	PubMed	39284068
P0DTC9	QRNAPRITF is a linear peptidic epitope (epitope ID 1309136) tested in 26 T cell assays and 1 MHC ligand assay.	IEDB	1309136	9	17	QRNAPRITF	ECO:0000213	PubMed	32999467
P0DTC9	QRNAPRITF is a linear peptidic epitope (epitope ID 1309136) tested in 26 T cell assays and 1 MHC ligand assay.	IEDB	1309136	9	17	QRNAPRITF	ECO:0000213	PubMed	33853928
P0DTC9	ADETQALPQRQKKQQ is a linear peptidic epitope (epitope ID 1310054) tested in 5 T cell assays, 10 B cell assays and 5 MHC ligand assays.	IEDB	1310054	376	390	ADETQALPQRQKKQQ	ECO:0000213	PubMed	34529740
P0DTC9	ALPQRQKKQQTVTLL is a linear peptidic epitope (epitope ID 1310061) tested in 3 T cell assays, 11 B cell assays and 5 MHC ligand assays.	IEDB	1310061	381	395	ALPQRQKKQQTVTLL	ECO:0000213	PubMed	34529740
P0DTC9	DDFSKQLQQSMSSAD is a linear peptidic epitope (epitope ID 1310077) tested in 4 T cell assays, 2 B cell assays and 5 MHC ligand assays.	IEDB	1310077	401	415	DDFSKQLQQSMSSAD	ECO:0000213	PubMed	34529740
P0DTC9	DKKKKADETQALPQR is a linear peptidic epitope (epitope ID 1310080) tested in 2 T cell assays, 9 B cell assays and 5 MHC ligand assays.	IEDB	1310080	371	385	DKKKKADETQALPQR	ECO:0000213	PubMed	34529740
P0DTC9	HIDAYKTFPPTEPKK is a linear peptidic epitope (epitope ID 1310109) tested in 4 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1310109	356	370	HIDAYKTFPPTEPKK	ECO:0000213	PubMed	34529740
P0DTC9	QKKQQTVTLLPAADL is a linear peptidic epitope (epitope ID 1310178) tested in 4 T cell assays, 5 B cell assays and 8 MHC ligand assays.	IEDB	1310178	386	400	QKKQQTVTLLPAADL	ECO:0000213	PubMed	34529740
P0DTC9	QKKQQTVTLLPAADL is a linear peptidic epitope (epitope ID 1310178) tested in 4 T cell assays, 5 B cell assays and 8 MHC ligand assays.	IEDB	1310178	386	400	QKKQQTVTLLPAADL	ECO:0000213	PubMed	38117652
P0DTC9	TEPKKDKKKKADETQ is a linear peptidic epitope (epitope ID 1310210) tested in 2 T cell assays, 5 B cell assays and 5 MHC ligand assays.	IEDB	1310210	366	380	TEPKKDKKKKADETQ	ECO:0000213	PubMed	34529740
P0DTC9	TVTLLPAADLDDFSK is a linear peptidic epitope (epitope ID 1310215) tested in 7 T cell assays, 15 B cell assays and 5 MHC ligand assays.	IEDB	1310215	391	405	TVTLLPAADLDDFSK	ECO:0000213	PubMed	34529740
P0DTC9	AADLDDFSKQLQQSM is a linear peptidic epitope (epitope ID 1310250) tested in 10 T cell assays, 14 B cell assays and 5 MHC ligand assays.	IEDB	1310250	397	411	AADLDDFSKQLQQSM	ECO:0000213	PubMed	36646780
P0DTC9	AADLDDFSKQLQQSM is a linear peptidic epitope (epitope ID 1310250) tested in 10 T cell assays, 14 B cell assays and 5 MHC ligand assays.	IEDB	1310250	397	411	AADLDDFSKQLQQSM	ECO:0000213	PubMed	32999467
P0DTC9	AIVLQLPQGTTLPKG is a linear peptidic epitope (epitope ID 1310265) tested in 9 T cell assays, 16 B cell assays and 5 MHC ligand assays.	IEDB	1310265	156	170	AIVLQLPQGTTLPKG	ECO:0000213	PubMed	34529740
P0DTC9	AIVLQLPQGTTLPKG is a linear peptidic epitope (epitope ID 1310265) tested in 9 T cell assays, 16 B cell assays and 5 MHC ligand assays.	IEDB	1310265	156	170	AIVLQLPQGTTLPKG	ECO:0000213	PubMed	32999467
P0DTC9	ASAFFGMSRIGMEVT is a linear peptidic epitope (epitope ID 1310286) tested in 20 T cell assays, 11 B cell assays and 5 MHC ligand assays.	IEDB	1310286	311	325	ASAFFGMSRIGMEVT	ECO:0000213	PubMed	33923363
P0DTC9	ASAFFGMSRIGMEVT is a linear peptidic epitope (epitope ID 1310286) tested in 20 T cell assays, 11 B cell assays and 5 MHC ligand assays.	IEDB	1310286	311	325	ASAFFGMSRIGMEVT	ECO:0000213	PubMed	34529740
P0DTC9	ASAFFGMSRIGMEVT is a linear peptidic epitope (epitope ID 1310286) tested in 20 T cell assays, 11 B cell assays and 5 MHC ligand assays.	IEDB	1310286	311	325	ASAFFGMSRIGMEVT	ECO:0000213	PubMed	35389886
P0DTC9	ASAFFGMSRIGMEVT is a linear peptidic epitope (epitope ID 1310286) tested in 20 T cell assays, 11 B cell assays and 5 MHC ligand assays.	IEDB	1310286	311	325	ASAFFGMSRIGMEVT	ECO:0000213	PubMed	32999467
P0DTC9	ASWFTALTQHGKEDL is a linear peptidic epitope (epitope ID 1310292) tested in 20 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	1310292	50	64	ASWFTALTQHGKEDL	ECO:0000213	PubMed	35389886
P0DTC9	ASWFTALTQHGKEDL is a linear peptidic epitope (epitope ID 1310292) tested in 20 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	1310292	50	64	ASWFTALTQHGKEDL	ECO:0000213	PubMed	37596280
P0DTC9	ASWFTALTQHGKEDL is a linear peptidic epitope (epitope ID 1310292) tested in 20 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	1310292	50	64	ASWFTALTQHGKEDL	ECO:0000213	PubMed	38117652
P0DTC9	ASWFTALTQHGKEDL is a linear peptidic epitope (epitope ID 1310292) tested in 20 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	1310292	50	64	ASWFTALTQHGKEDL	ECO:0000213	PubMed	32999467
P0DTC9	ASWFTALTQHGKEDL is a linear peptidic epitope (epitope ID 1310292) tested in 20 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	1310292	50	64	ASWFTALTQHGKEDL	ECO:0000213	PubMed	34630356
P0DTC9	DAALALLLLDRLNQL is a linear peptidic epitope (epitope ID 1310320) tested in 39 T cell assays, 4 B cell assays and 42 MHC ligand assays.	IEDB	1310320	216	230	DAALALLLLDRLNQL	ECO:0000213	PubMed	34529740
P0DTC9	DYKHWPQIAQF is a linear peptidic epitope (epitope ID 1310340) tested in 6 T cell assays.	IEDB	1310340	297	307	DYKHWPQIAQF	ECO:0000213	PubMed	32999467
P0DTC9	FKDQVILLNKHIDAY is a linear peptidic epitope (epitope ID 1310398) tested in 41 T cell assays, 10 B cell assays and 43 MHC ligand assays.	IEDB	1310398	346	360	FKDQVILLNKHIDAY	ECO:0000213	PubMed	34529740
P0DTC9	GTWLTYTGAIKLDDK is a linear peptidic epitope (epitope ID 1310464) tested in 17 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1310464	328	342	GTWLTYTGAIKLDDK	ECO:0000213	PubMed	38117652
P0DTC9	GTWLTYTGAIKLDDK is a linear peptidic epitope (epitope ID 1310464) tested in 17 T cell assays, 10 B cell assays and 7 MHC ligand assays.	IEDB	1310464	328	342	GTWLTYTGAIKLDDK	ECO:0000213	PubMed	32999467
P0DTC9	IGYYRRATRRIRGGD is a linear peptidic epitope (epitope ID 1310488) tested in 16 T cell assays, 6 B cell assays and 5 MHC ligand assays.	IEDB	1310488	84	98	IGYYRRATRRIRGGD	ECO:0000213	PubMed	33923363
P0DTC9	IGYYRRATRRIRGGD is a linear peptidic epitope (epitope ID 1310488) tested in 16 T cell assays, 6 B cell assays and 5 MHC ligand assays.	IEDB	1310488	84	98	IGYYRRATRRIRGGD	ECO:0000213	PubMed	35389886
P0DTC9	IGYYRRATRRIRGGD is a linear peptidic epitope (epitope ID 1310488) tested in 16 T cell assays, 6 B cell assays and 5 MHC ligand assays.	IEDB	1310488	84	98	IGYYRRATRRIRGGD	ECO:0000213	PubMed	32999467
P0DTC9	KDGIIWVATEGALNT is a linear peptidic epitope (epitope ID 1310526) tested in 15 T cell assays, 6 B cell assays and 8 MHC ligand assays.	IEDB	1310526	127	141	KDGIIWVATEGALNT	ECO:0000213	PubMed	37471227
P0DTC9	KDGIIWVATEGALNT is a linear peptidic epitope (epitope ID 1310526) tested in 15 T cell assays, 6 B cell assays and 8 MHC ligand assays.	IEDB	1310526	127	141	KDGIIWVATEGALNT	ECO:0000213	PubMed	32999467
P0DTC9	KKADETQAL is a linear peptidic epitope (epitope ID 1310539) tested in 3 T cell assays, 3 B cell assays and 1 MHC ligand assay.	IEDB	1310539	374	382	KKADETQAL	ECO:0000213	PubMed	37766081
P0DTC9	LLLLDRLNQLESKMS is a linear peptidic epitope (epitope ID 1310598) tested in 53 T cell assays, 15 B cell assays and 48 MHC ligand assays.	IEDB	1310598	221	235	LLLLDRLNQLESKMS	ECO:0000213	PubMed	33923363
P0DTC9	LLLLDRLNQLESKMS is a linear peptidic epitope (epitope ID 1310598) tested in 53 T cell assays, 15 B cell assays and 48 MHC ligand assays.	IEDB	1310598	221	235	LLLLDRLNQLESKMS	ECO:0000213	PubMed	34529740
P0DTC9	LLLLDRLNQLESKMS is a linear peptidic epitope (epitope ID 1310598) tested in 53 T cell assays, 15 B cell assays and 48 MHC ligand assays.	IEDB	1310598	221	235	LLLLDRLNQLESKMS	ECO:0000213	PubMed	36646780
P0DTC9	LLLLDRLNQLESKMS is a linear peptidic epitope (epitope ID 1310598) tested in 53 T cell assays, 15 B cell assays and 48 MHC ligand assays.	IEDB	1310598	221	235	LLLLDRLNQLESKMS	ECO:0000213	PubMed	37596280
P0DTC9	LLLLDRLNQLESKMS is a linear peptidic epitope (epitope ID 1310598) tested in 53 T cell assays, 15 B cell assays and 48 MHC ligand assays.	IEDB	1310598	221	235	LLLLDRLNQLESKMS	ECO:0000213	PubMed	32999467
P0DTC9	LLNKHIDAY is a linear peptidic epitope (epitope ID 1310599) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1310599	352	360	LLNKHIDAY	ECO:0000213	PubMed	34793243
P0DTC9	LLNKHIDAY is a linear peptidic epitope (epitope ID 1310599) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1310599	352	360	LLNKHIDAY	ECO:0000213	PubMed	36254196
P0DTC9	LLNKHIDAY is a linear peptidic epitope (epitope ID 1310599) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1310599	352	360	LLNKHIDAY	ECO:0000213	PubMed	38105139
P0DTC9	LLNKHIDAY is a linear peptidic epitope (epitope ID 1310599) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1310599	352	360	LLNKHIDAY	ECO:0000213	PubMed	33853928
P0DTC9	NPANNAAIVL is a linear peptidic epitope (epitope ID 1310677) tested in 7 T cell assays.	IEDB	1310677	150	159	NPANNAAIVL	ECO:0000213	PubMed	32999467
P0DTC9	PSGTWLTYTGAIKLD is a linear peptidic epitope (epitope ID 1310726) tested in 15 T cell assays, 4 B cell assays and 20 MHC ligand assays.	IEDB	1310726	326	340	PSGTWLTYTGAIKLD	ECO:0000213	PubMed	34529740
P0DTC9	PSGTWLTYTGAIKLD is a linear peptidic epitope (epitope ID 1310726) tested in 15 T cell assays, 4 B cell assays and 20 MHC ligand assays.	IEDB	1310726	326	340	PSGTWLTYTGAIKLD	ECO:0000213	PubMed	38781962
P0DTC9	QFAPSASAFFGMSRI is a linear peptidic epitope (epitope ID 1310734) tested in 5 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1310734	306	320	QFAPSASAFFGMSRI	ECO:0000213	PubMed	34529740
P0DTC9	RWYFYYLGTGPEAGL is a linear peptidic epitope (epitope ID 1310780) tested in 20 T cell assays and 5 MHC ligand assays.	IEDB	1310780	107	121	RWYFYYLGTGPEAGL	ECO:0000213	PubMed	33923363
P0DTC9	RWYFYYLGTGPEAGL is a linear peptidic epitope (epitope ID 1310780) tested in 20 T cell assays and 5 MHC ligand assays.	IEDB	1310780	107	121	RWYFYYLGTGPEAGL	ECO:0000213	PubMed	35389886
P0DTC9	RWYFYYLGTGPEAGL is a linear peptidic epitope (epitope ID 1310780) tested in 20 T cell assays and 5 MHC ligand assays.	IEDB	1310780	107	121	RWYFYYLGTGPEAGL	ECO:0000213	PubMed	32999467
P0DTC9	RWYFYYLGTGPEAGL is a linear peptidic epitope (epitope ID 1310780) tested in 20 T cell assays and 5 MHC ligand assays.	IEDB	1310780	107	121	RWYFYYLGTGPEAGL	ECO:0000213	PubMed	33723016
P0DTC9	SPDDQIGYY is a linear peptidic epitope (epitope ID 1310816) tested in 7 T cell assays and 2 MHC ligand assays.	IEDB	1310816	79	87	SPDDQIGYY	ECO:0000213	PubMed	38781962
P0DTC9	YKHWPQIAQFAPSAS is a linear peptidic epitope (epitope ID 1310960) tested in 9 T cell assays, 10 B cell assays and 5 MHC ligand assays.	IEDB	1310960	298	312	YKHWPQIAQFAPSAS	ECO:0000213	PubMed	32999467
P0DTC9	AQFAPSASAF is a linear peptidic epitope (epitope ID 1311554) tested in 12 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	1311554	305	314	AQFAPSASAF	ECO:0000213	PubMed	35196796
P0DTC9	AQFAPSASAF is a linear peptidic epitope (epitope ID 1311554) tested in 12 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	1311554	305	314	AQFAPSASAF	ECO:0000213	PubMed	35389886
P0DTC9	AQFAPSASAF is a linear peptidic epitope (epitope ID 1311554) tested in 12 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	1311554	305	314	AQFAPSASAF	ECO:0000213	PubMed	36254196
P0DTC9	AQFAPSASAF is a linear peptidic epitope (epitope ID 1311554) tested in 12 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	1311554	305	314	AQFAPSASAF	ECO:0000213	PubMed	38387105
P0DTC9	AQFAPSASAF is a linear peptidic epitope (epitope ID 1311554) tested in 12 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	1311554	305	314	AQFAPSASAF	ECO:0000213	PubMed	33184509
P0DTC9	AQFAPSASAF is a linear peptidic epitope (epitope ID 1311554) tested in 12 T cell assays, 1 B cell assay and 1 MHC ligand assay.	IEDB	1311554	305	314	AQFAPSASAF	ECO:0000213	PubMed	33853928
P0DTC9	KPRQKRTAT is a linear peptidic epitope (epitope ID 1311570) tested in 26 T cell assays, 2 B cell assays and 1 MHC ligand assay.	IEDB	1311570	257	265	KPRQKRTAT	ECO:0000213	PubMed	33945786
P0DTC9	KPRQKRTAT is a linear peptidic epitope (epitope ID 1311570) tested in 26 T cell assays, 2 B cell assays and 1 MHC ligand assay.	IEDB	1311570	257	265	KPRQKRTAT	ECO:0000213	PubMed	34793243
P0DTC9	KPRQKRTAT is a linear peptidic epitope (epitope ID 1311570) tested in 26 T cell assays, 2 B cell assays and 1 MHC ligand assay.	IEDB	1311570	257	265	KPRQKRTAT	ECO:0000213	PubMed	35157735
P0DTC9	KPRQKRTAT is a linear peptidic epitope (epitope ID 1311570) tested in 26 T cell assays, 2 B cell assays and 1 MHC ligand assay.	IEDB	1311570	257	265	KPRQKRTAT	ECO:0000213	PubMed	35196796
P0DTC9	KPRQKRTAT is a linear peptidic epitope (epitope ID 1311570) tested in 26 T cell assays, 2 B cell assays and 1 MHC ligand assay.	IEDB	1311570	257	265	KPRQKRTAT	ECO:0000213	PubMed	35328398
P0DTC9	KPRQKRTAT is a linear peptidic epitope (epitope ID 1311570) tested in 26 T cell assays, 2 B cell assays and 1 MHC ligand assay.	IEDB	1311570	257	265	KPRQKRTAT	ECO:0000213	PubMed	36254196
P0DTC9	KPRQKRTAT is a linear peptidic epitope (epitope ID 1311570) tested in 26 T cell assays, 2 B cell assays and 1 MHC ligand assay.	IEDB	1311570	257	265	KPRQKRTAT	ECO:0000213	PubMed	33184509
P0DTC9	KPRQKRTAT is a linear peptidic epitope (epitope ID 1311570) tested in 26 T cell assays, 2 B cell assays and 1 MHC ligand assay.	IEDB	1311570	257	265	KPRQKRTAT	ECO:0000213	PubMed	33853928
P0DTC9	GARSKQRRPQGLPN is a linear peptidic epitope (epitope ID 1311682) tested in 2 B cell assays.	IEDB	1311682	34	47	GARSKQRRPQGLPN	ECO:0000213	PubMed	32994364
P0DTC9	LPQGTTLPKGF is a linear peptidic epitope (epitope ID 1311749) tested in 2 T cell assays and 4 B cell assays.	IEDB	1311749	161	171	LPQGTTLPKGF	ECO:0000213	PubMed	33772767
P0DTC9	LPQGTTLPKGF is a linear peptidic epitope (epitope ID 1311749) tested in 2 T cell assays and 4 B cell assays.	IEDB	1311749	161	171	LPQGTTLPKGF	ECO:0000213	PubMed	32994364
P0DTC9	NNTASWFTAL is a linear peptidic epitope (epitope ID 1311775) tested in 2 B cell assays.	IEDB	1311775	47	56	NNTASWFTAL	ECO:0000213	PubMed	32994364
P0DTC9	TKKSAAEASKKPR is a linear peptidic epitope (epitope ID 1311869) tested in 2 B cell assays.	IEDB	1311869	247	259	TKKSAAEASKKPR	ECO:0000213	PubMed	32994364
P0DTC9	AALALLLLDRLNQLE is a linear peptidic epitope (epitope ID 1312093) tested in 8 T cell assays, 11 B cell assays and 5 MHC ligand assays.	IEDB	1312093	217	231	AALALLLLDRLNQLE	ECO:0000213	PubMed	35157735
P0DTC9	AALALLLLDRLNQLE is a linear peptidic epitope (epitope ID 1312093) tested in 8 T cell assays, 11 B cell assays and 5 MHC ligand assays.	IEDB	1312093	217	231	AALALLLLDRLNQLE	ECO:0000213	PubMed	34061349
P0DTC9	AFFGMSRIGMEVTPS is a linear peptidic epitope (epitope ID 1312112) tested in 2 T cell assays, 8 B cell assays and 5 MHC ligand assays.	IEDB	1312112	313	327	AFFGMSRIGMEVTPS	ECO:0000213	PubMed	33104167
P0DTC9	AFFGMSRIGMEVTPS is a linear peptidic epitope (epitope ID 1312112) tested in 2 T cell assays, 8 B cell assays and 5 MHC ligand assays.	IEDB	1312112	313	327	AFFGMSRIGMEVTPS	ECO:0000213	PubMed	35699447
P0DTC9	ANKDGIIWVATEGAL is a linear peptidic epitope (epitope ID 1312180) tested in 4 T cell assays, 2 B cell assays and 7 MHC ligand assays.	IEDB	1312180	125	139	ANKDGIIWVATEGAL	ECO:0000213	PubMed	35699447
P0DTC9	DKDPNFKDQVILLNK is a linear peptidic epitope (epitope ID 1312308) tested in 3 T cell assays, 11 B cell assays and 5 MHC ligand assays.	IEDB	1312308	341	355	DKDPNFKDQVILLNK	ECO:0000213	PubMed	34529740
P0DTC9	DYKHWPQIAQFAPSA is a linear peptidic epitope (epitope ID 1312340) tested in 2 T cell assays, 2 B cell assays and 5 MHC ligand assays.	IEDB	1312340	297	311	DYKHWPQIAQFAPSA	ECO:0000213	PubMed	34061349
P0DTC9	EASKKPRQKRTATKA is a linear peptidic epitope (epitope ID 1312346) tested in 1 T cell assay, 10 B cell assays and 5 MHC ligand assays.	IEDB	1312346	253	267	EASKKPRQKRTATKA	ECO:0000213	PubMed	36646780
P0DTC9	FGGPSDSTGSNQNGE is a linear peptidic epitope (epitope ID 1312422) tested in 2 T cell assays, 2 B cell assays and 5 MHC ligand assays.	IEDB	1312422	17	31	FGGPSDSTGSNQNGE	ECO:0000213	PubMed	35699447
P0DTC9	GIIWVATEGALNTPK is a linear peptidic epitope (epitope ID 1312553) tested in 10 T cell assays, 2 B cell assays and 5 MHC ligand assays.	IEDB	1312553	129	143	GIIWVATEGALNTPK	ECO:0000213	PubMed	35157735
P0DTC9	GIIWVATEGALNTPK is a linear peptidic epitope (epitope ID 1312553) tested in 10 T cell assays, 2 B cell assays and 5 MHC ligand assays.	IEDB	1312553	129	143	GIIWVATEGALNTPK	ECO:0000213	PubMed	35699447
P0DTC9	GMEVTPSGTWLTYTG is a linear peptidic epitope (epitope ID 1312574) tested in 8 T cell assays, 11 B cell assays and 5 MHC ligand assays.	IEDB	1312574	321	335	GMEVTPSGTWLTYTG	ECO:0000213	PubMed	34529740
P0DTC9	GMEVTPSGTWLTYTG is a linear peptidic epitope (epitope ID 1312574) tested in 8 T cell assays, 11 B cell assays and 5 MHC ligand assays.	IEDB	1312574	321	335	GMEVTPSGTWLTYTG	ECO:0000213	PubMed	33104167
P0DTC9	GMEVTPSGTWLTYTG is a linear peptidic epitope (epitope ID 1312574) tested in 8 T cell assays, 11 B cell assays and 5 MHC ligand assays.	IEDB	1312574	321	335	GMEVTPSGTWLTYTG	ECO:0000213	PubMed	35699447
P0DTC9	GYYRRATRRIRGGDG is a linear peptidic epitope (epitope ID 1312636) tested in 3 T cell assays, 8 B cell assays and 5 MHC ligand assays.	IEDB	1312636	85	99	GYYRRATRRIRGGDG	ECO:0000213	PubMed	35157735
P0DTC9	IVLQLPQGTTLPKGF is a linear peptidic epitope (epitope ID 1312786) tested in 1 T cell assay, 10 B cell assays and 5 MHC ligand assays.	IEDB	1312786	157	171	IVLQLPQGTTLPKGF	ECO:0000213	PubMed	36646780
P0DTC9	KEDLKFPRGQGVPIN is a linear peptidic epitope (epitope ID 1312809) tested in 7 T cell assays, 17 B cell assays and 5 MHC ligand assays.	IEDB	1312809	61	75	KEDLKFPRGQGVPIN	ECO:0000213	PubMed	34529740
P0DTC9	KKDKKKKADETQALP is a linear peptidic epitope (epitope ID 1312848) tested in 1 T cell assay, 2 B cell assays and 5 MHC ligand assays.	IEDB	1312848	369	383	KKDKKKKADETQALP	ECO:0000213	PubMed	36646780
P0DTC9	KKKADETQALPQRQK is a linear peptidic epitope (epitope ID 1312850) tested in 1 T cell assay, 10 B cell assays and 5 MHC ligand assays.	IEDB	1312850	373	387	KKKADETQALPQRQK	ECO:0000213	PubMed	36646780
P0DTC9	KPRQKRTATKAYNVT is a linear peptidic epitope (epitope ID 1312890) tested in 4 T cell assays, 2 B cell assays and 5 MHC ligand assays.	IEDB	1312890	257	271	KPRQKRTATKAYNVT	ECO:0000213	PubMed	33104167
P0DTC9	KQLQQSMSSADSTQA is a linear peptidic epitope (epitope ID 1312896) tested in 4 T cell assays, 10 B cell assays and 5 MHC ligand assays.	IEDB	1312896	405	419	KQLQQSMSSADSTQA	ECO:0000213	PubMed	34529740
P0DTC9	KRTATKAYNVTQAFG is a linear peptidic epitope (epitope ID 1312898) tested in 7 T cell assays, 10 B cell assays and 20 MHC ligand assays.	IEDB	1312898	261	275	KRTATKAYNVTQAFG	ECO:0000213	PubMed	34529740
P0DTC9	KSAAEASKKPRQKRT is a linear peptidic epitope (epitope ID 1312901) tested in 1 T cell assay, 4 B cell assays and 5 MHC ligand assays.	IEDB	1312901	249	263	KSAAEASKKPRQKRT	ECO:0000213	PubMed	36646780
P0DTC9	LPQGTTLPKGFYAEG is a linear peptidic epitope (epitope ID 1313059) tested in 2 T cell assays, 17 B cell assays and 5 MHC ligand assays.	IEDB	1313059	161	175	LPQGTTLPKGFYAEG	ECO:0000213	PubMed	34529740
P0DTC9	LPQGTTLPKGFYAEG is a linear peptidic epitope (epitope ID 1313059) tested in 2 T cell assays, 17 B cell assays and 5 MHC ligand assays.	IEDB	1313059	161	175	LPQGTTLPKGFYAEG	ECO:0000213	PubMed	36646780
P0DTC9	LPYGANKDGIIWVAT is a linear peptidic epitope (epitope ID 1313070) tested in 27 T cell assays, 16 B cell assays and 27 MHC ligand assays.	IEDB	1313070	121	135	LPYGANKDGIIWVAT	ECO:0000213	PubMed	34529740
P0DTC9	LPYGANKDGIIWVAT is a linear peptidic epitope (epitope ID 1313070) tested in 27 T cell assays, 16 B cell assays and 27 MHC ligand assays.	IEDB	1313070	121	135	LPYGANKDGIIWVAT	ECO:0000213	PubMed	38781962
P0DTC9	MSDNGPQNQRNAPRI is a linear peptidic epitope (epitope ID 1313173) tested in 5 T cell assays, 17 B cell assays and 8 MHC ligand assays.	IEDB	1313173	1	15	MSDNGPQNQRNAPRI	ECO:0000213	PubMed	34529740
P0DTC9	NFKDQVILLNKHIDA is a linear peptidic epitope (epitope ID 1313200) tested in 2 T cell assays, 2 B cell assays and 5 MHC ligand assays.	IEDB	1313200	345	359	NFKDQVILLNKHIDA	ECO:0000213	PubMed	35699447
P0DTC9	QASSRSSSRSRNSSR is a linear peptidic epitope (epitope ID 1313325) tested in 2 T cell assays, 16 B cell assays and 5 MHC ligand assays.	IEDB	1313325	181	195	QASSRSSSRSRNSSR	ECO:0000213	PubMed	34529740
P0DTC9	QELIRQGTDYKHWPQ is a linear peptidic epitope (epitope ID 1313331) tested in 2 T cell assays, 8 B cell assays and 7 MHC ligand assays.	IEDB	1313331	289	303	QELIRQGTDYKHWPQ	ECO:0000213	PubMed	34061349
P0DTC9	QLESKMSGKGQQQQG is a linear peptidic epitope (epitope ID 1313346) tested in 1 T cell assay, 8 B cell assays and 9 MHC ligand assays.	IEDB	1313346	229	243	QLESKMSGKGQQQQG	ECO:0000213	PubMed	36646780
P0DTC9	QQGQTVTKKSAAEAS is a linear peptidic epitope (epitope ID 1313375) tested in 2 T cell assays, 17 B cell assays and 6 MHC ligand assays.	IEDB	1313375	241	255	QQGQTVTKKSAAEAS	ECO:0000213	PubMed	34529740
P0DTC9	QQTVTLLPAADLDDF is a linear peptidic epitope (epitope ID 1313378) tested in 2 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1313378	389	403	QQTVTLLPAADLDDF	ECO:0000213	PubMed	36646780
P0DTC9	QQTVTLLPAADLDDF is a linear peptidic epitope (epitope ID 1313378) tested in 2 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1313378	389	403	QQTVTLLPAADLDDF	ECO:0000213	PubMed	34061349
P0DTC9	QTQGNFGDQELIRQG is a linear peptidic epitope (epitope ID 1313389) tested in 2 T cell assays, 10 B cell assays and 5 MHC ligand assays.	IEDB	1313389	281	295	QTQGNFGDQELIRQG	ECO:0000213	PubMed	34529740
P0DTC9	QVILLNKHIDAYKTF is a linear peptidic epitope (epitope ID 1313394) tested in 6 T cell assays, 8 B cell assays and 5 MHC ligand assays.	IEDB	1313394	349	363	QVILLNKHIDAYKTF	ECO:0000213	PubMed	34061349
P0DTC9	QVILLNKHIDAYKTF is a linear peptidic epitope (epitope ID 1313394) tested in 6 T cell assays, 8 B cell assays and 5 MHC ligand assays.	IEDB	1313394	349	363	QVILLNKHIDAYKTF	ECO:0000213	PubMed	35699447
P0DTC9	RATRRIRGGDGKMKD is a linear peptidic epitope (epitope ID 1313409) tested in 2 T cell assays, 2 B cell assays and 5 MHC ligand assays.	IEDB	1313409	89	103	RATRRIRGGDGKMKD	ECO:0000213	PubMed	34061349
P0DTC9	RMAGNGGDAALALLL is a linear peptidic epitope (epitope ID 1313463) tested in 2 T cell assays, 2 B cell assays and 5 MHC ligand assays.	IEDB	1313463	209	223	RMAGNGGDAALALLL	ECO:0000213	PubMed	34061349
P0DTC9	RNPANNAAIVLQLPQ is a linear peptidic epitope (epitope ID 1313467) tested in 1 T cell assay, 2 B cell assays and 6 MHC ligand assays.	IEDB	1313467	149	163	RNPANNAAIVLQLPQ	ECO:0000213	PubMed	38117652
P0DTC9	RPQGLPNNTASWFTA is a linear peptidic epitope (epitope ID 1313478) tested in 3 T cell assays, 11 B cell assays and 5 MHC ligand assays.	IEDB	1313478	41	55	RPQGLPNNTASWFTA	ECO:0000213	PubMed	34529740
P0DTC9	RQKKQQTVTLLPAAD is a linear peptidic epitope (epitope ID 1313484) tested in 1 T cell assay, 10 B cell assays and 6 MHC ligand assays.	IEDB	1313484	385	399	RQKKQQTVTLLPAAD	ECO:0000213	PubMed	36646780
P0DTC9	RQKKQQTVTLLPAAD is a linear peptidic epitope (epitope ID 1313484) tested in 1 T cell assay, 10 B cell assays and 6 MHC ligand assays.	IEDB	1313484	385	399	RQKKQQTVTLLPAAD	ECO:0000213	PubMed	38117652
P0DTC9	SDSTGSNQNGERSGA is a linear peptidic epitope (epitope ID 1313538) tested in 3 T cell assays, 11 B cell assays and 5 MHC ligand assays.	IEDB	1313538	21	35	SDSTGSNQNGERSGA	ECO:0000213	PubMed	34529740
P0DTC9	SKQRRPQGLPNNTAS is a linear peptidic epitope (epitope ID 1313575) tested in 1 T cell assay, 10 B cell assays and 5 MHC ligand assays.	IEDB	1313575	37	51	SKQRRPQGLPNNTAS	ECO:0000213	PubMed	36646780
P0DTC9	TASWFTALTQHGKED is a linear peptidic epitope (epitope ID 1313733) tested in 3 T cell assays, 8 B cell assays and 7 MHC ligand assays.	IEDB	1313733	49	63	TASWFTALTQHGKED	ECO:0000213	PubMed	38117652
P0DTC9	TKAYNVTQAFGRRGP is a linear peptidic epitope (epitope ID 1313746) tested in 2 T cell assays, 8 B cell assays and 8 MHC ligand assays.	IEDB	1313746	265	279	TKAYNVTQAFGRRGP	ECO:0000213	PubMed	38117652
P0DTC9	TKAYNVTQAFGRRGP is a linear peptidic epitope (epitope ID 1313746) tested in 2 T cell assays, 8 B cell assays and 8 MHC ligand assays.	IEDB	1313746	265	279	TKAYNVTQAFGRRGP	ECO:0000213	PubMed	35699447
P0DTC9	TLLPAADLDDFSKQL is a linear peptidic epitope (epitope ID 1313757) tested in 1 T cell assay, 19 B cell assays and 5 MHC ligand assays.	IEDB	1313757	393	407	TLLPAADLDDFSKQL	ECO:0000213	PubMed	36646780
P0DTC9	TPKDHIGTRNPANNA is a linear peptidic epitope (epitope ID 1313772) tested in 2 T cell assays, 10 B cell assays and 5 MHC ligand assays.	IEDB	1313772	141	155	TPKDHIGTRNPANNA	ECO:0000213	PubMed	34529740
P0DTC9	TPSGTWLTYTGAIKL is a linear peptidic epitope (epitope ID 1313778) tested in 3 T cell assays, 8 B cell assays and 5 MHC ligand assays.	IEDB	1313778	325	339	TPSGTWLTYTGAIKL	ECO:0000213	PubMed	35699447
P0DTC9	TQHGKEDLKFPRGQG is a linear peptidic epitope (epitope ID 1313789) tested in 2 T cell assays, 2 B cell assays and 5 MHC ligand assays.	IEDB	1313789	57	71	TQHGKEDLKFPRGQG	ECO:0000213	PubMed	35699447
P0DTC9	TWLTYTGAIKLDDKD is a linear peptidic epitope (epitope ID 1313817) tested in 2 T cell assays, 2 B cell assays and 5 MHC ligand assays.	IEDB	1313817	329	343	TWLTYTGAIKLDDKD	ECO:0000213	PubMed	34061349
P0DTC9	YTGAIKLDDKDPNFK is a linear peptidic epitope (epitope ID 1314052) tested in 2 T cell assays, 2 B cell assays and 5 MHC ligand assays.	IEDB	1314052	333	347	YTGAIKLDDKDPNFK	ECO:0000213	PubMed	34061349
P0DTC9	AAEASKKPRQKRTAT is a linear peptidic epitope (epitope ID 1314125) tested in 3 T cell assays, 9 B cell assays and 20 MHC ligand assays.	IEDB	1314125	251	265	AAEASKKPRQKRTAT	ECO:0000213	PubMed	34529740
P0DTC9	AGNGGDAALALLLLD is a linear peptidic epitope (epitope ID 1314288) tested in 8 T cell assays, 15 B cell assays and 20 MHC ligand assays.	IEDB	1314288	211	225	AGNGGDAALALLLLD	ECO:0000213	PubMed	34529740
P0DTC9	AIKLDDKDPNFKDQV is a linear peptidic epitope (epitope ID 1314325) tested in 4 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1314325	336	350	AIKLDDKDPNFKDQV	ECO:0000213	PubMed	34529740
P0DTC9	EGALNTPKDHIGTRN is a linear peptidic epitope (epitope ID 1315783) tested in 4 T cell assays, 10 B cell assays and 5 MHC ligand assays.	IEDB	1315783	136	150	EGALNTPKDHIGTRN	ECO:0000213	PubMed	34529740
P0DTC9	FGDQELIRQGTDYKH is a linear peptidic epitope (epitope ID 1316419) tested in 4 T cell assays, 10 B cell assays and 5 MHC ligand assays.	IEDB	1316419	286	300	FGDQELIRQGTDYKH	ECO:0000213	PubMed	34529740
P0DTC9	FPRGQGVPINTNSSP is a linear peptidic epitope (epitope ID 1316855) tested in 3 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1316855	66	80	FPRGQGVPINTNSSP	ECO:0000213	PubMed	34529740
P0DTC9	GGDGKMKDLSPRWYF is a linear peptidic epitope (epitope ID 1317355) tested in 3 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1317355	96	110	GGDGKMKDLSPRWYF	ECO:0000213	PubMed	34529740
P0DTC9	GKGQQQQGQTVTKKS is a linear peptidic epitope (epitope ID 1317428) tested in 3 T cell assays, 5 B cell assays and 5 MHC ligand assays.	IEDB	1317428	236	250	GKGQQQQGQTVTKKS	ECO:0000213	PubMed	34529740
P0DTC9	GVPINTNSSPDDQIG is a linear peptidic epitope (epitope ID 1317881) tested in 2 T cell assays, 8 B cell assays and 5 MHC ligand assays.	IEDB	1317881	71	85	GVPINTNSSPDDQIG	ECO:0000213	PubMed	34529740
P0DTC9	IWVATEGALNTPKDH is a linear peptidic epitope (epitope ID 1319093) tested in 3 T cell assays, 8 B cell assays and 5 MHC ligand assays.	IEDB	1319093	131	145	IWVATEGALNTPKDH	ECO:0000213	PubMed	34529740
P0DTC9	IWVATEGALNTPKDH is a linear peptidic epitope (epitope ID 1319093) tested in 3 T cell assays, 8 B cell assays and 5 MHC ligand assays.	IEDB	1319093	131	145	IWVATEGALNTPKDH	ECO:0000213	PubMed	38781962
P0DTC9	KKPRQKRTATKAYNV is a linear peptidic epitope (epitope ID 1319570) tested in 6 T cell assays, 10 B cell assays and 20 MHC ligand assays.	IEDB	1319570	256	270	KKPRQKRTATKAYNV	ECO:0000213	PubMed	34529740
P0DTC9	LTYTGAIKLDDKDPN is a linear peptidic epitope (epitope ID 1321430) tested in 5 T cell assays, 14 B cell assays and 6 MHC ligand assays.	IEDB	1321430	331	345	LTYTGAIKLDDKDPN	ECO:0000213	PubMed	34529740
P0DTC9	LTYTGAIKLDDKDPN is a linear peptidic epitope (epitope ID 1321430) tested in 5 T cell assays, 14 B cell assays and 6 MHC ligand assays.	IEDB	1321430	331	345	LTYTGAIKLDDKDPN	ECO:0000213	PubMed	38117652
P0DTC9	NAPRITFGGPSDSTG is a linear peptidic epitope (epitope ID 1322297) tested in 3 T cell assays, 8 B cell assays and 5 MHC ligand assays.	IEDB	1322297	11	25	NAPRITFGGPSDSTG	ECO:0000213	PubMed	34529740
P0DTC9	NKDGIIWVATEGALN is a linear peptidic epitope (epitope ID 1322398) tested in 34 T cell assays, 4 B cell assays and 45 MHC ligand assays.	IEDB	1322398	126	140	NKDGIIWVATEGALN	ECO:0000213	PubMed	34529740
P0DTC9	NKDGIIWVATEGALN is a linear peptidic epitope (epitope ID 1322398) tested in 34 T cell assays, 4 B cell assays and 45 MHC ligand assays.	IEDB	1322398	126	140	NKDGIIWVATEGALN	ECO:0000213	PubMed	38781962
P0DTC9	PQNQRNAPRITFGGP is a linear peptidic epitope (epitope ID 1323019) tested in 2 T cell assays, 5 B cell assays and 5 MHC ligand assays.	IEDB	1323019	6	20	PQNQRNAPRITFGGP	ECO:0000213	PubMed	34529740
P0DTC9	RRGPEQTQGNFGDQE is a linear peptidic epitope (epitope ID 1324030) tested in 3 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1324030	276	290	RRGPEQTQGNFGDQE	ECO:0000213	PubMed	34529740
P0DTC9	TDYKHWPQIAQFAPS is a linear peptidic epitope (epitope ID 1325397) tested in 3 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1325397	296	310	TDYKHWPQIAQFAPS	ECO:0000213	PubMed	34529740
P0DTC9	TFGGPSDSTGSNQNG is a linear peptidic epitope (epitope ID 1325450) tested in 5 T cell assays, 10 B cell assays and 5 MHC ligand assays.	IEDB	1325450	16	30	TFGGPSDSTGSNQNG	ECO:0000213	PubMed	34529740
P0DTC9	TQAFGRRGPEQTQGN is a linear peptidic epitope (epitope ID 1325850) tested in 4 T cell assays, 14 B cell assays and 6 MHC ligand assays.	IEDB	1325850	271	285	TQAFGRRGPEQTQGN	ECO:0000213	PubMed	34529740
P0DTC9	TQAFGRRGPEQTQGN is a linear peptidic epitope (epitope ID 1325850) tested in 4 T cell assays, 14 B cell assays and 6 MHC ligand assays.	IEDB	1325850	271	285	TQAFGRRGPEQTQGN	ECO:0000213	PubMed	38117652
P0DTC9	TRRIRGGDGKMKDLS is a linear peptidic epitope (epitope ID 1325864) tested in 4 T cell assays, 15 B cell assays and 5 MHC ligand assays.	IEDB	1325864	91	105	TRRIRGGDGKMKDLS	ECO:0000213	PubMed	34529740
P0DTC9	YKTFPPTEPK is a linear peptidic epitope (epitope ID 1328121) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1328121	360	369	YKTFPPTEPK	ECO:0000213	PubMed	34728796
P0DTC9	YYRRATRRIRGGDGK is a linear peptidic epitope (epitope ID 1329005) tested in 23 T cell assays, 4 B cell assays and 42 MHC ligand assays.	IEDB	1329005	86	100	YYRRATRRIRGGDGK	ECO:0000213	PubMed	34529740
P0DTC9	RLNQLESKM is a linear peptidic epitope (epitope ID 1330575) tested in 5 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7kgt.	IEDB	1330575	226	234	RLNQLESKM	ECO:0000213	PubMed	34793243
P0DTC9	RLNQLESKM is a linear peptidic epitope (epitope ID 1330575) tested in 5 T cell assays, 3 MHC ligand assays and has 3D structure(s) 7kgt.	IEDB	1330575	226	234	RLNQLESKM	ECO:0000213	PubMed	33521593
P0DTC9	RTATKAYNV is a linear peptidic epitope (epitope ID 1330583) tested in 13 T cell assays and 2 MHC ligand assays.	IEDB	1330583	262	270	RTATKAYNV	ECO:0000213	PubMed	38866784
P0DTC9	AADLDDFSKQL is a linear peptidic epitope (epitope ID 1330713) tested in 1 T cell assay.	IEDB	1330713	397	407	AADLDDFSKQL	ECO:0000213	PubMed	33853928
P0DTC9	APRITFGGP is a linear peptidic epitope (epitope ID 1330992) tested in 4 T cell assays and 12 MHC ligand assays.	IEDB	1330992	12	20	APRITFGGP	ECO:0000213	PubMed	34171305
P0DTC9	HWPQIAQF is a linear peptidic epitope (epitope ID 1332312) tested in 1 T cell assay.	IEDB	1332312	300	307	HWPQIAQF	ECO:0000213	PubMed	33853928
P0DTC9	KKQQTVTLL is a linear peptidic epitope (epitope ID 1332478) tested in 1 T cell assay.	IEDB	1332478	387	395	KKQQTVTLL	ECO:0000213	PubMed	33853928
P0DTC9	KQQTVTLLPAADLDDF is a linear peptidic epitope (epitope ID 1332525) tested in 5 T cell assays and 2 B cell assays.	IEDB	1332525	388	403	KQQTVTLLPAADLDDF	ECO:0000213	PubMed	38605956
P0DTC9	KQQTVTLLPAADLDDF is a linear peptidic epitope (epitope ID 1332525) tested in 5 T cell assays and 2 B cell assays.	IEDB	1332525	388	403	KQQTVTLLPAADLDDF	ECO:0000213	PubMed	33911008
P0DTC9	LLDRLNQ is a linear peptidic epitope (epitope ID 1332637) tested in 2 B cell assays.	IEDB	1332637	223	229	LLDRLNQ	ECO:0000213	PubMed	33495758
P0DTC9	MKDLSPRWY is a linear peptidic epitope (epitope ID 1332792) tested in 2 T cell assays.	IEDB	1332792	101	109	MKDLSPRWY	ECO:0000213	PubMed	33853928
P0DTC9	PKKDKKKK is a linear peptidic epitope (epitope ID 1333087) tested in 2 B cell assays.	IEDB	1333087	368	375	PKKDKKKK	ECO:0000213	PubMed	33495758
P0DTC9	RRGPEQTQGNF is a linear peptidic epitope (epitope ID 1333386) tested in 1 T cell assay and 3 MHC ligand assays.	IEDB	1333386	276	286	RRGPEQTQGNF	ECO:0000213	PubMed	33853928
P0DTC9	SSPDDQIGYYR is a linear peptidic epitope (epitope ID 1333792) tested in 1 T cell assay.	IEDB	1333792	78	88	SSPDDQIGYYR	ECO:0000213	PubMed	33853928
P0DTC9	LLDRLNQL is a linear peptidic epitope (epitope ID 1334594) tested in 6 T cell assays and 1 MHC ligand assay.	IEDB	1334594	223	230	LLDRLNQL	ECO:0000213	PubMed	33923363
P0DTC9	ATKAYNVTQAFGRRG is a linear peptidic epitope (epitope ID 1391818) tested in 1 T cell assay, 5 B cell assays and 6 MHC ligand assays.	IEDB	1391818	264	278	ATKAYNVTQAFGRRG	ECO:0000213	PubMed	38117652
P0DTC9	IGYYRRATR is a linear peptidic epitope (epitope ID 1392220) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1392220	84	92	IGYYRRATR	ECO:0000213	PubMed	34728796
P0DTC9	QAFGRRGPE is a linear peptidic epitope (epitope ID 1392365) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1392365	272	280	QAFGRRGPE	ECO:0000213	PubMed	38117652
P0DTC9	RIRGGDGKM is a linear peptidic epitope (epitope ID 1392399) tested in 10 T cell assays.	IEDB	1392399	93	101	RIRGGDGKM	ECO:0000213	PubMed	33945786
P0DTC9	RIRGGDGKM is a linear peptidic epitope (epitope ID 1392399) tested in 10 T cell assays.	IEDB	1392399	93	101	RIRGGDGKM	ECO:0000213	PubMed	34793243
P0DTC9	RIRGGDGKM is a linear peptidic epitope (epitope ID 1392399) tested in 10 T cell assays.	IEDB	1392399	93	101	RIRGGDGKM	ECO:0000213	PubMed	35157735
P0DTC9	RIRGGDGKM is a linear peptidic epitope (epitope ID 1392399) tested in 10 T cell assays.	IEDB	1392399	93	101	RIRGGDGKM	ECO:0000213	PubMed	35196796
P0DTC9	RIRGGDGKM is a linear peptidic epitope (epitope ID 1392399) tested in 10 T cell assays.	IEDB	1392399	93	101	RIRGGDGKM	ECO:0000213	PubMed	38077128
P0DTC9	VTKKSAAEASKKPRQ is a linear peptidic epitope (epitope ID 1392505) tested in 2 T cell assays, 5 B cell assays and 5 MHC ligand assays.	IEDB	1392505	246	260	VTKKSAAEASKKPRQ	ECO:0000213	PubMed	34529740
P0DTC9	DLSPRWYFYY is a linear peptidic epitope (epitope ID 1394617) tested in 5 T cell assays.	IEDB	1394617	103	112	DLSPRWYFYY	ECO:0000213	PubMed	33995351
P0DTC9	DLSPRWYFYY is a linear peptidic epitope (epitope ID 1394617) tested in 5 T cell assays.	IEDB	1394617	103	112	DLSPRWYFYY	ECO:0000213	PubMed	36603583
P0DTC9	DLSPRWYFYYL is a linear peptidic epitope (epitope ID 1394618) tested in 2 T cell assays.	IEDB	1394618	103	113	DLSPRWYFYYL	ECO:0000213	PubMed	33995351
P0DTC9	DLSPRWYFYYLGTGP is a linear peptidic epitope (epitope ID 1394619) tested in 7 T cell assays, 6 B cell assays and 5 MHC ligand assays.	IEDB	1394619	103	117	DLSPRWYFYYLGTGP	ECO:0000213	PubMed	33995351
P0DTC9	ERSGARSKQRRPQGL is a linear peptidic epitope (epitope ID 1397276) tested in 3 T cell assays, 15 B cell assays and 5 MHC ligand assays.	IEDB	1397276	31	45	ERSGARSKQRRPQGL	ECO:0000213	PubMed	34529740
P0DTC9	ESKMSGKGQQQQGQT is a linear peptidic epitope (epitope ID 1397277) tested in 2 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1397277	231	245	ESKMSGKGQQQQGQT	ECO:0000213	PubMed	34529740
P0DTC9	ESKMSGKGQQQQGQT is a linear peptidic epitope (epitope ID 1397277) tested in 2 T cell assays, 9 B cell assays and 8 MHC ligand assays.	IEDB	1397277	231	245	ESKMSGKGQQQQGQT	ECO:0000213	PubMed	38781962
P0DTC9	IGTRNPANNAAIVLQ is a linear peptidic epitope (epitope ID 1397327) tested in 3 T cell assays, 5 B cell assays and 5 MHC ligand assays.	IEDB	1397327	146	160	IGTRNPANNAAIVLQ	ECO:0000213	PubMed	34529740
P0DTC9	RSKQRRPQGLPNNTA is a linear peptidic epitope (epitope ID 1397409) tested in 2 T cell assays, 5 B cell assays and 5 MHC ligand assays.	IEDB	1397409	36	50	RSKQRRPQGLPNNTA	ECO:0000213	PubMed	34529740
P0DTC9	ALALLLLDRLNQ is a linear peptidic epitope (epitope ID 1410081) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1410081	218	229	ALALLLLDRLNQ	ECO:0000213	PubMed	38117652
P0DTC9	ALLLLDRLNQLE is a linear peptidic epitope (epitope ID 1410413) tested in 1 T cell assay and 3 B cell assays.	IEDB	1410413	220	231	ALLLLDRLNQLE	ECO:0000213	PubMed	35857584
P0DTC9	AQFAPSASAFFG is a linear peptidic epitope (epitope ID 1411922) tested in 4 T cell assays and 3 B cell assays.	IEDB	1411922	305	316	AQFAPSASAFFG	ECO:0000213	PubMed	35857584
P0DTC9	ASWFTALTQHGK is a linear peptidic epitope (epitope ID 1413012) tested in 1 T cell assay and 3 B cell assays.	IEDB	1413012	50	61	ASWFTALTQHGK	ECO:0000213	PubMed	35857584
P0DTC9	DAYKTFPPTEPK is a linear peptidic epitope (epitope ID 1419499) tested in 4 B cell assays.	IEDB	1419499	358	369	DAYKTFPPTEPK	ECO:0000213	PubMed	37898784
P0DTC9	DQVILLNKHIDA is a linear peptidic epitope (epitope ID 1423647) tested in 1 T cell assay, 3 B cell assays and 1 MHC ligand assay.	IEDB	1423647	348	359	DQVILLNKHIDA	ECO:0000213	PubMed	38117652
P0DTC9	GYYRRATRRIRG is a linear peptidic epitope (epitope ID 1446099) tested in 7 T cell assays and 6 B cell assays.	IEDB	1446099	85	96	GYYRRATRRIRG	ECO:0000213	PubMed	35857584
P0DTC9	KAYNVTQAFGRR is a linear peptidic epitope (epitope ID 1456851) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1456851	266	277	KAYNVTQAFGRR	ECO:0000213	PubMed	38117652
P0DTC9	LLLDRLNQLESK is a linear peptidic epitope (epitope ID 1469111) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1469111	222	233	LLLDRLNQLESK	ECO:0000213	PubMed	38117652
P0DTC9	NVTQAFGRRGPE is a linear peptidic epitope (epitope ID 1485094) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1485094	269	280	NVTQAFGRRGPE	ECO:0000213	PubMed	38117652
P0DTC9	RSKQRRPQGLPN is a linear peptidic epitope (epitope ID 1500187) tested in 4 B cell assays.	IEDB	1500187	36	47	RSKQRRPQGLPN	ECO:0000213	PubMed	37898784
P0DTC9	SAFFGMSRIGME is a linear peptidic epitope (epitope ID 1501534) tested in 2 T cell assays and 6 B cell assays.	IEDB	1501534	312	323	SAFFGMSRIGME	ECO:0000213	PubMed	35857584
P0DTC9	TWLTYTGAIKLD is a linear peptidic epitope (epitope ID 1520609) tested in 5 T cell assays and 3 B cell assays.	IEDB	1520609	329	340	TWLTYTGAIKLD	ECO:0000213	PubMed	35857584
P0DTC9	VTQAFGRRGPEQ is a linear peptidic epitope (epitope ID 1529971) tested in 3 B cell assays and 1 MHC ligand assay.	IEDB	1529971	270	281	VTQAFGRRGPEQ	ECO:0000213	PubMed	38117652
P0DTC9	WYFYYLGTGPEA is a linear peptidic epitope (epitope ID 1533216) tested in 1 T cell assay and 3 B cell assays.	IEDB	1533216	108	119	WYFYYLGTGPEA	ECO:0000213	PubMed	35857584
P0DTC9	ALALLLLDRLNQLES is a linear peptidic epitope (epitope ID 1539491) tested in 4 B cell assays and 6 MHC ligand assays.	IEDB	1539491	218	232	ALALLLLDRLNQLES	ECO:0000213	PubMed	38117652
P0DTC9	DQVILLNKHIDAYKT is a linear peptidic epitope (epitope ID 1539947) tested in 1 T cell assay, 4 B cell assays and 6 MHC ligand assays.	IEDB	1539947	348	362	DQVILLNKHIDAYKT	ECO:0000213	PubMed	38117652
P0DTC9	FYYLGTGPEAGLPYG is a linear peptidic epitope (epitope ID 1540390) tested in 1 T cell assay, 4 B cell assays and 5 MHC ligand assays.	IEDB	1540390	110	124	FYYLGTGPEAGLPYG	ECO:0000213	PubMed	34630356
P0DTC9	GPEAGLPYGANKDGI is a linear peptidic epitope (epitope ID 1540543) tested in 4 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1540543	116	130	GPEAGLPYGANKDGI	ECO:0000213	PubMed	34529740
P0DTC9	GPEAGLPYGANKDGI is a linear peptidic epitope (epitope ID 1540543) tested in 4 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1540543	116	130	GPEAGLPYGANKDGI	ECO:0000213	PubMed	38781962
P0DTC9	LDRLNQLESKMSGKG is a linear peptidic epitope (epitope ID 1541237) tested in 3 T cell assays, 4 B cell assays and 10 MHC ligand assays.	IEDB	1541237	224	238	LDRLNQLESKMSGKG	ECO:0000213	PubMed	37471227
P0DTC9	LLPAADLDDFSKQLQ is a linear peptidic epitope (epitope ID 1541375) tested in 10 B cell assays and 6 MHC ligand assays.	IEDB	1541375	394	408	LLPAADLDDFSKQLQ	ECO:0000213	PubMed	38117652
P0DTC9	NPANNAAIVLQLPQG is a linear peptidic epitope (epitope ID 1541798) tested in 4 B cell assays and 6 MHC ligand assays.	IEDB	1541798	150	164	NPANNAAIVLQLPQG	ECO:0000213	PubMed	38117652
P0DTC9	PNNTASWFTALTQHG is a linear peptidic epitope (epitope ID 1541993) tested in 4 T cell assays, 10 B cell assays and 6 MHC ligand assays.	IEDB	1541993	46	60	PNNTASWFTALTQHG	ECO:0000213	PubMed	34529740
P0DTC9	PNNTASWFTALTQHG is a linear peptidic epitope (epitope ID 1541993) tested in 4 T cell assays, 10 B cell assays and 6 MHC ligand assays.	IEDB	1541993	46	60	PNNTASWFTALTQHG	ECO:0000213	PubMed	38781962
P0DTC9	QFAPSASAF is a linear peptidic epitope (epitope ID 1542092) tested in 3 T cell assays and 5 MHC ligand assays.	IEDB	1542092	306	314	QFAPSASAF	ECO:0000213	PubMed	38932408
P0DTC9	RLNQLESKMSGKGQQ is a linear peptidic epitope (epitope ID 1542291) tested in 3 T cell assays, 10 B cell assays and 8 MHC ligand assays.	IEDB	1542291	226	240	RLNQLESKMSGKGQQ	ECO:0000213	PubMed	34529740
P0DTC9	SNQNGERSGARSKQR is a linear peptidic epitope (epitope ID 1542535) tested in 1 T cell assay, 4 B cell assays and 5 MHC ligand assays.	IEDB	1542535	26	40	SNQNGERSGARSKQR	ECO:0000213	PubMed	34529740
P0DTC9	SPARMAGNGGDAALA is a linear peptidic epitope (epitope ID 1542543) tested in 1 T cell assay, 4 B cell assays and 5 MHC ligand assays.	IEDB	1542543	206	220	SPARMAGNGGDAALA	ECO:0000213	PubMed	34529740
P0DTC9	SRGGSQASSRSSSRS is a linear peptidic epitope (epitope ID 1542564) tested in 2 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1542564	176	190	SRGGSQASSRSSSRS	ECO:0000213	PubMed	34529740
P0DTC9	SRIGMEVTPSGTWLT is a linear peptidic epitope (epitope ID 1542566) tested in 1 T cell assay, 4 B cell assays and 7 MHC ligand assays.	IEDB	1542566	318	332	SRIGMEVTPSGTWLT	ECO:0000213	PubMed	38105139
P0DTC9	SSPDDQIGYY is a linear peptidic epitope (epitope ID 1542585) tested in 6 T cell assays and 2 MHC ligand assays.	IEDB	1542585	78	87	SSPDDQIGYY	ECO:0000213	PubMed	35389886
P0DTC9	SSPDDQIGYY is a linear peptidic epitope (epitope ID 1542585) tested in 6 T cell assays and 2 MHC ligand assays.	IEDB	1542585	78	87	SSPDDQIGYY	ECO:0000213	PubMed	38781962
P0DTC9	SSSRSRNSSRNSTPG is a linear peptidic epitope (epitope ID 1542590) tested in 1 T cell assay, 4 B cell assays and 5 MHC ligand assays.	IEDB	1542590	186	200	SSSRSRNSSRNSTPG	ECO:0000213	PubMed	34529740
P0DTC9	TLPKGFYAEGSRGGS is a linear peptidic epitope (epitope ID 1542835) tested in 3 T cell assays, 10 B cell assays and 5 MHC ligand assays.	IEDB	1542835	166	180	TLPKGFYAEGSRGGS	ECO:0000213	PubMed	34529740
P0DTC9	TNSSPDDQIGYYRRA is a linear peptidic epitope (epitope ID 1542862) tested in 4 T cell assays, 10 B cell assays and 5 MHC ligand assays.	IEDB	1542862	76	90	TNSSPDDQIGYYRRA	ECO:0000213	PubMed	34529740
P0DTC9	VTPSGTWLTYTGAIK is a linear peptidic epitope (epitope ID 1543277) tested in 5 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1543277	324	338	VTPSGTWLTYTGAIK	ECO:0000213	PubMed	38105139
P0DTC9	FTALTQHGK is a linear peptidic epitope (epitope ID 1546637) tested in 6 T cell assays.	IEDB	1546637	53	61	FTALTQHGK	ECO:0000213	PubMed	34814158
P0DTC9	LIRQGTDYK is a linear peptidic epitope (epitope ID 1549605) tested in 2 T cell assays and 9 B cell assays.	IEDB	1549605	291	299	LIRQGTDYK	ECO:0000213	PubMed	34611361
P0DTC9	FYAEGSRGGSQASSR is a linear peptidic epitope (epitope ID 1597694) tested in 1 T cell assay, 8 B cell assays and 5 MHC ligand assays.	IEDB	1597694	171	185	FYAEGSRGGSQASSR	ECO:0000213	PubMed	34529740
P0DTC9	PANNAAIVLQLPQGT is a linear peptidic epitope (epitope ID 1597778) tested in 1 T cell assay, 14 B cell assays and 5 MHC ligand assays.	IEDB	1597778	151	165	PANNAAIVLQLPQGT	ECO:0000213	PubMed	34529740
P0DTC9	YYLGTGPEAGLPYGA is a linear peptidic epitope (epitope ID 1597865) tested in 2 T cell assays, 8 B cell assays and 6 MHC ligand assays.	IEDB	1597865	111	125	YYLGTGPEAGLPYGA	ECO:0000213	PubMed	34529740
P0DTC9	YYRRATRRIRG is a linear peptidic epitope (epitope ID 1597866) tested in 3 T cell assays.	IEDB	1597866	86	96	YYRRATRRIRG	ECO:0000213	PubMed	34529740
P0DTC9	LQQSMSSA is a linear peptidic epitope (epitope ID 1631492) tested in 1 T cell assay.	IEDB	1631492	407	414	LQQSMSSA	ECO:0000213	PubMed	34630356
P0DTC9	LLNKHIDAYK is a linear peptidic epitope (epitope ID 1676052) tested in 2 T cell assays and 2 MHC ligand assays.	IEDB	1676052	352	361	LLNKHIDAYK	ECO:0000213	PubMed	38117652
P0DTC9	NTPKDHIGTR is a linear peptidic epitope (epitope ID 1683924) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1683924	140	149	NTPKDHIGTR	ECO:0000213	PubMed	34728796
P0DTC9	NVTQAFGRR is a linear peptidic epitope (epitope ID 1684303) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1684303	269	277	NVTQAFGRR	ECO:0000213	PubMed	34728796
P0DTC9	QLQQSMSSA is a linear peptidic epitope (epitope ID 1688356) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1688356	406	414	QLQQSMSSA	ECO:0000213	PubMed	34728796
P0DTC9	QTVTLLPAA is a linear peptidic epitope (epitope ID 1689210) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1689210	390	398	QTVTLLPAA	ECO:0000213	PubMed	34728796
P0DTC9	TWLTYTGAI is a linear peptidic epitope (epitope ID 1701204) tested in 2 T cell assays.	IEDB	1701204	329	337	TWLTYTGAI	ECO:0000213	PubMed	34793243
P0DTC9	WLTYTGAIKL is a linear peptidic epitope (epitope ID 1707900) tested in 4 T cell assays and 4 MHC ligand assays.	IEDB	1707900	330	339	WLTYTGAIKL	ECO:0000213	PubMed	34728796
P0DTC9	WLTYTGAIKL is a linear peptidic epitope (epitope ID 1707900) tested in 4 T cell assays and 4 MHC ligand assays.	IEDB	1707900	330	339	WLTYTGAIKL	ECO:0000213	PubMed	35937077
P0DTC9	WLTYTGAIKL is a linear peptidic epitope (epitope ID 1707900) tested in 4 T cell assays and 4 MHC ligand assays.	IEDB	1707900	330	339	WLTYTGAIKL	ECO:0000213	PubMed	38105139
P0DTC9	DFSKQLQQ is a linear peptidic epitope (epitope ID 1862864) tested in 7 B cell assays.	IEDB	1862864	402	409	DFSKQLQQ	ECO:0000213	PubMed	35037999
P0DTC9	DLDDFSKQLQQ is a linear peptidic epitope (epitope ID 1862866) tested in 7 B cell assays.	IEDB	1862866	399	409	DLDDFSKQLQQ	ECO:0000213	PubMed	35037999
P0DTC9	AALALLLLDRLNQ is a linear peptidic epitope (epitope ID 1870863) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1870863	217	229	AALALLLLDRLNQ	ECO:0000213	PubMed	38117652
P0DTC9	TKAYNVTQAFGRR is a linear peptidic epitope (epitope ID 1873667) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1873667	265	277	TKAYNVTQAFGRR	ECO:0000213	PubMed	38117652
P0DTC9	GTTLPKG is a linear peptidic epitope (epitope ID 1965797) tested in 2 B cell assays.	IEDB	1965797	164	170	GTTLPKG	ECO:0000213	PubMed	35328398
P0DTC9	RSSSRSR is a linear peptidic epitope (epitope ID 1970335) tested in 2 B cell assays.	IEDB	1970335	185	191	RSSSRSR	ECO:0000213	PubMed	35328398
P0DTC9	TGPEAGLPYGANKDG is a linear peptidic epitope (epitope ID 2001332) tested in 6 B cell assays and 6 MHC ligand assays.	IEDB	2001332	115	129	TGPEAGLPYGANKDG	ECO:0000213	PubMed	38117652
P0DTC9	KDQVILLNKHIDAYK is a linear peptidic epitope (epitope ID 2122684) tested in 7 MHC ligand assays.	IEDB	2122684	347	361	KDQVILLNKHIDAYK	ECO:0000213	PubMed	38117652
P0DTC9	AYNVTQAFGRRGPEQ is a linear peptidic epitope (epitope ID 2131013) tested in 6 MHC ligand assays.	IEDB	2131013	267	281	AYNVTQAFGRRGPEQ	ECO:0000213	PubMed	38117652
P0DTC9	DQVILLNKHIDAY is a linear peptidic epitope (epitope ID 2131218) tested in 1 T cell assay.	IEDB	2131218	348	360	DQVILLNKHIDAY	ECO:0000213	PubMed	35486722
P0DTC9	LALLLLDRLNQLESK is a linear peptidic epitope (epitope ID 2132220) tested in 6 MHC ligand assays.	IEDB	2132220	219	233	LALLLLDRLNQLESK	ECO:0000213	PubMed	38117652
P0DTC9	TATKAYNVTQAFGRR is a linear peptidic epitope (epitope ID 2133319) tested in 6 MHC ligand assays.	IEDB	2133319	263	277	TATKAYNVTQAFGRR	ECO:0000213	PubMed	38117652
P0DTC9	AIKLDDKDP is a linear peptidic epitope (epitope ID 2133993) tested in 1 T cell assay.	IEDB	2133993	336	344	AIKLDDKDP	ECO:0000213	PubMed	34793243
P0DTC9	APSASAFFG is a linear peptidic epitope (epitope ID 2134008) tested in 1 T cell assay.	IEDB	2134008	308	316	APSASAFFG	ECO:0000213	PubMed	34793243
P0DTC9	DDKDPNFKD is a linear peptidic epitope (epitope ID 2134024) tested in 1 T cell assay.	IEDB	2134024	340	348	DDKDPNFKD	ECO:0000213	PubMed	34793243
P0DTC9	DKDPNFKDQ is a linear peptidic epitope (epitope ID 2134027) tested in 1 T cell assay.	IEDB	2134027	341	349	DKDPNFKDQ	ECO:0000213	PubMed	34793243
P0DTC9	DPNFKDQVI is a linear peptidic epitope (epitope ID 2134032) tested in 1 T cell assay.	IEDB	2134032	343	351	DPNFKDQVI	ECO:0000213	PubMed	34793243
P0DTC9	DQVILLNKH is a linear peptidic epitope (epitope ID 2134034) tested in 1 T cell assay.	IEDB	2134034	348	356	DQVILLNKH	ECO:0000213	PubMed	34793243
P0DTC9	DRLNQLESK is a linear peptidic epitope (epitope ID 2134035) tested in 1 T cell assay.	IEDB	2134035	225	233	DRLNQLESK	ECO:0000213	PubMed	34793243
P0DTC9	FKDQVILLN is a linear peptidic epitope (epitope ID 2134053) tested in 1 T cell assay.	IEDB	2134053	346	354	FKDQVILLN	ECO:0000213	PubMed	34793243
P0DTC9	GAIKLDDKD is a linear peptidic epitope (epitope ID 2134087) tested in 1 T cell assay.	IEDB	2134087	335	343	GAIKLDDKD	ECO:0000213	PubMed	34793243
P0DTC9	GDAALALLL is a linear peptidic epitope (epitope ID 2134089) tested in 1 T cell assay.	IEDB	2134089	215	223	GDAALALLL	ECO:0000213	PubMed	34793243
P0DTC9	IKLDDKDPN is a linear peptidic epitope (epitope ID 2134110) tested in 2 T cell assays.	IEDB	2134110	337	345	IKLDDKDPN	ECO:0000213	PubMed	34793243
P0DTC9	LDDKDPNFK is a linear peptidic epitope (epitope ID 2134153) tested in 1 T cell assay.	IEDB	2134153	339	347	LDDKDPNFK	ECO:0000213	PubMed	34793243
P0DTC9	LDRLNQLES is a linear peptidic epitope (epitope ID 2134156) tested in 1 T cell assay.	IEDB	2134156	224	232	LDRLNQLES	ECO:0000213	PubMed	34793243
P0DTC9	LLDRLNQLE is a linear peptidic epitope (epitope ID 2134160) tested in 1 T cell assay.	IEDB	2134160	223	231	LLDRLNQLE	ECO:0000213	PubMed	34793243
P0DTC9	LNKHIDAYK is a linear peptidic epitope (epitope ID 2134170) tested in 1 T cell assay.	IEDB	2134170	353	361	LNKHIDAYK	ECO:0000213	PubMed	34793243
P0DTC9	NPANNAAIV is a linear peptidic epitope (epitope ID 2134213) tested in 3 T cell assays.	IEDB	2134213	150	158	NPANNAAIV	ECO:0000213	PubMed	34793243
P0DTC9	QVILLNKHI is a linear peptidic epitope (epitope ID 2134244) tested in 1 T cell assay.	IEDB	2134244	349	357	QVILLNKHI	ECO:0000213	PubMed	34793243
P0DTC9	TGAIKLDDK is a linear peptidic epitope (epitope ID 2134294) tested in 1 T cell assay.	IEDB	2134294	334	342	TGAIKLDDK	ECO:0000213	PubMed	34793243
P0DTC9	WLTYTGAIK is a linear peptidic epitope (epitope ID 2134345) tested in 1 T cell assay.	IEDB	2134345	330	338	WLTYTGAIK	ECO:0000213	PubMed	34793243
P0DTC9	AYNVTQAF is a linear peptidic epitope (epitope ID 2150143) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	2150143	267	274	AYNVTQAF	ECO:0000213	PubMed	38866784
P0DTC9	TKAYNVTQAF is a linear peptidic epitope (epitope ID 2150214) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	2150214	265	274	TKAYNVTQAF	ECO:0000213	PubMed	38866784
P0DTC9	DAALALLLL is a linear peptidic epitope (epitope ID 2157663) tested in 3 T cell assays and 1 B cell assay.	IEDB	2157663	216	224	DAALALLLL	ECO:0000213	PubMed	39591116
P0DTC9	NNAAIVLQL is a linear peptidic epitope (epitope ID 2157720) tested in 3 T cell assays and 1 B cell assay.	IEDB	2157720	153	161	NNAAIVLQL	ECO:0000213	PubMed	39591116
P0DTC9	AALALLLLDRLNQL is a linear peptidic epitope (epitope ID 2157770) tested in 1 T cell assay and 4 B cell assays.	IEDB	2157770	217	230	AALALLLLDRLNQL	ECO:0000213	PubMed	36238992
P0DTC9	ETQALPQRQKKQQ is a linear peptidic epitope (epitope ID 2218331) tested in 4 B cell assays.	IEDB	2218331	378	390	ETQALPQRQKKQQ	ECO:0000213	PubMed	37112903
P0DTC9	RGPEQTQGNFG is a linear peptidic epitope (epitope ID 2218398) tested in 4 B cell assays.	IEDB	2218398	277	287	RGPEQTQGNFG	ECO:0000213	PubMed	37112903
P0DTC9	RSSSRSRNSSRNS is a linear peptidic epitope (epitope ID 2218404) tested in 4 B cell assays.	IEDB	2218404	185	197	RSSSRSRNSSRNS	ECO:0000213	PubMed	37112903
P0DTC9	ASWFTALTQHGKED is a linear peptidic epitope (epitope ID 2243419) tested in 3 B cell assays and 2 MHC ligand assays.	IEDB	2243419	50	63	ASWFTALTQHGKED	ECO:0000213	PubMed	38117652
P0DTC9	KDLSPRWYFY is a linear peptidic epitope (epitope ID 2243461) tested in 3 B cell assays.	IEDB	2243461	102	111	KDLSPRWYFY	ECO:0000213	PubMed	37766081
P0DTC9	ALALLLLDRLNQLE is a linear peptidic epitope (epitope ID 2249307) tested in 1 MHC ligand assay.	IEDB	2249307	218	231	ALALLLLDRLNQLE	ECO:0000213	PubMed	38117652
P0DTC9	ALLLLDRLNQLESK is a linear peptidic epitope (epitope ID 2249327) tested in 1 MHC ligand assay.	IEDB	2249327	220	233	ALLLLDRLNQLESK	ECO:0000213	PubMed	38117652
P0DTC9	ATKAYNVTQAFGRR is a linear peptidic epitope (epitope ID 2249410) tested in 1 MHC ligand assay.	IEDB	2249410	264	277	ATKAYNVTQAFGRR	ECO:0000213	PubMed	38117652
P0DTC9	AYNVTQAFGRRGP is a linear peptidic epitope (epitope ID 2249467) tested in 1 MHC ligand assay.	IEDB	2249467	267	279	AYNVTQAFGRRGP	ECO:0000213	PubMed	38117652
P0DTC9	DQVILLNKHIDAYK is a linear peptidic epitope (epitope ID 2249661) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	2249661	348	361	DQVILLNKHIDAYK	ECO:0000213	PubMed	38105139
P0DTC9	DQVILLNKHIDAYK is a linear peptidic epitope (epitope ID 2249661) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	2249661	348	361	DQVILLNKHIDAYK	ECO:0000213	PubMed	38117652
P0DTC9	IAQFAPSASAFFG is a linear peptidic epitope (epitope ID 2250439) tested in 1 MHC ligand assay.	IEDB	2250439	304	316	IAQFAPSASAFFG	ECO:0000213	PubMed	38117652
P0DTC9	ILLNKHIDAYK is a linear peptidic epitope (epitope ID 2250531) tested in 1 MHC ligand assay.	IEDB	2250531	351	361	ILLNKHIDAYK	ECO:0000213	PubMed	38117652
P0DTC9	KAYNVTQAFGRRG is a linear peptidic epitope (epitope ID 2250630) tested in 1 MHC ligand assay.	IEDB	2250630	266	278	KAYNVTQAFGRRG	ECO:0000213	PubMed	38117652
P0DTC9	KAYNVTQAFGRRGP is a linear peptidic epitope (epitope ID 2250631) tested in 1 MHC ligand assay.	IEDB	2250631	266	279	KAYNVTQAFGRRGP	ECO:0000213	PubMed	38117652
P0DTC9	KDQVILLNKHIDA is a linear peptidic epitope (epitope ID 2250644) tested in 1 MHC ligand assay.	IEDB	2250644	347	359	KDQVILLNKHIDA	ECO:0000213	PubMed	38117652
P0DTC9	KDQVILLNKHIDAY is a linear peptidic epitope (epitope ID 2250645) tested in 1 MHC ligand assay.	IEDB	2250645	347	360	KDQVILLNKHIDAY	ECO:0000213	PubMed	38117652
P0DTC9	LTYTGAIKLDDK is a linear peptidic epitope (epitope ID 2251131) tested in 1 MHC ligand assay.	IEDB	2251131	331	342	LTYTGAIKLDDK	ECO:0000213	PubMed	38117652
P0DTC9	NPANNAAIVLQ is a linear peptidic epitope (epitope ID 2251382) tested in 1 MHC ligand assay.	IEDB	2251382	150	160	NPANNAAIVLQ	ECO:0000213	PubMed	38117652
P0DTC9	NPANNAAIVLQLPQ is a linear peptidic epitope (epitope ID 2251383) tested in 1 MHC ligand assay.	IEDB	2251383	150	163	NPANNAAIVLQLPQ	ECO:0000213	PubMed	38117652
P0DTC9	NVTQAFGRRGPEQ is a linear peptidic epitope (epitope ID 2251428) tested in 1 MHC ligand assay.	IEDB	2251428	269	281	NVTQAFGRRGPEQ	ECO:0000213	PubMed	38117652
P0DTC9	PANNAAIVLQLPQ is a linear peptidic epitope (epitope ID 2251443) tested in 1 MHC ligand assay.	IEDB	2251443	151	163	PANNAAIVLQLPQ	ECO:0000213	PubMed	38117652
P0DTC9	PANNAAIVLQLPQG is a linear peptidic epitope (epitope ID 2251444) tested in 1 MHC ligand assay.	IEDB	2251444	151	164	PANNAAIVLQLPQG	ECO:0000213	PubMed	38117652
P0DTC9	PNFKDQVILL is a linear peptidic epitope (epitope ID 2251514) tested in 1 T cell assay.	IEDB	2251514	344	353	PNFKDQVILL	ECO:0000213	PubMed	38105139
P0DTC9	QAFGRRGPEQ is a linear peptidic epitope (epitope ID 2251584) tested in 1 MHC ligand assay.	IEDB	2251584	272	281	QAFGRRGPEQ	ECO:0000213	PubMed	38117652
P0DTC9	QKKQQTVTLLPAAD is a linear peptidic epitope (epitope ID 2251613) tested in 1 MHC ligand assay.	IEDB	2251613	386	399	QKKQQTVTLLPAAD	ECO:0000213	PubMed	38117652
P0DTC9	TGPEAGLPYGANKD is a linear peptidic epitope (epitope ID 2252239) tested in 1 T cell assay.	IEDB	2252239	115	128	TGPEAGLPYGANKD	ECO:0000213	PubMed	38105139
P0DTC9	TKAYNVTQAFGRRG is a linear peptidic epitope (epitope ID 2252260) tested in 1 MHC ligand assay.	IEDB	2252260	265	278	TKAYNVTQAFGRRG	ECO:0000213	PubMed	38117652
P0DTC9	TQAFGRRGP is a linear peptidic epitope (epitope ID 2252331) tested in 1 MHC ligand assay.	IEDB	2252331	271	279	TQAFGRRGP	ECO:0000213	PubMed	38117652
P0DTC9	TQAFGRRGPE is a linear peptidic epitope (epitope ID 2252332) tested in 1 MHC ligand assay.	IEDB	2252332	271	280	TQAFGRRGPE	ECO:0000213	PubMed	38117652
P0DTC9	TQAFGRRGPEQ is a linear peptidic epitope (epitope ID 2252333) tested in 1 MHC ligand assay.	IEDB	2252333	271	281	TQAFGRRGPEQ	ECO:0000213	PubMed	38117652
P0DTC9	TYTGAIKLDDK is a linear peptidic epitope (epitope ID 2252427) tested in 1 MHC ligand assay.	IEDB	2252427	332	342	TYTGAIKLDDK	ECO:0000213	PubMed	38117652
P0DTC9	VTQAFGRRGP is a linear peptidic epitope (epitope ID 2252667) tested in 1 MHC ligand assay.	IEDB	2252667	270	279	VTQAFGRRGP	ECO:0000213	PubMed	38117652
P0DTC9	VTQAFGRRGPE is a linear peptidic epitope (epitope ID 2252668) tested in 1 MHC ligand assay.	IEDB	2252668	270	280	VTQAFGRRGPE	ECO:0000213	PubMed	38117652
P0DTC9	WLTYTGAIKLDDK is a linear peptidic epitope (epitope ID 2252774) tested in 1 MHC ligand assay.	IEDB	2252774	330	342	WLTYTGAIKLDDK	ECO:0000213	PubMed	38117652
P0DTC9	YTGAIKLDDKD is a linear peptidic epitope (epitope ID 2252883) tested in 1 MHC ligand assay.	IEDB	2252883	333	343	YTGAIKLDDKD	ECO:0000213	PubMed	38117652
P0DTC9	ADLDDFSKQL is a linear peptidic epitope (epitope ID 2259112) tested in 1 T cell assay.	IEDB	2259112	398	407	ADLDDFSKQL	ECO:0000213	PubMed	38781962
P0DTC9	LTYTGAIKL is a linear peptidic epitope (epitope ID 2269209) tested in 1 T cell assay and 1 B cell assay.	IEDB	2269209	331	339	LTYTGAIKL	ECO:0000213	PubMed	39591116
P0DTD1	AAISDYDYY is a linear peptidic epitope (epitope ID 234) tested in 1 T cell assay and 5 MHC ligand assays.	IEDB	234	4840	4848	AAISDYDYY	ECO:0000213	PubMed	33853928
P0DTD1	AIILASFSA is a linear peptidic epitope (epitope ID 1946) tested in 1 T cell assay and 10 MHC ligand assays.	IEDB	1946	474	482	AIILASFSA	ECO:0000213	PubMed	34793243
P0DTD1	AIMTRCLAV is a linear peptidic epitope (epitope ID 2027) tested in 3 T cell assays and 10 MHC ligand assays.	IEDB	2027	6199	6207	AIMTRCLAV	ECO:0000213	PubMed	34793243
P0DTD1	AISDYDYYR is a linear peptidic epitope (epitope ID 2077) tested in 2 T cell assays and 7 MHC ligand assays.	IEDB	2077	4841	4849	AISDYDYYR	ECO:0000213	PubMed	34728796
P0DTD1	ALLADKFPV is a linear peptidic epitope (epitope ID 2682) tested in 4 T cell assays and 10 MHC ligand assays.	IEDB	2682	6245	6253	ALLADKFPV	ECO:0000213	PubMed	34793243
P0DTD1	ALLADKFPV is a linear peptidic epitope (epitope ID 2682) tested in 4 T cell assays and 10 MHC ligand assays.	IEDB	2682	6245	6253	ALLADKFPV	ECO:0000213	PubMed	33853928
P0DTD1	ALWEIQQVV is a linear peptidic epitope (epitope ID 2998) tested in 35 T cell assays and 35 MHC ligand assays.	IEDB	2998	4094	4102	ALWEIQQVV	ECO:0000213	PubMed	34793243
P0DTD1	ALWEIQQVV is a linear peptidic epitope (epitope ID 2998) tested in 35 T cell assays and 35 MHC ligand assays.	IEDB	2998	4094	4102	ALWEIQQVV	ECO:0000213	PubMed	36151076
P0DTD1	ALWEIQQVV is a linear peptidic epitope (epitope ID 2998) tested in 35 T cell assays and 35 MHC ligand assays.	IEDB	2998	4094	4102	ALWEIQQVV	ECO:0000213	PubMed	36494499
P0DTD1	ALWEIQQVV is a linear peptidic epitope (epitope ID 2998) tested in 35 T cell assays and 35 MHC ligand assays.	IEDB	2998	4094	4102	ALWEIQQVV	ECO:0000213	PubMed	36691482
P0DTD1	ALWEIQQVV is a linear peptidic epitope (epitope ID 2998) tested in 35 T cell assays and 35 MHC ligand assays.	IEDB	2998	4094	4102	ALWEIQQVV	ECO:0000213	PubMed	33128877
P0DTD1	ALWEIQQVV is a linear peptidic epitope (epitope ID 2998) tested in 35 T cell assays and 35 MHC ligand assays.	IEDB	2998	4094	4102	ALWEIQQVV	ECO:0000213	PubMed	33427749
P0DTD1	ALWEIQQVV is a linear peptidic epitope (epitope ID 2998) tested in 35 T cell assays and 35 MHC ligand assays.	IEDB	2998	4094	4102	ALWEIQQVV	ECO:0000213	PubMed	33853928
P0DTD1	AMQTMLFTM is a linear peptidic epitope (epitope ID 3179) tested in 2 T cell assays and 10 MHC ligand assays.	IEDB	3179	4028	4036	AMQTMLFTM	ECO:0000213	PubMed	34793243
P0DTD1	AMYTPHTVL is a linear peptidic epitope (epitope ID 3217) tested in 3 T cell assays and 7 MHC ligand assays.	IEDB	3217	5315	5323	AMYTPHTVL	ECO:0000213	PubMed	37390223
P0DTD1	APLLSAGIF is a linear peptidic epitope (epitope ID 3643) tested in 2 T cell assays and 5 MHC ligand assays.	IEDB	3643	1146	1154	APLLSAGIF	ECO:0000213	PubMed	34793243
P0DTD1	ASGNLLLDK is a linear peptidic epitope (epitope ID 4428) tested in 2 T cell assays and 6 MHC ligand assays.	IEDB	4428	4775	4783	ASGNLLLDK	ECO:0000213	PubMed	34728796
P0DTD1	AWPLIVTAL is a linear peptidic epitope (epitope ID 5686) tested in 1 T cell assay and 8 MHC ligand assays.	IEDB	5686	4123	4131	AWPLIVTAL	ECO:0000213	PubMed	33853928
P0DTD1	CTDDNALAY is a linear peptidic epitope (epitope ID 7121) tested in 14 T cell assays and 31 MHC ligand assays.	IEDB	7121	4163	4171	CTDDNALAY	ECO:0000213	PubMed	34793243
P0DTD1	CTDDNALAY is a linear peptidic epitope (epitope ID 7121) tested in 14 T cell assays and 31 MHC ligand assays.	IEDB	7121	4163	4171	CTDDNALAY	ECO:0000213	PubMed	35104433
P0DTD1	CTDDNALAY is a linear peptidic epitope (epitope ID 7121) tested in 14 T cell assays and 31 MHC ligand assays.	IEDB	7121	4163	4171	CTDDNALAY	ECO:0000213	PubMed	36151076
P0DTD1	CTDDNALAY is a linear peptidic epitope (epitope ID 7121) tested in 14 T cell assays and 31 MHC ligand assays.	IEDB	7121	4163	4171	CTDDNALAY	ECO:0000213	PubMed	33184509
P0DTD1	CTDDNALAYY is a linear peptidic epitope (epitope ID 7122) tested in 27 T cell assays and 7 MHC ligand assays.	IEDB	7122	4163	4172	CTDDNALAYY	ECO:0000213	PubMed	36151076
P0DTD1	CTDDNALAYY is a linear peptidic epitope (epitope ID 7122) tested in 27 T cell assays and 7 MHC ligand assays.	IEDB	7122	4163	4172	CTDDNALAYY	ECO:0000213	PubMed	36691482
P0DTD1	CTDDNALAYY is a linear peptidic epitope (epitope ID 7122) tested in 27 T cell assays and 7 MHC ligand assays.	IEDB	7122	4163	4172	CTDDNALAYY	ECO:0000213	PubMed	33128877
P0DTD1	CTDDNALAYY is a linear peptidic epitope (epitope ID 7122) tested in 27 T cell assays and 7 MHC ligand assays.	IEDB	7122	4163	4172	CTDDNALAYY	ECO:0000213	PubMed	33184509
P0DTD1	CTDDNALAYY is a linear peptidic epitope (epitope ID 7122) tested in 27 T cell assays and 7 MHC ligand assays.	IEDB	7122	4163	4172	CTDDNALAYY	ECO:0000213	PubMed	33972535
P0DTD1	CTDDNALAYY is a linear peptidic epitope (epitope ID 7122) tested in 27 T cell assays and 7 MHC ligand assays.	IEDB	7122	4163	4172	CTDDNALAYY	ECO:0000213	PubMed	33853928
P0DTD1	EEAIRHVRAW is a linear peptidic epitope (epitope ID 11499) tested in 3 T cell assays and 6 MHC ligand assays.	IEDB	11499	6002	6011	EEAIRHVRAW	ECO:0000213	PubMed	33184509
P0DTD1	EYADVFHLYL is a linear peptidic epitope (epitope ID 14969) tested in 7 T cell assays and 9 MHC ligand assays.	IEDB	14969	5268	5277	EYADVFHLYL	ECO:0000213	PubMed	36603583
P0DTD1	FLGRYMSAL is a linear peptidic epitope (epitope ID 16632) tested in 4 T cell assays and 11 MHC ligand assays.	IEDB	16632	1642	1650	FLGRYMSAL	ECO:0000213	PubMed	34793243
P0DTD1	FLGRYMSAL is a linear peptidic epitope (epitope ID 16632) tested in 4 T cell assays and 11 MHC ligand assays.	IEDB	16632	1642	1650	FLGRYMSAL	ECO:0000213	PubMed	37193826
P0DTD1	FLLNKEMYL is a linear peptidic epitope (epitope ID 16737) tested in 31 T cell assays and 16 MHC ligand assays.	IEDB	16737	3183	3191	FLLNKEMYL	ECO:0000213	PubMed	34793243
P0DTD1	FLLNKEMYL is a linear peptidic epitope (epitope ID 16737) tested in 31 T cell assays and 16 MHC ligand assays.	IEDB	16737	3183	3191	FLLNKEMYL	ECO:0000213	PubMed	36691482
P0DTD1	FLLNKEMYL is a linear peptidic epitope (epitope ID 16737) tested in 31 T cell assays and 16 MHC ligand assays.	IEDB	16737	3183	3191	FLLNKEMYL	ECO:0000213	PubMed	33911008
P0DTD1	FLLNKEMYL is a linear peptidic epitope (epitope ID 16737) tested in 31 T cell assays and 16 MHC ligand assays.	IEDB	16737	3183	3191	FLLNKEMYL	ECO:0000213	PubMed	32913053
P0DTD1	FLLPSLATV is a linear peptidic epitope (epitope ID 16743) tested in 16 T cell assays and 16 MHC ligand assays.	IEDB	16743	3639	3647	FLLPSLATV	ECO:0000213	PubMed	34793243
P0DTD1	FLLPSLATV is a linear peptidic epitope (epitope ID 16743) tested in 16 T cell assays and 16 MHC ligand assays.	IEDB	16743	3639	3647	FLLPSLATV	ECO:0000213	PubMed	33184509
P0DTD1	FLLPSLATV is a linear peptidic epitope (epitope ID 16743) tested in 16 T cell assays and 16 MHC ligand assays.	IEDB	16743	3639	3647	FLLPSLATV	ECO:0000213	PubMed	32791978
P0DTD1	FLNGSCGSV is a linear peptidic epitope (epitope ID 16779) tested in 6 T cell assays and 11 MHC ligand assays.	IEDB	16779	3403	3411	FLNGSCGSV	ECO:0000213	PubMed	34793243
P0DTD1	FLNRFTTTL is a linear peptidic epitope (epitope ID 16786) tested in 20 T cell assays and 13 MHC ligand assays.	IEDB	16786	3482	3490	FLNRFTTTL	ECO:0000213	PubMed	34793243
P0DTD1	FLNRFTTTL is a linear peptidic epitope (epitope ID 16786) tested in 20 T cell assays and 13 MHC ligand assays.	IEDB	16786	3482	3490	FLNRFTTTL	ECO:0000213	PubMed	35104433
P0DTD1	FLPRVFSAV is a linear peptidic epitope (epitope ID 16820) tested in 13 T cell assays and 11 MHC ligand assays.	IEDB	16820	2884	2892	FLPRVFSAV	ECO:0000213	PubMed	34793243
P0DTD1	FLPRVFSAV is a linear peptidic epitope (epitope ID 16820) tested in 13 T cell assays and 11 MHC ligand assays.	IEDB	16820	2884	2892	FLPRVFSAV	ECO:0000213	PubMed	33853928
P0DTD1	FPLKLRGTAV is a linear peptidic epitope (epitope ID 17330) tested in 1 T cell assay and 5 MHC ligand assays.	IEDB	17330	7048	7057	FPLKLRGTAV	ECO:0000213	PubMed	33853928
P0DTD1	FSAVGNICY is a linear peptidic epitope (epitope ID 17675) tested in 2 T cell assays and 7 MHC ligand assays.	IEDB	17675	2889	2897	FSAVGNICY	ECO:0000213	PubMed	33853928
P0DTD1	FTDGVCLFW is a linear peptidic epitope (epitope ID 17921) tested in 1 T cell assay and 21 MHC ligand assays.	IEDB	17921	6302	6310	FTDGVCLFW	ECO:0000213	PubMed	33853928
P0DTD1	FVDGVPFVV is a linear peptidic epitope (epitope ID 18133) tested in 21 T cell assays and 32 MHC ligand assays.	IEDB	18133	4726	4734	FVDGVPFVV	ECO:0000213	PubMed	34793243
P0DTD1	FVDGVPFVV is a linear peptidic epitope (epitope ID 18133) tested in 21 T cell assays and 32 MHC ligand assays.	IEDB	18133	4726	4734	FVDGVPFVV	ECO:0000213	PubMed	34919800
P0DTD1	FVDGVPFVV is a linear peptidic epitope (epitope ID 18133) tested in 21 T cell assays and 32 MHC ligand assays.	IEDB	18133	4726	4734	FVDGVPFVV	ECO:0000213	PubMed	35196796
P0DTD1	FVDGVPFVV is a linear peptidic epitope (epitope ID 18133) tested in 21 T cell assays and 32 MHC ligand assays.	IEDB	18133	4726	4734	FVDGVPFVV	ECO:0000213	PubMed	33853928
P0DTD1	FYAYLRKHF is a linear peptidic epitope (epitope ID 18375) tested in 5 T cell assays and 6 MHC ligand assays.	IEDB	18375	5137	5145	FYAYLRKHF	ECO:0000213	PubMed	33853928
P0DTD1	GPKVKYLYF is a linear peptidic epitope (epitope ID 21680) tested in 1 T cell assay and 5 MHC ligand assays.	IEDB	21680	4222	4230	GPKVKYLYF	ECO:0000213	PubMed	33853928
P0DTD1	GTSTDVVYR is a linear peptidic epitope (epitope ID 22846) tested in 3 T cell assays and 7 MHC ligand assays.	IEDB	22846	4417	4425	GTSTDVVYR	ECO:0000213	PubMed	34728796
P0DTD1	GVYDYLVST is a linear peptidic epitope (epitope ID 23215) tested in 3 T cell assays and 10 MHC ligand assays.	IEDB	23215	3809	3817	GVYDYLVST	ECO:0000213	PubMed	34793243
P0DTD1	GVYDYLVST is a linear peptidic epitope (epitope ID 23215) tested in 3 T cell assays and 10 MHC ligand assays.	IEDB	23215	3809	3817	GVYDYLVST	ECO:0000213	PubMed	33853928
P0DTD1	HFISNSWLM is a linear peptidic epitope (epitope ID 23789) tested in 1 T cell assay and 6 MHC ligand assays.	IEDB	23789	2357	2365	HFISNSWLM	ECO:0000213	PubMed	34793243
P0DTD1	ILGLPTQTV is a linear peptidic epitope (epitope ID 27078) tested in 4 T cell assays and 22 MHC ligand assays.	IEDB	27078	5849	5857	ILGLPTQTV	ECO:0000213	PubMed	34793243
P0DTD1	ILGLPTQTV is a linear peptidic epitope (epitope ID 27078) tested in 4 T cell assays and 22 MHC ligand assays.	IEDB	27078	5849	5857	ILGLPTQTV	ECO:0000213	PubMed	33853928
P0DTD1	ILHCANFNV is a linear peptidic epitope (epitope ID 27089) tested in 4 T cell assays and 36 MHC ligand assays.	IEDB	27089	4699	4707	ILHCANFNV	ECO:0000213	PubMed	34728796
P0DTD1	ILHCANFNV is a linear peptidic epitope (epitope ID 27089) tested in 4 T cell assays and 36 MHC ligand assays.	IEDB	27089	4699	4707	ILHCANFNV	ECO:0000213	PubMed	35937077
P0DTD1	IPLTTAAKL is a linear peptidic epitope (epitope ID 27944) tested in 2 T cell assays and 5 MHC ligand assays.	IEDB	27944	4062	4070	IPLTTAAKL	ECO:0000213	PubMed	34793243
P0DTD1	IPRRNVATL is a linear peptidic epitope (epitope ID 28050) tested in 18 T cell assays and 30 MHC ligand assays.	IEDB	28050	5916	5924	IPRRNVATL	ECO:0000213	PubMed	34793243
P0DTD1	IPRRNVATL is a linear peptidic epitope (epitope ID 28050) tested in 18 T cell assays and 30 MHC ligand assays.	IEDB	28050	5916	5924	IPRRNVATL	ECO:0000213	PubMed	35484232
P0DTD1	IPRRNVATL is a linear peptidic epitope (epitope ID 28050) tested in 18 T cell assays and 30 MHC ligand assays.	IEDB	28050	5916	5924	IPRRNVATL	ECO:0000213	PubMed	36254196
P0DTD1	IPRRNVATL is a linear peptidic epitope (epitope ID 28050) tested in 18 T cell assays and 30 MHC ligand assays.	IEDB	28050	5916	5924	IPRRNVATL	ECO:0000213	PubMed	33128877
P0DTD1	IPRRNVATL is a linear peptidic epitope (epitope ID 28050) tested in 18 T cell assays and 30 MHC ligand assays.	IEDB	28050	5916	5924	IPRRNVATL	ECO:0000213	PubMed	33184509
P0DTD1	IPRRNVATL is a linear peptidic epitope (epitope ID 28050) tested in 18 T cell assays and 30 MHC ligand assays.	IEDB	28050	5916	5924	IPRRNVATL	ECO:0000213	PubMed	33972535
P0DTD1	IPRRNVATL is a linear peptidic epitope (epitope ID 28050) tested in 18 T cell assays and 30 MHC ligand assays.	IEDB	28050	5916	5924	IPRRNVATL	ECO:0000213	PubMed	33427749
P0DTD1	IPRRNVATL is a linear peptidic epitope (epitope ID 28050) tested in 18 T cell assays and 30 MHC ligand assays.	IEDB	28050	5916	5924	IPRRNVATL	ECO:0000213	PubMed	33853928
P0DTD1	IPTITQMNL is a linear peptidic epitope (epitope ID 28087) tested in 4 T cell assays and 8 MHC ligand assays.	IEDB	28087	4928	4936	IPTITQMNL	ECO:0000213	PubMed	34793243
P0DTD1	IPTITQMNL is a linear peptidic epitope (epitope ID 28087) tested in 4 T cell assays and 8 MHC ligand assays.	IEDB	28087	4928	4936	IPTITQMNL	ECO:0000213	PubMed	33853928
P0DTD1	IQPGQTFSV is a linear peptidic epitope (epitope ID 28199) tested in 2 T cell assays and 10 MHC ligand assays.	IEDB	28199	3369	3377	IQPGQTFSV	ECO:0000213	PubMed	34793243
P0DTD1	ISDYDYYRY is a linear peptidic epitope (epitope ID 28464) tested in 5 T cell assays and 30 MHC ligand assays.	IEDB	28464	4842	4850	ISDYDYYRY	ECO:0000213	PubMed	34793243
P0DTD1	IVDTVSALV is a linear peptidic epitope (epitope ID 29237) tested in 3 T cell assays and 10 MHC ligand assays.	IEDB	29237	5772	5780	IVDTVSALV	ECO:0000213	PubMed	34793243
P0DTD1	IVDTVSALVY is a linear peptidic epitope (epitope ID 29238) tested in 16 T cell assays and 9 MHC ligand assays.	IEDB	29238	5772	5781	IVDTVSALVY	ECO:0000213	PubMed	34312620
P0DTD1	IVDTVSALVY is a linear peptidic epitope (epitope ID 29238) tested in 16 T cell assays and 9 MHC ligand assays.	IEDB	29238	5772	5781	IVDTVSALVY	ECO:0000213	PubMed	34725257
P0DTD1	KGFFKEGSSVELKHF is a linear peptidic epitope (epitope ID 30926) tested in 6 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	30926	4818	4832	KGFFKEGSSVELKHF	ECO:0000213	PubMed	37215095
P0DTD1	KIEELFYSY is a linear peptidic epitope (epitope ID 31216) tested in 1 T cell assay and 7 MHC ligand assays.	IEDB	31216	6287	6295	KIEELFYSY	ECO:0000213	PubMed	33853928
P0DTD1	KLFAAETLK is a linear peptidic epitope (epitope ID 31833) tested in 21 T cell assays and 33 MHC ligand assays.	IEDB	31833	5455	5463	KLFAAETLK	ECO:0000213	PubMed	34312620
P0DTD1	KLFAAETLK is a linear peptidic epitope (epitope ID 31833) tested in 21 T cell assays and 33 MHC ligand assays.	IEDB	31833	5455	5463	KLFAAETLK	ECO:0000213	PubMed	34725257
P0DTD1	KLFAAETLK is a linear peptidic epitope (epitope ID 31833) tested in 21 T cell assays and 33 MHC ligand assays.	IEDB	31833	5455	5463	KLFAAETLK	ECO:0000213	PubMed	32999467
P0DTD1	KLNVGDYFV is a linear peptidic epitope (epitope ID 32060) tested in 5 T cell assays and 10 MHC ligand assays.	IEDB	32060	5542	5550	KLNVGDYFV	ECO:0000213	PubMed	34793243
P0DTD1	KLNVGDYFV is a linear peptidic epitope (epitope ID 32060) tested in 5 T cell assays and 10 MHC ligand assays.	IEDB	32060	5542	5550	KLNVGDYFV	ECO:0000213	PubMed	33853928
P0DTD1	KLSYGIATV is a linear peptidic epitope (epitope ID 32183) tested in 18 T cell assays and 12 MHC ligand assays.	IEDB	32183	5470	5478	KLSYGIATV	ECO:0000213	PubMed	34793243
P0DTD1	KLSYGIATV is a linear peptidic epitope (epitope ID 32183) tested in 18 T cell assays and 12 MHC ligand assays.	IEDB	32183	5470	5478	KLSYGIATV	ECO:0000213	PubMed	38605956
P0DTD1	KLSYGIATV is a linear peptidic epitope (epitope ID 32183) tested in 18 T cell assays and 12 MHC ligand assays.	IEDB	32183	5470	5478	KLSYGIATV	ECO:0000213	PubMed	33911008
P0DTD1	KLSYGIATV is a linear peptidic epitope (epitope ID 32183) tested in 18 T cell assays and 12 MHC ligand assays.	IEDB	32183	5470	5478	KLSYGIATV	ECO:0000213	PubMed	33853928
P0DTD1	KLWAQCVQL is a linear peptidic epitope (epitope ID 32240) tested in 44 T cell assays and 34 MHC ligand assays.	IEDB	32240	3886	3894	KLWAQCVQL	ECO:0000213	PubMed	34793243
P0DTD1	KLWAQCVQL is a linear peptidic epitope (epitope ID 32240) tested in 44 T cell assays and 34 MHC ligand assays.	IEDB	32240	3886	3894	KLWAQCVQL	ECO:0000213	PubMed	34968416
P0DTD1	KLWAQCVQL is a linear peptidic epitope (epitope ID 32240) tested in 44 T cell assays and 34 MHC ligand assays.	IEDB	32240	3886	3894	KLWAQCVQL	ECO:0000213	PubMed	36494499
P0DTD1	KLWAQCVQL is a linear peptidic epitope (epitope ID 32240) tested in 44 T cell assays and 34 MHC ligand assays.	IEDB	32240	3886	3894	KLWAQCVQL	ECO:0000213	PubMed	36691482
P0DTD1	KLWAQCVQL is a linear peptidic epitope (epitope ID 32240) tested in 44 T cell assays and 34 MHC ligand assays.	IEDB	32240	3886	3894	KLWAQCVQL	ECO:0000213	PubMed	33128877
P0DTD1	KLWAQCVQL is a linear peptidic epitope (epitope ID 32240) tested in 44 T cell assays and 34 MHC ligand assays.	IEDB	32240	3886	3894	KLWAQCVQL	ECO:0000213	PubMed	34758478
P0DTD1	KLWAQCVQL is a linear peptidic epitope (epitope ID 32240) tested in 44 T cell assays and 34 MHC ligand assays.	IEDB	32240	3886	3894	KLWAQCVQL	ECO:0000213	PubMed	33853928
P0DTD1	KQFDTYNLW is a linear peptidic epitope (epitope ID 32976) tested in 5 T cell assays and 22 MHC ligand assays.	IEDB	32976	6437	6445	KQFDTYNLW	ECO:0000213	PubMed	35389886
P0DTD1	KQFDTYNLW is a linear peptidic epitope (epitope ID 32976) tested in 5 T cell assays and 22 MHC ligand assays.	IEDB	32976	6437	6445	KQFDTYNLW	ECO:0000213	PubMed	33853928
P0DTD1	KSAGFPFNK is a linear peptidic epitope (epitope ID 33269) tested in 6 T cell assays and 12 MHC ligand assays.	IEDB	33269	4892	4900	KSAGFPFNK	ECO:0000213	PubMed	34728796
P0DTD1	KSAGFPFNK is a linear peptidic epitope (epitope ID 33269) tested in 6 T cell assays and 12 MHC ligand assays.	IEDB	33269	4892	4900	KSAGFPFNK	ECO:0000213	PubMed	35104433
P0DTD1	KTNCCRFQEK is a linear peptidic epitope (epitope ID 33781) tested in 1 T cell assay and 7 MHC ligand assays.	IEDB	33781	4442	4451	KTNCCRFQEK	ECO:0000213	PubMed	34728796
P0DTD1	LDAYNMMISAGFSLW is a linear peptidic epitope (epitope ID 35122) tested in 12 T cell assays, 4 B cell assays, 8 MHC ligand assays and has 3D structure(s) 8cmg.	IEDB	35122	6420	6434	LDAYNMMISAGFSLW	ECO:0000213	PubMed	38605956
P0DTD1	LDAYNMMISAGFSLW is a linear peptidic epitope (epitope ID 35122) tested in 12 T cell assays, 4 B cell assays, 8 MHC ligand assays and has 3D structure(s) 8cmg.	IEDB	35122	6420	6434	LDAYNMMISAGFSLW	ECO:0000213	PubMed	33911008
P0DTD1	LLDDFVEII is a linear peptidic epitope (epitope ID 37144) tested in 3 T cell assays and 10 MHC ligand assays.	IEDB	37144	6750	6758	LLDDFVEII	ECO:0000213	PubMed	34506741
P0DTD1	LLDDFVEII is a linear peptidic epitope (epitope ID 37144) tested in 3 T cell assays and 10 MHC ligand assays.	IEDB	37144	6750	6758	LLDDFVEII	ECO:0000213	PubMed	34793243
P0DTD1	LLLDDFVEI is a linear peptidic epitope (epitope ID 37468) tested in 13 T cell assays and 13 MHC ligand assays.	IEDB	37468	6749	6757	LLLDDFVEI	ECO:0000213	PubMed	34506741
P0DTD1	LLLDDFVEI is a linear peptidic epitope (epitope ID 37468) tested in 13 T cell assays and 13 MHC ligand assays.	IEDB	37468	6749	6757	LLLDDFVEI	ECO:0000213	PubMed	34793243
P0DTD1	LLLDDFVEI is a linear peptidic epitope (epitope ID 37468) tested in 13 T cell assays and 13 MHC ligand assays.	IEDB	37468	6749	6757	LLLDDFVEI	ECO:0000213	PubMed	38605956
P0DTD1	LLLDDFVEI is a linear peptidic epitope (epitope ID 37468) tested in 13 T cell assays and 13 MHC ligand assays.	IEDB	37468	6749	6757	LLLDDFVEI	ECO:0000213	PubMed	33911008
P0DTD1	LLMPILTLT is a linear peptidic epitope (epitope ID 37583) tested in 5 T cell assays and 10 MHC ligand assays.	IEDB	37583	4632	4640	LLMPILTLT	ECO:0000213	PubMed	34793243
P0DTD1	LLSAGIFGA is a linear peptidic epitope (epitope ID 37766) tested in 7 T cell assays and 12 MHC ligand assays.	IEDB	37766	1148	1156	LLSAGIFGA	ECO:0000213	PubMed	34793243
P0DTD1	LLSAGIFGA is a linear peptidic epitope (epitope ID 37766) tested in 7 T cell assays and 12 MHC ligand assays.	IEDB	37766	1148	1156	LLSAGIFGA	ECO:0000213	PubMed	37193826
P0DTD1	LLVYAADPAMHAASG is a linear peptidic epitope (epitope ID 37937) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	37937	4763	4777	LLVYAADPAMHAASG	ECO:0000213	PubMed	37215095
P0DTD1	LMIERFVSL is a linear peptidic epitope (epitope ID 38043) tested in 10 T cell assays and 12 MHC ligand assays.	IEDB	38043	5246	5254	LMIERFVSL	ECO:0000213	PubMed	34793243
P0DTD1	LMIERFVSL is a linear peptidic epitope (epitope ID 38043) tested in 10 T cell assays and 12 MHC ligand assays.	IEDB	38043	5246	5254	LMIERFVSL	ECO:0000213	PubMed	33853928
P0DTD1	LPVNVAFEL is a linear peptidic epitope (epitope ID 38761) tested in 3 T cell assays and 6 MHC ligand assays.	IEDB	38761	6501	6509	LPVNVAFEL	ECO:0000213	PubMed	34793243
P0DTD1	LPYPDPSRI is a linear peptidic epitope (epitope ID 38782) tested in 24 T cell assays and 21 MHC ligand assays.	IEDB	38782	5221	5229	LPYPDPSRI	ECO:0000213	PubMed	35196796
P0DTD1	LPYPDPSRI is a linear peptidic epitope (epitope ID 38782) tested in 24 T cell assays and 21 MHC ligand assays.	IEDB	38782	5221	5229	LPYPDPSRI	ECO:0000213	PubMed	36201943
P0DTD1	LPYPDPSRI is a linear peptidic epitope (epitope ID 38782) tested in 24 T cell assays and 21 MHC ligand assays.	IEDB	38782	5221	5229	LPYPDPSRI	ECO:0000213	PubMed	33972535
P0DTD1	LPYPDPSRIL is a linear peptidic epitope (epitope ID 38783) tested in 5 T cell assays and 7 MHC ligand assays.	IEDB	38783	5221	5230	LPYPDPSRIL	ECO:0000213	PubMed	34145459
P0DTD1	LPYPDPSRIL is a linear peptidic epitope (epitope ID 38783) tested in 5 T cell assays and 7 MHC ligand assays.	IEDB	38783	5221	5230	LPYPDPSRIL	ECO:0000213	PubMed	36201943
P0DTD1	LPYPDPSRIL is a linear peptidic epitope (epitope ID 38783) tested in 5 T cell assays and 7 MHC ligand assays.	IEDB	38783	5221	5230	LPYPDPSRIL	ECO:0000213	PubMed	33853928
P0DTD1	LQLGFSTGV is a linear peptidic epitope (epitope ID 38874) tested in 3 T cell assays and 10 MHC ligand assays.	IEDB	38874	6032	6040	LQLGFSTGV	ECO:0000213	PubMed	34793243
P0DTD1	LSFKELLVY is a linear peptidic epitope (epitope ID 39346) tested in 3 T cell assays and 7 MHC ligand assays.	IEDB	39346	4758	4766	LSFKELLVY	ECO:0000213	PubMed	34793243
P0DTD1	LTGHMLDMY is a linear peptidic epitope (epitope ID 39913) tested in 4 T cell assays and 8 MHC ligand assays.	IEDB	39913	5287	5295	LTGHMLDMY	ECO:0000213	PubMed	34793243
P0DTD1	LTGHMLDMY is a linear peptidic epitope (epitope ID 39913) tested in 4 T cell assays and 8 MHC ligand assays.	IEDB	39913	5287	5295	LTGHMLDMY	ECO:0000213	PubMed	33972535
P0DTD1	LTNDNTSRY is a linear peptidic epitope (epitope ID 40050) tested in 4 T cell assays and 7 MHC ligand assays.	IEDB	40050	5299	5307	LTNDNTSRY	ECO:0000213	PubMed	34793243
P0DTD1	LTNDNTSRY is a linear peptidic epitope (epitope ID 40050) tested in 4 T cell assays and 7 MHC ligand assays.	IEDB	40050	5299	5307	LTNDNTSRY	ECO:0000213	PubMed	35104433
P0DTD1	LVLSVNPYV is a linear peptidic epitope (epitope ID 40459) tested in 3 T cell assays and 10 MHC ligand assays.	IEDB	40459	5365	5373	LVLSVNPYV	ECO:0000213	PubMed	34793243
P0DTD1	LYQPPQTSI is a linear peptidic epitope (epitope ID 40914) tested in 3 T cell assays and 14 MHC ligand assays.	IEDB	40914	3249	3257	LYQPPQTSI	ECO:0000213	PubMed	33853928
P0DTD1	MLWCKDGHV is a linear peptidic epitope (epitope ID 42093) tested in 3 T cell assays and 10 MHC ligand assays.	IEDB	42093	6782	6790	MLWCKDGHV	ECO:0000213	PubMed	34793243
P0DTD1	MMISAGFSL is a linear peptidic epitope (epitope ID 42128) tested in 6 T cell assays and 12 MHC ligand assays.	IEDB	42128	6425	6433	MMISAGFSL	ECO:0000213	PubMed	34793243
P0DTD1	MMISAGFSL is a linear peptidic epitope (epitope ID 42128) tested in 6 T cell assays and 12 MHC ligand assays.	IEDB	42128	6425	6433	MMISAGFSL	ECO:0000213	PubMed	33853928
P0DTD1	MPASWVMRI is a linear peptidic epitope (epitope ID 42260) tested in 10 T cell assays and 29 MHC ligand assays.	IEDB	42260	3655	3663	MPASWVMRI	ECO:0000213	PubMed	34793243
P0DTD1	MPASWVMRI is a linear peptidic epitope (epitope ID 42260) tested in 10 T cell assays and 29 MHC ligand assays.	IEDB	42260	3655	3663	MPASWVMRI	ECO:0000213	PubMed	33853928
P0DTD1	MPASWVMRIM is a linear peptidic epitope (epitope ID 42261) tested in 1 T cell assay and 6 MHC ligand assays.	IEDB	42261	3655	3664	MPASWVMRIM	ECO:0000213	PubMed	38045681
P0DTD1	MPNMLRIMA is a linear peptidic epitope (epitope ID 42300) tested in 1 T cell assay and 6 MHC ligand assays.	IEDB	42300	5018	5026	MPNMLRIMA	ECO:0000213	PubMed	34793243
P0DTD1	MPNMLRIMASLVLAR is a linear peptidic epitope (epitope ID 42301) tested in 6 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	42301	5018	5032	MPNMLRIMASLVLAR	ECO:0000213	PubMed	37215095
P0DTD1	MTNRQFHQK is a linear peptidic epitope (epitope ID 42843) tested in 4 T cell assays and 23 MHC ligand assays.	IEDB	42843	4958	4966	MTNRQFHQK	ECO:0000213	PubMed	34728796
P0DTD1	MVMCGGSLY is a linear peptidic epitope (epitope ID 42971) tested in 1 T cell assay and 10 MHC ligand assays.	IEDB	42971	5058	5066	MVMCGGSLY	ECO:0000213	PubMed	34793243
P0DTD1	NAAISDYDY is a linear peptidic epitope (epitope ID 43119) tested in 4 T cell assays and 6 MHC ligand assays.	IEDB	43119	4839	4847	NAAISDYDY	ECO:0000213	PubMed	34758478
P0DTD1	NLWNTFTRL is a linear peptidic epitope (epitope ID 44927) tested in 3 T cell assays and 10 MHC ligand assays.	IEDB	44927	6443	6451	NLWNTFTRL	ECO:0000213	PubMed	33853928
P0DTD1	NMLRIMASL is a linear peptidic epitope (epitope ID 45000) tested in 10 T cell assays and 20 MHC ligand assays.	IEDB	45000	5020	5028	NMLRIMASL	ECO:0000213	PubMed	34728796
P0DTD1	NMLRIMASL is a linear peptidic epitope (epitope ID 45000) tested in 10 T cell assays and 20 MHC ligand assays.	IEDB	45000	5020	5028	NMLRIMASL	ECO:0000213	PubMed	34793243
P0DTD1	NMLRIMASL is a linear peptidic epitope (epitope ID 45000) tested in 10 T cell assays and 20 MHC ligand assays.	IEDB	45000	5020	5028	NMLRIMASL	ECO:0000213	PubMed	35937077
P0DTD1	NPKTPKYKF is a linear peptidic epitope (epitope ID 45385) tested in 2 T cell assays and 21 MHC ligand assays.	IEDB	45385	3358	3366	NPKTPKYKF	ECO:0000213	PubMed	33853928
P0DTD1	NSVFNICQAVTANVN is a linear peptidic epitope (epitope ID 46023) tested in 6 T cell assays and 6 MHC ligand assays.	IEDB	46023	5083	5097	NSVFNICQAVTANVN	ECO:0000213	PubMed	37215095
P0DTD1	NTLTLAVPY is a linear peptidic epitope (epitope ID 46172) tested in 1 T cell assay and 6 MHC ligand assays.	IEDB	46172	6853	6861	NTLTLAVPY	ECO:0000213	PubMed	34793243
P0DTD1	PEFYEAMYTPHTVLQ is a linear peptidic epitope (epitope ID 47282) tested in 6 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	47282	5310	5324	PEFYEAMYTPHTVLQ	ECO:0000213	PubMed	37215095
P0DTD1	PFMIDVQQW is a linear peptidic epitope (epitope ID 47524) tested in 1 T cell assay and 6 MHC ligand assays.	IEDB	47524	6164	6172	PFMIDVQQW	ECO:0000213	PubMed	33853928
P0DTD1	PMDSTVKNY is a linear peptidic epitope (epitope ID 48545) tested in 1 T cell assay and 6 MHC ligand assays.	IEDB	48545	6722	6730	PMDSTVKNY	ECO:0000213	PubMed	34793243
P0DTD1	PNMLRIMASLVLARK is a linear peptidic epitope (epitope ID 48677) tested in 14 T cell assays, 8 B cell assays and 6 MHC ligand assays.	IEDB	48677	5019	5033	PNMLRIMASLVLARK	ECO:0000213	PubMed	38605956
P0DTD1	PNMLRIMASLVLARK is a linear peptidic epitope (epitope ID 48677) tested in 14 T cell assays, 8 B cell assays and 6 MHC ligand assays.	IEDB	48677	5019	5033	PNMLRIMASLVLARK	ECO:0000213	PubMed	33911008
P0DTD1	QEYADVFHLY is a linear peptidic epitope (epitope ID 50727) tested in 7 T cell assays and 6 MHC ligand assays.	IEDB	50727	5267	5276	QEYADVFHLY	ECO:0000213	PubMed	38781962
P0DTD1	QEYADVFHLY is a linear peptidic epitope (epitope ID 50727) tested in 7 T cell assays and 6 MHC ligand assays.	IEDB	50727	5267	5276	QEYADVFHLY	ECO:0000213	PubMed	33184509
P0DTD1	QLMCQPILL is a linear peptidic epitope (epitope ID 51442) tested in 2 T cell assays and 11 MHC ligand assays.	IEDB	51442	2563	2571	QLMCQPILL	ECO:0000213	PubMed	37193826
P0DTD1	QLMCQPILLL is a linear peptidic epitope (epitope ID 51443) tested in 4 T cell assays and 10 MHC ligand assays.	IEDB	51443	2563	2572	QLMCQPILLL	ECO:0000213	PubMed	37193826
P0DTD1	QLYLGGMSYY is a linear peptidic epitope (epitope ID 51585) tested in 1 T cell assay and 5 MHC ligand assays.	IEDB	51585	5386	5395	QLYLGGMSYY	ECO:0000213	PubMed	33853928
P0DTD1	QMNLKYAISAKNRAR is a linear peptidic epitope (epitope ID 51627) tested in 7 T cell assays and 7 MHC ligand assays.	IEDB	51627	4933	4947	QMNLKYAISAKNRAR	ECO:0000213	PubMed	37215095
P0DTD1	RILGAGCFV is a linear peptidic epitope (epitope ID 54183) tested in 4 T cell assays and 10 MHC ligand assays.	IEDB	54183	5228	5236	RILGAGCFV	ECO:0000213	PubMed	34793243
P0DTD1	RKIFVDGVPFVVSTG is a linear peptidic epitope (epitope ID 54361) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	54361	4723	4737	RKIFVDGVPFVVSTG	ECO:0000213	PubMed	37215095
P0DTD1	RLYYDSMSY is a linear peptidic epitope (epitope ID 54847) tested in 6 T cell assays and 25 MHC ligand assays.	IEDB	54847	4905	4913	RLYYDSMSY	ECO:0000213	PubMed	33853928
P0DTD1	RMYIFFASFY is a linear peptidic epitope (epitope ID 54961) tested in 3 T cell assays and 11 MHC ligand assays.	IEDB	54961	2382	2391	RMYIFFASFY	ECO:0000213	PubMed	33184509
P0DTD1	RPDTRYVLM is a linear peptidic epitope (epitope ID 55132) tested in 4 T cell assays and 5 MHC ligand assays.	IEDB	55132	2949	2957	RPDTRYVLM	ECO:0000213	PubMed	34793243
P0DTD1	RPDTRYVLM is a linear peptidic epitope (epitope ID 55132) tested in 4 T cell assays and 5 MHC ligand assays.	IEDB	55132	2949	2957	RPDTRYVLM	ECO:0000213	PubMed	33427749
P0DTD1	RPPLNRNYV is a linear peptidic epitope (epitope ID 55258) tested in 1 T cell assay and 5 MHC ligand assays.	IEDB	55258	5497	5505	RPPLNRNYV	ECO:0000213	PubMed	34793243
P0DTD1	RQFHQKLLK is a linear peptidic epitope (epitope ID 55413) tested in 6 T cell assays and 7 MHC ligand assays.	IEDB	55413	4961	4969	RQFHQKLLK	ECO:0000213	PubMed	35389886
P0DTD1	RQLLFVVEV is a linear peptidic epitope (epitope ID 55444) tested in 25 T cell assays and 12 MHC ligand assays.	IEDB	55444	4859	4867	RQLLFVVEV	ECO:0000213	PubMed	34793243
P0DTD1	RQLLFVVEV is a linear peptidic epitope (epitope ID 55444) tested in 25 T cell assays and 12 MHC ligand assays.	IEDB	55444	4859	4867	RQLLFVVEV	ECO:0000213	PubMed	34919800
P0DTD1	RQLLFVVEV is a linear peptidic epitope (epitope ID 55444) tested in 25 T cell assays and 12 MHC ligand assays.	IEDB	55444	4859	4867	RQLLFVVEV	ECO:0000213	PubMed	38781962
P0DTD1	RQLLFVVEV is a linear peptidic epitope (epitope ID 55444) tested in 25 T cell assays and 12 MHC ligand assays.	IEDB	55444	4859	4867	RQLLFVVEV	ECO:0000213	PubMed	39589869
P0DTD1	RQLLFVVEV is a linear peptidic epitope (epitope ID 55444) tested in 25 T cell assays and 12 MHC ligand assays.	IEDB	55444	4859	4867	RQLLFVVEV	ECO:0000213	PubMed	33853928
P0DTD1	RYFKYWDQTY is a linear peptidic epitope (epitope ID 56531) tested in 1 T cell assay and 6 MHC ligand assays.	IEDB	56531	4677	4686	RYFKYWDQTY	ECO:0000213	PubMed	33853928
P0DTD1	RYLALYNKY is a linear peptidic epitope (epitope ID 56568) tested in 1 T cell assay and 6 MHC ligand assays.	IEDB	56568	3206	3214	RYLALYNKY	ECO:0000213	PubMed	34793243
P0DTD1	SEFSSLPSY is a linear peptidic epitope (epitope ID 57432) tested in 16 T cell assays and 26 MHC ligand assays.	IEDB	57432	3946	3954	SEFSSLPSY	ECO:0000213	PubMed	34968416
P0DTD1	SEFSSLPSY is a linear peptidic epitope (epitope ID 57432) tested in 16 T cell assays and 26 MHC ligand assays.	IEDB	57432	3946	3954	SEFSSLPSY	ECO:0000213	PubMed	33184509
P0DTD1	SLAIDAYPL is a linear peptidic epitope (epitope ID 59001) tested in 2 T cell assays and 25 MHC ligand assays.	IEDB	59001	5253	5261	SLAIDAYPL	ECO:0000213	PubMed	34728796
P0DTD1	SLAIDAYPL is a linear peptidic epitope (epitope ID 59001) tested in 2 T cell assays and 25 MHC ligand assays.	IEDB	59001	5253	5261	SLAIDAYPL	ECO:0000213	PubMed	35937077
P0DTD1	SLAIDAYPLTKHPNQ is a linear peptidic epitope (epitope ID 59002) tested in 6 T cell assays and 6 MHC ligand assays.	IEDB	59002	5253	5267	SLAIDAYPLTKHPNQ	ECO:0000213	PubMed	37215095
P0DTD1	SLLSVLLSM is a linear peptidic epitope (epitope ID 59312) tested in 4 T cell assays and 10 MHC ligand assays.	IEDB	59312	3913	3921	SLLSVLLSM	ECO:0000213	PubMed	34793243
P0DTD1	SLLSVLLSM is a linear peptidic epitope (epitope ID 59312) tested in 4 T cell assays and 10 MHC ligand assays.	IEDB	59312	3913	3921	SLLSVLLSM	ECO:0000213	PubMed	33853928
P0DTD1	SPSGVYQCAM is a linear peptidic epitope (epitope ID 60255) tested in 3 T cell assays and 5 MHC ligand assays.	IEDB	60255	3384	3393	SPSGVYQCAM	ECO:0000213	PubMed	33853928
P0DTD1	SPYNSQNAV is a linear peptidic epitope (epitope ID 60344) tested in 2 T cell assays and 5 MHC ligand assays.	IEDB	60344	5837	5845	SPYNSQNAV	ECO:0000213	PubMed	34793243
P0DTD1	SSGDATTAY is a linear peptidic epitope (epitope ID 61021) tested in 1 T cell assay and 6 MHC ligand assays.	IEDB	61021	5073	5081	SSGDATTAY	ECO:0000213	PubMed	34793243
P0DTD1	SYSLFDMSKF is a linear peptidic epitope (epitope ID 62705) tested in 1 T cell assay and 8 MHC ligand assays.	IEDB	62705	7039	7048	SYSLFDMSKF	ECO:0000213	PubMed	33853928
P0DTD1	TDDNALAYY is a linear peptidic epitope (epitope ID 63134) tested in 2 T cell assays and 6 MHC ligand assays.	IEDB	63134	4164	4172	TDDNALAYY	ECO:0000213	PubMed	34793243
P0DTD1	TFTYASALW is a linear peptidic epitope (epitope ID 63762) tested in 3 T cell assays and 7 MHC ligand assays.	IEDB	63762	4088	4096	TFTYASALW	ECO:0000213	PubMed	34793243
P0DTD1	TFTYASALW is a linear peptidic epitope (epitope ID 63762) tested in 3 T cell assays and 7 MHC ligand assays.	IEDB	63762	4088	4096	TFTYASALW	ECO:0000213	PubMed	33853928
P0DTD1	TGHMLDMYSVMLTND is a linear peptidic epitope (epitope ID 63847) tested in 6 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	63847	5288	5302	TGHMLDMYSVMLTND	ECO:0000213	PubMed	37215095
P0DTD1	TLIGDCATV is a linear peptidic epitope (epitope ID 64850) tested in 4 T cell assays and 10 MHC ligand assays.	IEDB	64850	6908	6916	TLIGDCATV	ECO:0000213	PubMed	34793243
P0DTD1	TLVPQEHYV is a linear peptidic epitope (epitope ID 65132) tested in 21 T cell assays and 24 MHC ligand assays.	IEDB	65132	5563	5571	TLVPQEHYV	ECO:0000213	PubMed	34312620
P0DTD1	TLVPQEHYV is a linear peptidic epitope (epitope ID 65132) tested in 21 T cell assays and 24 MHC ligand assays.	IEDB	65132	5563	5571	TLVPQEHYV	ECO:0000213	PubMed	34725257
P0DTD1	TLVPQEHYV is a linear peptidic epitope (epitope ID 65132) tested in 21 T cell assays and 24 MHC ligand assays.	IEDB	65132	5563	5571	TLVPQEHYV	ECO:0000213	PubMed	34793243
P0DTD1	TMADLVYAL is a linear peptidic epitope (epitope ID 65176) tested in 32 T cell assays and 20 MHC ligand assays.	IEDB	65176	4515	4523	TMADLVYAL	ECO:0000213	PubMed	34210785
P0DTD1	TMADLVYAL is a linear peptidic epitope (epitope ID 65176) tested in 32 T cell assays and 20 MHC ligand assays.	IEDB	65176	4515	4523	TMADLVYAL	ECO:0000213	PubMed	34506741
P0DTD1	TMADLVYAL is a linear peptidic epitope (epitope ID 65176) tested in 32 T cell assays and 20 MHC ligand assays.	IEDB	65176	4515	4523	TMADLVYAL	ECO:0000213	PubMed	34627082
P0DTD1	TMADLVYAL is a linear peptidic epitope (epitope ID 65176) tested in 32 T cell assays and 20 MHC ligand assays.	IEDB	65176	4515	4523	TMADLVYAL	ECO:0000213	PubMed	34793243
P0DTD1	TMADLVYAL is a linear peptidic epitope (epitope ID 65176) tested in 32 T cell assays and 20 MHC ligand assays.	IEDB	65176	4515	4523	TMADLVYAL	ECO:0000213	PubMed	34919800
P0DTD1	TMADLVYAL is a linear peptidic epitope (epitope ID 65176) tested in 32 T cell assays and 20 MHC ligand assays.	IEDB	65176	4515	4523	TMADLVYAL	ECO:0000213	PubMed	38781962
P0DTD1	TMADLVYAL is a linear peptidic epitope (epitope ID 65176) tested in 32 T cell assays and 20 MHC ligand assays.	IEDB	65176	4515	4523	TMADLVYAL	ECO:0000213	PubMed	39589869
P0DTD1	TMADLVYAL is a linear peptidic epitope (epitope ID 65176) tested in 32 T cell assays and 20 MHC ligand assays.	IEDB	65176	4515	4523	TMADLVYAL	ECO:0000213	PubMed	32913053
P0DTD1	TMADLVYAL is a linear peptidic epitope (epitope ID 65176) tested in 32 T cell assays and 20 MHC ligand assays.	IEDB	65176	4515	4523	TMADLVYAL	ECO:0000213	PubMed	33853928
P0DTD1	TPKYKFVRI is a linear peptidic epitope (epitope ID 65630) tested in 2 T cell assays and 5 MHC ligand assays.	IEDB	65630	3361	3369	TPKYKFVRI	ECO:0000213	PubMed	32999467
P0DTD1	TPRDLGACI is a linear peptidic epitope (epitope ID 65739) tested in 3 T cell assays and 27 MHC ligand assays.	IEDB	65739	2684	2692	TPRDLGACI	ECO:0000213	PubMed	34793243
P0DTD1	TPRDLGACI is a linear peptidic epitope (epitope ID 65739) tested in 3 T cell assays and 27 MHC ligand assays.	IEDB	65739	2684	2692	TPRDLGACI	ECO:0000213	PubMed	33853928
P0DTD1	TQYNRYLALY is a linear peptidic epitope (epitope ID 65979) tested in 1 T cell assay and 5 MHC ligand assays.	IEDB	65979	3202	3211	TQYNRYLALY	ECO:0000213	PubMed	38045681
P0DTD1	TSFGPLVRK is a linear peptidic epitope (epitope ID 66198) tested in 4 T cell assays and 7 MHC ligand assays.	IEDB	66198	4716	4724	TSFGPLVRK	ECO:0000213	PubMed	33427749
P0DTD1	TSSGDATTAY is a linear peptidic epitope (epitope ID 66426) tested in 1 T cell assay and 7 MHC ligand assays.	IEDB	66426	5072	5081	TSSGDATTAY	ECO:0000213	PubMed	33853928
P0DTD1	TVAYFNMVY is a linear peptidic epitope (epitope ID 66956) tested in 3 T cell assays and 12 MHC ligand assays.	IEDB	66956	3646	3654	TVAYFNMVY	ECO:0000213	PubMed	34793243
P0DTD1	TVAYFNMVY is a linear peptidic epitope (epitope ID 66956) tested in 3 T cell assays and 12 MHC ligand assays.	IEDB	66956	3646	3654	TVAYFNMVY	ECO:0000213	PubMed	38045681
P0DTD1	TVKPGNFNK is a linear peptidic epitope (epitope ID 67051) tested in 3 T cell assays and 7 MHC ligand assays.	IEDB	67051	4801	4809	TVKPGNFNK	ECO:0000213	PubMed	34728796
P0DTD1	TVLSFCAFA is a linear peptidic epitope (epitope ID 67078) tested in 1 T cell assay and 10 MHC ligand assays.	IEDB	67078	4265	4273	TVLSFCAFA	ECO:0000213	PubMed	34793243
P0DTD1	TYASALWEI is a linear peptidic epitope (epitope ID 67315) tested in 3 T cell assays and 6 MHC ligand assays.	IEDB	67315	4090	4098	TYASALWEI	ECO:0000213	PubMed	34506741
P0DTD1	TYASALWEI is a linear peptidic epitope (epitope ID 67315) tested in 3 T cell assays and 6 MHC ligand assays.	IEDB	67315	4090	4098	TYASALWEI	ECO:0000213	PubMed	34793243
P0DTD1	VELKHFFFA is a linear peptidic epitope (epitope ID 68271) tested in 1 T cell assay and 6 MHC ligand assays.	IEDB	68271	4827	4835	VELKHFFFA	ECO:0000213	PubMed	38781962
P0DTD1	VLAWLYAAV is a linear peptidic epitope (epitope ID 69392) tested in 14 T cell assays and 12 MHC ligand assays.	IEDB	69392	3467	3475	VLAWLYAAV	ECO:0000213	PubMed	34793243
P0DTD1	VLQAVGACV is a linear peptidic epitope (epitope ID 69716) tested in 3 T cell assays and 10 MHC ligand assays.	IEDB	69716	5322	5330	VLQAVGACV	ECO:0000213	PubMed	34793243
P0DTD1	VLSFCAFAV is a linear peptidic epitope (epitope ID 69758) tested in 3 T cell assays and 11 MHC ligand assays.	IEDB	69758	4266	4274	VLSFCAFAV	ECO:0000213	PubMed	34793243
P0DTD1	VLWAHGFEL is a linear peptidic epitope (epitope ID 69850) tested in 21 T cell assays and 34 MHC ligand assays.	IEDB	69850	6109	6117	VLWAHGFEL	ECO:0000213	PubMed	34793243
P0DTD1	VLWAHGFEL is a linear peptidic epitope (epitope ID 69850) tested in 21 T cell assays and 34 MHC ligand assays.	IEDB	69850	6109	6117	VLWAHGFEL	ECO:0000213	PubMed	37390223
P0DTD1	VLWAHGFEL is a linear peptidic epitope (epitope ID 69850) tested in 21 T cell assays and 34 MHC ligand assays.	IEDB	69850	6109	6117	VLWAHGFEL	ECO:0000213	PubMed	38214610
P0DTD1	VMCGGSLYV is a linear peptidic epitope (epitope ID 69929) tested in 4 T cell assays and 13 MHC ligand assays.	IEDB	69929	5059	5067	VMCGGSLYV	ECO:0000213	PubMed	34728796
P0DTD1	VMCGGSLYV is a linear peptidic epitope (epitope ID 69929) tested in 4 T cell assays and 13 MHC ligand assays.	IEDB	69929	5059	5067	VMCGGSLYV	ECO:0000213	PubMed	34793243
P0DTD1	VMPLSAPTL is a linear peptidic epitope (epitope ID 70008) tested in 12 T cell assays and 8 MHC ligand assays.	IEDB	70008	5556	5564	VMPLSAPTL	ECO:0000213	PubMed	34793243
P0DTD1	VMPLSAPTL is a linear peptidic epitope (epitope ID 70008) tested in 12 T cell assays and 8 MHC ligand assays.	IEDB	70008	5556	5564	VMPLSAPTL	ECO:0000213	PubMed	37390223
P0DTD1	VPANSTVLSF is a linear peptidic epitope (epitope ID 70250) tested in 2 T cell assays and 5 MHC ligand assays.	IEDB	70250	4260	4269	VPANSTVLSF	ECO:0000213	PubMed	33853928
P0DTD1	VVDKYFDCY is a linear peptidic epitope (epitope ID 71635) tested in 6 T cell assays and 29 MHC ligand assays.	IEDB	71635	4867	4875	VVDKYFDCY	ECO:0000213	PubMed	34793243
P0DTD1	VVNARLRAK is a linear peptidic epitope (epitope ID 71767) tested in 4 T cell assays and 7 MHC ligand assays.	IEDB	71767	5710	5718	VVNARLRAK	ECO:0000213	PubMed	35104433
P0DTD1	VVNARLRAK is a linear peptidic epitope (epitope ID 71767) tested in 4 T cell assays and 7 MHC ligand assays.	IEDB	71767	5710	5718	VVNARLRAK	ECO:0000213	PubMed	33427749
P0DTD1	VVSTGYHFR is a linear peptidic epitope (epitope ID 71837) tested in 3 T cell assays and 8 MHC ligand assays.	IEDB	71837	4733	4741	VVSTGYHFR	ECO:0000213	PubMed	34728796
P0DTD1	VVYRAFDIY is a linear peptidic epitope (epitope ID 71916) tested in 1 T cell assay and 5 MHC ligand assays.	IEDB	71916	4422	4430	VVYRAFDIY	ECO:0000213	PubMed	33853928
P0DTD1	VVYRGTTTYK is a linear peptidic epitope (epitope ID 71918) tested in 11 T cell assays and 6 MHC ligand assays.	IEDB	71918	5533	5542	VVYRGTTTYK	ECO:0000213	PubMed	38932408
P0DTD1	VVYRGTTTYK is a linear peptidic epitope (epitope ID 71918) tested in 11 T cell assays and 6 MHC ligand assays.	IEDB	71918	5533	5542	VVYRGTTTYK	ECO:0000213	PubMed	33184509
P0DTD1	VVYRGTTTYK is a linear peptidic epitope (epitope ID 71918) tested in 11 T cell assays and 6 MHC ligand assays.	IEDB	71918	5533	5542	VVYRGTTTYK	ECO:0000213	PubMed	33427749
P0DTD1	VYIGDPAQL is a linear peptidic epitope (epitope ID 72048) tested in 47 T cell assays and 9 MHC ligand assays.	IEDB	72048	5721	5729	VYIGDPAQL	ECO:0000213	PubMed	34312620
P0DTD1	VYIGDPAQL is a linear peptidic epitope (epitope ID 72048) tested in 47 T cell assays and 9 MHC ligand assays.	IEDB	72048	5721	5729	VYIGDPAQL	ECO:0000213	PubMed	34725257
P0DTD1	VYIGDPAQL is a linear peptidic epitope (epitope ID 72048) tested in 47 T cell assays and 9 MHC ligand assays.	IEDB	72048	5721	5729	VYIGDPAQL	ECO:0000213	PubMed	34793243
P0DTD1	VYIGDPAQL is a linear peptidic epitope (epitope ID 72048) tested in 47 T cell assays and 9 MHC ligand assays.	IEDB	72048	5721	5729	VYIGDPAQL	ECO:0000213	PubMed	34968416
P0DTD1	VYIGDPAQL is a linear peptidic epitope (epitope ID 72048) tested in 47 T cell assays and 9 MHC ligand assays.	IEDB	72048	5721	5729	VYIGDPAQL	ECO:0000213	PubMed	35383307
P0DTD1	VYIGDPAQL is a linear peptidic epitope (epitope ID 72048) tested in 47 T cell assays and 9 MHC ligand assays.	IEDB	72048	5721	5729	VYIGDPAQL	ECO:0000213	PubMed	35389886
P0DTD1	VYIGDPAQL is a linear peptidic epitope (epitope ID 72048) tested in 47 T cell assays and 9 MHC ligand assays.	IEDB	72048	5721	5729	VYIGDPAQL	ECO:0000213	PubMed	36254196
P0DTD1	VYIGDPAQL is a linear peptidic epitope (epitope ID 72048) tested in 47 T cell assays and 9 MHC ligand assays.	IEDB	72048	5721	5729	VYIGDPAQL	ECO:0000213	PubMed	38387105
P0DTD1	VYIGDPAQL is a linear peptidic epitope (epitope ID 72048) tested in 47 T cell assays and 9 MHC ligand assays.	IEDB	72048	5721	5729	VYIGDPAQL	ECO:0000213	PubMed	32999467
P0DTD1	VYIGDPAQL is a linear peptidic epitope (epitope ID 72048) tested in 47 T cell assays and 9 MHC ligand assays.	IEDB	72048	5721	5729	VYIGDPAQL	ECO:0000213	PubMed	33128877
P0DTD1	VYIGDPAQL is a linear peptidic epitope (epitope ID 72048) tested in 47 T cell assays and 9 MHC ligand assays.	IEDB	72048	5721	5729	VYIGDPAQL	ECO:0000213	PubMed	36526616
P0DTD1	VYIGDPAQL is a linear peptidic epitope (epitope ID 72048) tested in 47 T cell assays and 9 MHC ligand assays.	IEDB	72048	5721	5729	VYIGDPAQL	ECO:0000213	PubMed	33427749
P0DTD1	VYIGDPAQL is a linear peptidic epitope (epitope ID 72048) tested in 47 T cell assays and 9 MHC ligand assays.	IEDB	72048	5721	5729	VYIGDPAQL	ECO:0000213	PubMed	33853928
P0DTD1	VYMPASWVM is a linear peptidic epitope (epitope ID 72100) tested in 5 T cell assays and 9 MHC ligand assays.	IEDB	72100	3653	3661	VYMPASWVM	ECO:0000213	PubMed	35104433
P0DTD1	VYMPASWVM is a linear peptidic epitope (epitope ID 72100) tested in 5 T cell assays and 9 MHC ligand assays.	IEDB	72100	3653	3661	VYMPASWVM	ECO:0000213	PubMed	33853928
P0DTD1	VYRGTTTYKL is a linear peptidic epitope (epitope ID 72148) tested in 1 T cell assay and 6 MHC ligand assays.	IEDB	72148	5534	5543	VYRGTTTYKL	ECO:0000213	PubMed	33853928
P0DTD1	WLPTGTLLV is a linear peptidic epitope (epitope ID 72766) tested in 4 T cell assays and 11 MHC ligand assays.	IEDB	72766	6886	6894	WLPTGTLLV	ECO:0000213	PubMed	34506741
P0DTD1	WLPTGTLLV is a linear peptidic epitope (epitope ID 72766) tested in 4 T cell assays and 11 MHC ligand assays.	IEDB	72766	6886	6894	WLPTGTLLV	ECO:0000213	PubMed	34793243
P0DTD1	WLPTGTLLV is a linear peptidic epitope (epitope ID 72766) tested in 4 T cell assays and 11 MHC ligand assays.	IEDB	72766	6886	6894	WLPTGTLLV	ECO:0000213	PubMed	39456150
P0DTD1	YAYLRKHFSMMILSD is a linear peptidic epitope (epitope ID 73478) tested in 6 T cell assays, 4 B cell assays and 15 MHC ligand assays.	IEDB	73478	5138	5152	YAYLRKHFSMMILSD	ECO:0000213	PubMed	37215095
P0DTD1	YEDQDALFAY is a linear peptidic epitope (epitope ID 73633) tested in 2 T cell assays and 6 MHC ligand assays.	IEDB	73633	4913	4922	YEDQDALFAY	ECO:0000213	PubMed	38781962
P0DTD1	YEDQDALFAY is a linear peptidic epitope (epitope ID 73633) tested in 2 T cell assays and 6 MHC ligand assays.	IEDB	73633	4913	4922	YEDQDALFAY	ECO:0000213	PubMed	38045681
P0DTD1	YLDAYNMMI is a linear peptidic epitope (epitope ID 74593) tested in 14 T cell assays and 13 MHC ligand assays.	IEDB	74593	6419	6427	YLDAYNMMI	ECO:0000213	PubMed	34793243
P0DTD1	YLDAYNMMI is a linear peptidic epitope (epitope ID 74593) tested in 14 T cell assays and 13 MHC ligand assays.	IEDB	74593	6419	6427	YLDAYNMMI	ECO:0000213	PubMed	38605956
P0DTD1	YLDAYNMMI is a linear peptidic epitope (epitope ID 74593) tested in 14 T cell assays and 13 MHC ligand assays.	IEDB	74593	6419	6427	YLDAYNMMI	ECO:0000213	PubMed	33911008
P0DTD1	YLDAYNMMI is a linear peptidic epitope (epitope ID 74593) tested in 14 T cell assays and 13 MHC ligand assays.	IEDB	74593	6419	6427	YLDAYNMMI	ECO:0000213	PubMed	33427749
P0DTD1	YLNTLTLAV is a linear peptidic epitope (epitope ID 74850) tested in 6 T cell assays and 11 MHC ligand assays.	IEDB	74850	6851	6859	YLNTLTLAV	ECO:0000213	PubMed	34793243
P0DTD1	YTGNYQCGHY is a linear peptidic epitope (epitope ID 76063) tested in 1 T cell assay and 9 MHC ligand assays.	IEDB	76063	1827	1836	YTGNYQCGHY	ECO:0000213	PubMed	33853928
P0DTD1	YTMADLVYA is a linear peptidic epitope (epitope ID 76120) tested in 4 T cell assays and 11 MHC ligand assays.	IEDB	76120	4514	4522	YTMADLVYA	ECO:0000213	PubMed	34793243
P0DTD1	YTPSKLIEY is a linear peptidic epitope (epitope ID 76156) tested in 1 T cell assay and 7 MHC ligand assays.	IEDB	76156	2897	2905	YTPSKLIEY	ECO:0000213	PubMed	34793243
P0DTD1	YVFCTVNAL is a linear peptidic epitope (epitope ID 76266) tested in 3 T cell assays and 10 MHC ligand assays.	IEDB	76266	5679	5687	YVFCTVNAL	ECO:0000213	PubMed	34793243
P0DTD1	YYPSARIVY is a linear peptidic epitope (epitope ID 76569) tested in 1 T cell assay and 6 MHC ligand assays.	IEDB	76569	5622	5630	YYPSARIVY	ECO:0000213	PubMed	33853928
P0DTD1	YYRYNLPTM is a linear peptidic epitope (epitope ID 76599) tested in 1 T cell assay and 8 MHC ligand assays.	IEDB	76599	4847	4855	YYRYNLPTM	ECO:0000213	PubMed	34793243
P0DTD1	QLSLPVLQV is a linear peptidic epitope (epitope ID 120150) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	120150	15	23	QLSLPVLQV	ECO:0000213	PubMed	39456150
P0DTD1	TLGVLVPHV is a linear peptidic epitope (epitope ID 120241) tested in 7 T cell assays and 2 MHC ligand assays.	IEDB	120241	103	111	TLGVLVPHV	ECO:0000213	PubMed	34793243
P0DTD1	TLGVLVPHV is a linear peptidic epitope (epitope ID 120241) tested in 7 T cell assays and 2 MHC ligand assays.	IEDB	120241	103	111	TLGVLVPHV	ECO:0000213	PubMed	39456150
P0DTD1	VLGSLAATV is a linear peptidic epitope (epitope ID 120285) tested in 2 T cell assays.	IEDB	120285	4242	4250	VLGSLAATV	ECO:0000213	PubMed	34793243
P0DTD1	VLLSVLQQL is a linear peptidic epitope (epitope ID 120287) tested in 12 T cell assays and 2 MHC ligand assays.	IEDB	120287	3871	3879	VLLSVLQQL	ECO:0000213	PubMed	34793243
P0DTD1	HTTDPSFLGRY is a linear peptidic epitope (epitope ID 1074924) tested in 17 T cell assays.	IEDB	1074924	1636	1646	HTTDPSFLGRY	ECO:0000213	PubMed	36691482
P0DTD1	HTTDPSFLGRY is a linear peptidic epitope (epitope ID 1074924) tested in 17 T cell assays.	IEDB	1074924	1636	1646	HTTDPSFLGRY	ECO:0000213	PubMed	33427749
P0DTD1	HTTDPSFLGRY is a linear peptidic epitope (epitope ID 1074924) tested in 17 T cell assays.	IEDB	1074924	1636	1646	HTTDPSFLGRY	ECO:0000213	PubMed	33853928
P0DTD1	HTTDPSFLGRY is a linear peptidic epitope (epitope ID 1074924) tested in 17 T cell assays.	IEDB	1074924	1636	1646	HTTDPSFLGRY	ECO:0000213	PubMed	35699447
P0DTD1	ALWEIQQV is a linear peptidic epitope (epitope ID 1125037) tested in 2 T cell assays.	IEDB	1125037	4094	4101	ALWEIQQV	ECO:0000213	PubMed	33853928
P0DTD1	FGDDTVIEV is a linear peptidic epitope (epitope ID 1125057) tested in 10 T cell assays and 10 MHC ligand assays.	IEDB	1125057	825	833	FGDDTVIEV	ECO:0000213	PubMed	34793243
P0DTD1	FGDDTVIEV is a linear peptidic epitope (epitope ID 1125057) tested in 10 T cell assays and 10 MHC ligand assays.	IEDB	1125057	825	833	FGDDTVIEV	ECO:0000213	PubMed	32791978
P0DTD1	FGDDTVIEV is a linear peptidic epitope (epitope ID 1125057) tested in 10 T cell assays and 10 MHC ligand assays.	IEDB	1125057	825	833	FGDDTVIEV	ECO:0000213	PubMed	33853928
P0DTD1	WLMWLIINL is a linear peptidic epitope (epitope ID 1125145) tested in 14 T cell assays and 3 MHC ligand assays.	IEDB	1125145	2363	2371	WLMWLIINL	ECO:0000213	PubMed	34793243
P0DTD1	WLMWLIINL is a linear peptidic epitope (epitope ID 1125145) tested in 14 T cell assays and 3 MHC ligand assays.	IEDB	1125145	2363	2371	WLMWLIINL	ECO:0000213	PubMed	33911008
P0DTD1	HNDILLAKDTTEAFE is a linear peptidic epitope (epitope ID 1146707) tested in 5 T cell assays and 6 MHC ligand assays.	IEDB	1146707	3895	3909	HNDILLAKDTTEAFE	ECO:0000213	PubMed	32668444
P0DTD1	KMVSLLSVLLSMQGA is a linear peptidic epitope (epitope ID 1153055) tested in 4 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1153055	3910	3924	KMVSLLSVLLSMQGA	ECO:0000213	PubMed	34758478
P0DTD1	LRAKHYVYIGDPAQL is a linear peptidic epitope (epitope ID 1158827) tested in 4 T cell assays and 4 MHC ligand assays.	IEDB	1158827	5715	5729	LRAKHYVYIGDPAQL	ECO:0000213	PubMed	34758478
P0DTD1	RVESSSKLWAQCVQL is a linear peptidic epitope (epitope ID 1167599) tested in 5 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	1167599	3880	3894	RVESSSKLWAQCVQL	ECO:0000213	PubMed	32668444
P0DTD1	RVESSSKLWAQCVQL is a linear peptidic epitope (epitope ID 1167599) tested in 5 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	1167599	3880	3894	RVESSSKLWAQCVQL	ECO:0000213	PubMed	34758478
P0DTD1	SKLWAQCVQLHNDIL is a linear peptidic epitope (epitope ID 1169536) tested in 5 T cell assays and 3 MHC ligand assays.	IEDB	1169536	3885	3899	SKLWAQCVQLHNDIL	ECO:0000213	PubMed	32668444
P0DTD1	ILFTRFFYV is a linear peptidic epitope (epitope ID 1309121) tested in 15 T cell assays and 2 MHC ligand assays.	IEDB	1309121	2332	2340	ILFTRFFYV	ECO:0000213	PubMed	34793243
P0DTD1	ILFTRFFYV is a linear peptidic epitope (epitope ID 1309121) tested in 15 T cell assays and 2 MHC ligand assays.	IEDB	1309121	2332	2340	ILFTRFFYV	ECO:0000213	PubMed	39456150
P0DTD1	ILFTRFFYV is a linear peptidic epitope (epitope ID 1309121) tested in 15 T cell assays and 2 MHC ligand assays.	IEDB	1309121	2332	2340	ILFTRFFYV	ECO:0000213	PubMed	33184509
P0DTD1	ILFTRFFYV is a linear peptidic epitope (epitope ID 1309121) tested in 15 T cell assays and 2 MHC ligand assays.	IEDB	1309121	2332	2340	ILFTRFFYV	ECO:0000213	PubMed	32913053
P0DTD1	SMWALIISV is a linear peptidic epitope (epitope ID 1309138) tested in 21 T cell assays and 6 MHC ligand assays.	IEDB	1309138	3732	3740	SMWALIISV	ECO:0000213	PubMed	34793243
P0DTD1	SMWALIISV is a linear peptidic epitope (epitope ID 1309138) tested in 21 T cell assays and 6 MHC ligand assays.	IEDB	1309138	3732	3740	SMWALIISV	ECO:0000213	PubMed	33911008
P0DTD1	SMWALIISV is a linear peptidic epitope (epitope ID 1309138) tested in 21 T cell assays and 6 MHC ligand assays.	IEDB	1309138	3732	3740	SMWALIISV	ECO:0000213	PubMed	32913053
P0DTD1	SMWALIISV is a linear peptidic epitope (epitope ID 1309138) tested in 21 T cell assays and 6 MHC ligand assays.	IEDB	1309138	3732	3740	SMWALIISV	ECO:0000213	PubMed	33853928
P0DTD1	TLMNVLTLV is a linear peptidic epitope (epitope ID 1309141) tested in 17 T cell assays and 4 MHC ligand assays.	IEDB	1309141	3710	3718	TLMNVLTLV	ECO:0000213	PubMed	34793243
P0DTD1	TLMNVLTLV is a linear peptidic epitope (epitope ID 1309141) tested in 17 T cell assays and 4 MHC ligand assays.	IEDB	1309141	3710	3718	TLMNVLTLV	ECO:0000213	PubMed	32913053
P0DTD1	APHGHVMVEL is a linear peptidic epitope (epitope ID 1310280) tested in 10 T cell assays and 9 MHC ligand assays.	IEDB	1310280	79	88	APHGHVMVEL	ECO:0000213	PubMed	33853928
P0DTD1	ASMPTTIAK is a linear peptidic epitope (epitope ID 1310291) tested in 17 T cell assays and 6 MHC ligand assays.	IEDB	1310291	2192	2200	ASMPTTIAK	ECO:0000213	PubMed	34968416
P0DTD1	ASMPTTIAK is a linear peptidic epitope (epitope ID 1310291) tested in 17 T cell assays and 6 MHC ligand assays.	IEDB	1310291	2192	2200	ASMPTTIAK	ECO:0000213	PubMed	35104433
P0DTD1	ASMPTTIAK is a linear peptidic epitope (epitope ID 1310291) tested in 17 T cell assays and 6 MHC ligand assays.	IEDB	1310291	2192	2200	ASMPTTIAK	ECO:0000213	PubMed	32999467
P0DTD1	ASMPTTIAK is a linear peptidic epitope (epitope ID 1310291) tested in 17 T cell assays and 6 MHC ligand assays.	IEDB	1310291	2192	2200	ASMPTTIAK	ECO:0000213	PubMed	33184509
P0DTD1	DLKGKYVQI is a linear peptidic epitope (epitope ID 1310332) tested in 7 T cell assays.	IEDB	1310332	4344	4352	DLKGKYVQI	ECO:0000213	PubMed	32999467
P0DTD1	EAFEKMVSL is a linear peptidic epitope (epitope ID 1310343) tested in 2 T cell assays.	IEDB	1310343	3906	3914	EAFEKMVSL	ECO:0000213	PubMed	32999467
P0DTD1	ESPFVMMSAPPAQYE is a linear peptidic epitope (epitope ID 1310374) tested in 7 T cell assays, 8 B cell assays and 7 MHC ligand assays.	IEDB	1310374	1801	1815	ESPFVMMSAPPAQYE	ECO:0000213	PubMed	33911008
P0DTD1	FVKHKHAFL is a linear peptidic epitope (epitope ID 1310425) tested in 7 T cell assays and 1 MHC ligand assay.	IEDB	1310425	3628	3636	FVKHKHAFL	ECO:0000213	PubMed	34968416
P0DTD1	FVKHKHAFL is a linear peptidic epitope (epitope ID 1310425) tested in 7 T cell assays and 1 MHC ligand assay.	IEDB	1310425	3628	3636	FVKHKHAFL	ECO:0000213	PubMed	32999467
P0DTD1	IEYPIIGDEL is a linear peptidic epitope (epitope ID 1310482) tested in 7 T cell assays and 1 MHC ligand assay.	IEDB	1310482	6219	6228	IEYPIIGDEL	ECO:0000213	PubMed	35484232
P0DTD1	IEYPIIGDEL is a linear peptidic epitope (epitope ID 1310482) tested in 7 T cell assays and 1 MHC ligand assay.	IEDB	1310482	6219	6228	IEYPIIGDEL	ECO:0000213	PubMed	36254196
P0DTD1	IEYPIIGDEL is a linear peptidic epitope (epitope ID 1310482) tested in 7 T cell assays and 1 MHC ligand assay.	IEDB	1310482	6219	6228	IEYPIIGDEL	ECO:0000213	PubMed	38387105
P0DTD1	IEYPIIGDEL is a linear peptidic epitope (epitope ID 1310482) tested in 7 T cell assays and 1 MHC ligand assay.	IEDB	1310482	6219	6228	IEYPIIGDEL	ECO:0000213	PubMed	32999467
P0DTD1	LDDFVEIIKSQDLSV is a linear peptidic epitope (epitope ID 1310564) tested in 3 T cell assays, 8 B cell assays and 4 MHC ligand assays.	IEDB	1310564	6751	6765	LDDFVEIIKSQDLSV	ECO:0000213	PubMed	32999467
P0DTD1	NYMPYFFTL is a linear peptidic epitope (epitope ID 1310703) tested in 15 T cell assays and 1 MHC ligand assay.	IEDB	1310703	2167	2175	NYMPYFFTL	ECO:0000213	PubMed	34793243
P0DTD1	NYMPYFFTL is a linear peptidic epitope (epitope ID 1310703) tested in 15 T cell assays and 1 MHC ligand assay.	IEDB	1310703	2167	2175	NYMPYFFTL	ECO:0000213	PubMed	33184509
P0DTD1	NYMPYFFTL is a linear peptidic epitope (epitope ID 1310703) tested in 15 T cell assays and 1 MHC ligand assay.	IEDB	1310703	2167	2175	NYMPYFFTL	ECO:0000213	PubMed	33427749
P0DTD1	TTDPSFLGRY is a linear peptidic epitope (epitope ID 1310872) tested in 51 T cell assays and 1 MHC ligand assay.	IEDB	1310872	1637	1646	TTDPSFLGRY	ECO:0000213	PubMed	36691482
P0DTD1	TTDPSFLGRY is a linear peptidic epitope (epitope ID 1310872) tested in 51 T cell assays and 1 MHC ligand assay.	IEDB	1310872	1637	1646	TTDPSFLGRY	ECO:0000213	PubMed	37036004
P0DTD1	TTDPSFLGRY is a linear peptidic epitope (epitope ID 1310872) tested in 51 T cell assays and 1 MHC ligand assay.	IEDB	1310872	1637	1646	TTDPSFLGRY	ECO:0000213	PubMed	38387105
P0DTD1	TTDPSFLGRY is a linear peptidic epitope (epitope ID 1310872) tested in 51 T cell assays and 1 MHC ligand assay.	IEDB	1310872	1637	1646	TTDPSFLGRY	ECO:0000213	PubMed	32999467
P0DTD1	TTDPSFLGRY is a linear peptidic epitope (epitope ID 1310872) tested in 51 T cell assays and 1 MHC ligand assay.	IEDB	1310872	1637	1646	TTDPSFLGRY	ECO:0000213	PubMed	33128877
P0DTD1	TTDPSFLGRY is a linear peptidic epitope (epitope ID 1310872) tested in 51 T cell assays and 1 MHC ligand assay.	IEDB	1310872	1637	1646	TTDPSFLGRY	ECO:0000213	PubMed	33972535
P0DTD1	TTDPSFLGRY is a linear peptidic epitope (epitope ID 1310872) tested in 51 T cell assays and 1 MHC ligand assay.	IEDB	1310872	1637	1646	TTDPSFLGRY	ECO:0000213	PubMed	33853928
P0DTD1	TTDPSFLGRY is a linear peptidic epitope (epitope ID 1310872) tested in 51 T cell assays and 1 MHC ligand assay.	IEDB	1310872	1637	1646	TTDPSFLGRY	ECO:0000213	PubMed	35699447
P0DTD1	DTDFVNEFY is a linear peptidic epitope (epitope ID 1311144) tested in 30 T cell assays and 2 MHC ligand assays.	IEDB	1311144	5130	5138	DTDFVNEFY	ECO:0000213	PubMed	34793243
P0DTD1	DTDFVNEFY is a linear peptidic epitope (epitope ID 1311144) tested in 30 T cell assays and 2 MHC ligand assays.	IEDB	1311144	5130	5138	DTDFVNEFY	ECO:0000213	PubMed	34968416
P0DTD1	DTDFVNEFY is a linear peptidic epitope (epitope ID 1311144) tested in 30 T cell assays and 2 MHC ligand assays.	IEDB	1311144	5130	5138	DTDFVNEFY	ECO:0000213	PubMed	35196796
P0DTD1	DTDFVNEFY is a linear peptidic epitope (epitope ID 1311144) tested in 30 T cell assays and 2 MHC ligand assays.	IEDB	1311144	5130	5138	DTDFVNEFY	ECO:0000213	PubMed	35383307
P0DTD1	DTDFVNEFY is a linear peptidic epitope (epitope ID 1311144) tested in 30 T cell assays and 2 MHC ligand assays.	IEDB	1311144	5130	5138	DTDFVNEFY	ECO:0000213	PubMed	35389886
P0DTD1	DTDFVNEFY is a linear peptidic epitope (epitope ID 1311144) tested in 30 T cell assays and 2 MHC ligand assays.	IEDB	1311144	5130	5138	DTDFVNEFY	ECO:0000213	PubMed	36691482
P0DTD1	DTDFVNEFY is a linear peptidic epitope (epitope ID 1311144) tested in 30 T cell assays and 2 MHC ligand assays.	IEDB	1311144	5130	5138	DTDFVNEFY	ECO:0000213	PubMed	33128877
P0DTD1	DTDFVNEFY is a linear peptidic epitope (epitope ID 1311144) tested in 30 T cell assays and 2 MHC ligand assays.	IEDB	1311144	5130	5138	DTDFVNEFY	ECO:0000213	PubMed	33184509
P0DTD1	DTDFVNEFY is a linear peptidic epitope (epitope ID 1311144) tested in 30 T cell assays and 2 MHC ligand assays.	IEDB	1311144	5130	5138	DTDFVNEFY	ECO:0000213	PubMed	33972535
P0DTD1	DTDFVNEFY is a linear peptidic epitope (epitope ID 1311144) tested in 30 T cell assays and 2 MHC ligand assays.	IEDB	1311144	5130	5138	DTDFVNEFY	ECO:0000213	PubMed	33427749
P0DTD1	GTDLEGNFY is a linear peptidic epitope (epitope ID 1311156) tested in 15 T cell assays and 2 MHC ligand assays.	IEDB	1311156	3437	3445	GTDLEGNFY	ECO:0000213	PubMed	34793243
P0DTD1	GTDLEGNFY is a linear peptidic epitope (epitope ID 1311156) tested in 15 T cell assays and 2 MHC ligand assays.	IEDB	1311156	3437	3445	GTDLEGNFY	ECO:0000213	PubMed	34968416
P0DTD1	GTDLEGNFY is a linear peptidic epitope (epitope ID 1311156) tested in 15 T cell assays and 2 MHC ligand assays.	IEDB	1311156	3437	3445	GTDLEGNFY	ECO:0000213	PubMed	36691482
P0DTD1	GTDLEGNFY is a linear peptidic epitope (epitope ID 1311156) tested in 15 T cell assays and 2 MHC ligand assays.	IEDB	1311156	3437	3445	GTDLEGNFY	ECO:0000213	PubMed	33128877
P0DTD1	GTDLEGNFY is a linear peptidic epitope (epitope ID 1311156) tested in 15 T cell assays and 2 MHC ligand assays.	IEDB	1311156	3437	3445	GTDLEGNFY	ECO:0000213	PubMed	33427749
P0DTD1	KTIQPRVEK is a linear peptidic epitope (epitope ID 1311176) tested in 13 T cell assays and 3 MHC ligand assays.	IEDB	1311176	282	290	KTIQPRVEK	ECO:0000213	PubMed	34968416
P0DTD1	KTIQPRVEK is a linear peptidic epitope (epitope ID 1311176) tested in 13 T cell assays and 3 MHC ligand assays.	IEDB	1311176	282	290	KTIQPRVEK	ECO:0000213	PubMed	33128877
P0DTD1	KTIQPRVEK is a linear peptidic epitope (epitope ID 1311176) tested in 13 T cell assays and 3 MHC ligand assays.	IEDB	1311176	282	290	KTIQPRVEK	ECO:0000213	PubMed	33427749
P0DTD1	NTCDGTTFTY is a linear peptidic epitope (epitope ID 1311195) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1311195	4082	4091	NTCDGTTFTY	ECO:0000213	PubMed	36691482
P0DTD1	NTCDGTTFTY is a linear peptidic epitope (epitope ID 1311195) tested in 9 T cell assays and 1 MHC ligand assay.	IEDB	1311195	4082	4091	NTCDGTTFTY	ECO:0000213	PubMed	33128877
P0DTD1	PTDNYITTY is a linear peptidic epitope (epitope ID 1311201) tested in 25 T cell assays and 2 MHC ligand assays.	IEDB	1311201	1321	1329	PTDNYITTY	ECO:0000213	PubMed	34793243
P0DTD1	PTDNYITTY is a linear peptidic epitope (epitope ID 1311201) tested in 25 T cell assays and 2 MHC ligand assays.	IEDB	1311201	1321	1329	PTDNYITTY	ECO:0000213	PubMed	36691482
P0DTD1	PTDNYITTY is a linear peptidic epitope (epitope ID 1311201) tested in 25 T cell assays and 2 MHC ligand assays.	IEDB	1311201	1321	1329	PTDNYITTY	ECO:0000213	PubMed	38387105
P0DTD1	PTDNYITTY is a linear peptidic epitope (epitope ID 1311201) tested in 25 T cell assays and 2 MHC ligand assays.	IEDB	1311201	1321	1329	PTDNYITTY	ECO:0000213	PubMed	33128877
P0DTD1	PTDNYITTY is a linear peptidic epitope (epitope ID 1311201) tested in 25 T cell assays and 2 MHC ligand assays.	IEDB	1311201	1321	1329	PTDNYITTY	ECO:0000213	PubMed	33972535
P0DTD1	PTDNYITTY is a linear peptidic epitope (epitope ID 1311201) tested in 25 T cell assays and 2 MHC ligand assays.	IEDB	1311201	1321	1329	PTDNYITTY	ECO:0000213	PubMed	33427749
P0DTD1	PTDNYITTY is a linear peptidic epitope (epitope ID 1311201) tested in 25 T cell assays and 2 MHC ligand assays.	IEDB	1311201	1321	1329	PTDNYITTY	ECO:0000213	PubMed	33853928
P0DTD1	RPDTRYVL is a linear peptidic epitope (epitope ID 1311209) tested in 11 T cell assays and 1 MHC ligand assay.	IEDB	1311209	2949	2956	RPDTRYVL	ECO:0000213	PubMed	38387105
P0DTD1	RPDTRYVL is a linear peptidic epitope (epitope ID 1311209) tested in 11 T cell assays and 1 MHC ligand assay.	IEDB	1311209	2949	2956	RPDTRYVL	ECO:0000213	PubMed	33128877
P0DTD1	VTDTPKGPK is a linear peptidic epitope (epitope ID 1311231) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1311231	4216	4224	VTDTPKGPK	ECO:0000213	PubMed	33128877
P0DTD1	VTNNTFTLK is a linear peptidic epitope (epitope ID 1311232) tested in 15 T cell assays and 3 MHC ligand assays.	IEDB	1311232	808	816	VTNNTFTLK	ECO:0000213	PubMed	34968416
P0DTD1	VTNNTFTLK is a linear peptidic epitope (epitope ID 1311232) tested in 15 T cell assays and 3 MHC ligand assays.	IEDB	1311232	808	816	VTNNTFTLK	ECO:0000213	PubMed	33128877
P0DTD1	VTNNTFTLK is a linear peptidic epitope (epitope ID 1311232) tested in 15 T cell assays and 3 MHC ligand assays.	IEDB	1311232	808	816	VTNNTFTLK	ECO:0000213	PubMed	33427749
P0DTD1	YLFDESGEFKL is a linear peptidic epitope (epitope ID 1311238) tested in 14 T cell assays and 2 MHC ligand assays.	IEDB	1311238	906	916	YLFDESGEFKL	ECO:0000213	PubMed	36691482
P0DTD1	YLFDESGEFKL is a linear peptidic epitope (epitope ID 1311238) tested in 14 T cell assays and 2 MHC ligand assays.	IEDB	1311238	906	916	YLFDESGEFKL	ECO:0000213	PubMed	37193826
P0DTD1	YLFDESGEFKL is a linear peptidic epitope (epitope ID 1311238) tested in 14 T cell assays and 2 MHC ligand assays.	IEDB	1311238	906	916	YLFDESGEFKL	ECO:0000213	PubMed	33128877
P0DTD1	AEWFLAYIL is a linear peptidic epitope (epitope ID 1311551) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1311551	2325	2333	AEWFLAYIL	ECO:0000213	PubMed	33184509
P0DTD1	EEIAIILASF is a linear peptidic epitope (epitope ID 1311557) tested in 3 T cell assays.	IEDB	1311557	471	480	EEIAIILASF	ECO:0000213	PubMed	33184509
P0DTD1	FLAHIQWMV is a linear peptidic epitope (epitope ID 1311559) tested in 11 T cell assays and 3 MHC ligand assays.	IEDB	1311559	3122	3130	FLAHIQWMV	ECO:0000213	PubMed	34793243
P0DTD1	FLAHIQWMV is a linear peptidic epitope (epitope ID 1311559) tested in 11 T cell assays and 3 MHC ligand assays.	IEDB	1311559	3122	3130	FLAHIQWMV	ECO:0000213	PubMed	33853928
P0DTD1	GEAANFCAL is a linear peptidic epitope (epitope ID 1311563) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	1311563	1705	1713	GEAANFCAL	ECO:0000213	PubMed	35104433
P0DTD1	GEAANFCAL is a linear peptidic epitope (epitope ID 1311563) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	1311563	1705	1713	GEAANFCAL	ECO:0000213	PubMed	33184509
P0DTD1	GETLPTEVL is a linear peptidic epitope (epitope ID 1311564) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1311564	744	752	GETLPTEVL	ECO:0000213	PubMed	33184509
P0DTD1	GEVITFDNL is a linear peptidic epitope (epitope ID 1311565) tested in 5 T cell assays and 2 MHC ligand assays.	IEDB	1311565	1548	1556	GEVITFDNL	ECO:0000213	PubMed	33184509
P0DTD1	KQLIKVTLVF is a linear peptidic epitope (epitope ID 1311571) tested in 3 T cell assays.	IEDB	1311571	2771	2780	KQLIKVTLVF	ECO:0000213	PubMed	33184509
P0DTD1	LVQMAPISAM is a linear peptidic epitope (epitope ID 1311576) tested in 3 T cell assays.	IEDB	1311576	2371	2380	LVQMAPISAM	ECO:0000213	PubMed	33184509
P0DTD1	QEILGTVSW is a linear peptidic epitope (epitope ID 1311585) tested in 4 T cell assays.	IEDB	1311585	1365	1373	QEILGTVSW	ECO:0000213	PubMed	33184509
P0DTD1	SAFAMMFVK is a linear peptidic epitope (epitope ID 1311587) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	1311587	3622	3630	SAFAMMFVK	ECO:0000213	PubMed	33184509
P0DTD1	SAFAMMFVK is a linear peptidic epitope (epitope ID 1311587) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	1311587	3622	3630	SAFAMMFVK	ECO:0000213	PubMed	33427749
P0DTD1	STFNVPMEK is a linear peptidic epitope (epitope ID 1311591) tested in 11 T cell assays and 6 MHC ligand assays.	IEDB	1311591	2600	2608	STFNVPMEK	ECO:0000213	PubMed	34968416
P0DTD1	STFNVPMEK is a linear peptidic epitope (epitope ID 1311591) tested in 11 T cell assays and 6 MHC ligand assays.	IEDB	1311591	2600	2608	STFNVPMEK	ECO:0000213	PubMed	33184509
P0DTD1	STFNVPMEK is a linear peptidic epitope (epitope ID 1311591) tested in 11 T cell assays and 6 MHC ligand assays.	IEDB	1311591	2600	2608	STFNVPMEK	ECO:0000213	PubMed	33427749
P0DTD1	TEVVGDIIL is a linear peptidic epitope (epitope ID 1311592) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1311592	2069	2077	TEVVGDIIL	ECO:0000213	PubMed	33184509
P0DTD1	AIFYLITPV is a linear peptidic epitope (epitope ID 1311971) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1311971	2785	2793	AIFYLITPV	ECO:0000213	PubMed	34793243
P0DTD1	ALLSDLQDL is a linear peptidic epitope (epitope ID 1311973) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1311973	4183	4191	ALLSDLQDL	ECO:0000213	PubMed	34793243
P0DTD1	ALNLGETFV is a linear peptidic epitope (epitope ID 1311974) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1311974	702	710	ALNLGETFV	ECO:0000213	PubMed	34793243
P0DTD1	FITESKPSV is a linear peptidic epitope (epitope ID 1311987) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1311987	1214	1222	FITESKPSV	ECO:0000213	PubMed	34793243
P0DTD1	FITESKPSV is a linear peptidic epitope (epitope ID 1311987) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1311987	1214	1222	FITESKPSV	ECO:0000213	PubMed	37193826
P0DTD1	FLALCADSI is a linear peptidic epitope (epitope ID 1311988) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1311988	685	693	FLALCADSI	ECO:0000213	PubMed	34793243
P0DTD1	FLARGIVFM is a linear peptidic epitope (epitope ID 1311989) tested in 6 T cell assays and 2 MHC ligand assays.	IEDB	1311989	3753	3761	FLARGIVFM	ECO:0000213	PubMed	33853928
P0DTD1	FLRDGWEIV is a linear peptidic epitope (epitope ID 1311990) tested in 6 T cell assays and 1 MHC ligand assay.	IEDB	1311990	641	649	FLRDGWEIV	ECO:0000213	PubMed	34793243
P0DTD1	FLRDGWEIV is a linear peptidic epitope (epitope ID 1311990) tested in 6 T cell assays and 1 MHC ligand assay.	IEDB	1311990	641	649	FLRDGWEIV	ECO:0000213	PubMed	39456150
P0DTD1	GLLPPKNSI is a linear peptidic epitope (epitope ID 1311993) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1311993	3827	3835	GLLPPKNSI	ECO:0000213	PubMed	33853928
P0DTD1	GLNDNLLEI is a linear peptidic epitope (epitope ID 1311994) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1311994	445	453	GLNDNLLEI	ECO:0000213	PubMed	34793243
P0DTD1	GLVEVEKGV is a linear peptidic epitope (epitope ID 1311995) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1311995	52	60	GLVEVEKGV	ECO:0000213	PubMed	34793243
P0DTD1	IIWFLLLSV is a linear peptidic epitope (epitope ID 1311999) tested in 15 T cell assays and 3 MHC ligand assays.	IEDB	1311999	2230	2238	IIWFLLLSV	ECO:0000213	PubMed	34793243
P0DTD1	ILLLDQALV is a linear peptidic epitope (epitope ID 1312002) tested in 6 T cell assays and 2 MHC ligand assays.	IEDB	1312002	2569	2577	ILLLDQALV	ECO:0000213	PubMed	34793243
P0DTD1	ILLLDQALV is a linear peptidic epitope (epitope ID 1312002) tested in 6 T cell assays and 2 MHC ligand assays.	IEDB	1312002	2569	2577	ILLLDQALV	ECO:0000213	PubMed	37193826
P0DTD1	ILTSLLVLV is a linear peptidic epitope (epitope ID 1312003) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1312003	3587	3595	ILTSLLVLV	ECO:0000213	PubMed	34793243
P0DTD1	ILTSLLVLV is a linear peptidic epitope (epitope ID 1312003) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1312003	3587	3595	ILTSLLVLV	ECO:0000213	PubMed	33853928
P0DTD1	IVAGGIVAI is a linear peptidic epitope (epitope ID 1312004) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1312004	3047	3055	IVAGGIVAI	ECO:0000213	PubMed	34793243
P0DTD1	IVAGGIVAI is a linear peptidic epitope (epitope ID 1312004) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1312004	3047	3055	IVAGGIVAI	ECO:0000213	PubMed	33853928
P0DTD1	KLIEYTDFA is a linear peptidic epitope (epitope ID 1312007) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1312007	2901	2909	KLIEYTDFA	ECO:0000213	PubMed	34793243
P0DTD1	KLMPVCVET is a linear peptidic epitope (epitope ID 1312008) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1312008	1387	1395	KLMPVCVET	ECO:0000213	PubMed	34793243
P0DTD1	KLMPVCVET is a linear peptidic epitope (epitope ID 1312008) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1312008	1387	1395	KLMPVCVET	ECO:0000213	PubMed	37193826
P0DTD1	KLMPVCVET is a linear peptidic epitope (epitope ID 1312008) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1312008	1387	1395	KLMPVCVET	ECO:0000213	PubMed	33853928
P0DTD1	KLNEEIAII is a linear peptidic epitope (epitope ID 1312009) tested in 6 T cell assays and 1 MHC ligand assay.	IEDB	1312009	468	476	KLNEEIAII	ECO:0000213	PubMed	34793243
P0DTD1	KLNIKLLGV is a linear peptidic epitope (epitope ID 1312010) tested in 4 T cell assays and 2 MHC ligand assays.	IEDB	1312010	3839	3847	KLNIKLLGV	ECO:0000213	PubMed	34793243
P0DTD1	KLNIKLLGV is a linear peptidic epitope (epitope ID 1312010) tested in 4 T cell assays and 2 MHC ligand assays.	IEDB	1312010	3839	3847	KLNIKLLGV	ECO:0000213	PubMed	33853928
P0DTD1	LLFLMSFTV is a linear peptidic epitope (epitope ID 1312016) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1312016	3083	3091	LLFLMSFTV	ECO:0000213	PubMed	34793243
P0DTD1	LLLTILTSL is a linear peptidic epitope (epitope ID 1312018) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1312018	3583	3591	LLLTILTSL	ECO:0000213	PubMed	34793243
P0DTD1	LLSVCLGSL is a linear peptidic epitope (epitope ID 1312019) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1312019	2235	2243	LLSVCLGSL	ECO:0000213	PubMed	34793243
P0DTD1	LMWLIINLV is a linear peptidic epitope (epitope ID 1312020) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1312020	2364	2372	LMWLIINLV	ECO:0000213	PubMed	34793243
P0DTD1	MLAKALRKV is a linear peptidic epitope (epitope ID 1312022) tested in 8 T cell assays and 1 MHC ligand assay.	IEDB	1312022	1312	1320	MLAKALRKV	ECO:0000213	PubMed	34793243
P0DTD1	MLAKALRKV is a linear peptidic epitope (epitope ID 1312022) tested in 8 T cell assays and 1 MHC ligand assay.	IEDB	1312022	1312	1320	MLAKALRKV	ECO:0000213	PubMed	37193826
P0DTD1	MLFTMLRKL is a linear peptidic epitope (epitope ID 1312023) tested in 6 T cell assays and 2 MHC ligand assays.	IEDB	1312023	4032	4040	MLFTMLRKL	ECO:0000213	PubMed	34793243
P0DTD1	RIMTWLDMV is a linear peptidic epitope (epitope ID 1312030) tested in 7 T cell assays and 1 MHC ligand assay.	IEDB	1312030	3662	3670	RIMTWLDMV	ECO:0000213	PubMed	34793243
P0DTD1	RIMTWLDMV is a linear peptidic epitope (epitope ID 1312030) tested in 7 T cell assays and 1 MHC ligand assay.	IEDB	1312030	3662	3670	RIMTWLDMV	ECO:0000213	PubMed	33853928
P0DTD1	SLINTLNDL is a linear peptidic epitope (epitope ID 1312039) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1312039	1433	1441	SLINTLNDL	ECO:0000213	PubMed	34793243
P0DTD1	SLINTLNDL is a linear peptidic epitope (epitope ID 1312039) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1312039	1433	1441	SLINTLNDL	ECO:0000213	PubMed	33853928
P0DTD1	SLIYSTAAL is a linear peptidic epitope (epitope ID 1312040) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1312040	2242	2250	SLIYSTAAL	ECO:0000213	PubMed	34793243
P0DTD1	SLIYSTAAL is a linear peptidic epitope (epitope ID 1312040) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1312040	2242	2250	SLIYSTAAL	ECO:0000213	PubMed	37193826
P0DTD1	SLPGVFCGV is a linear peptidic epitope (epitope ID 1312041) tested in 16 T cell assays and 4 MHC ligand assays.	IEDB	1312041	3013	3021	SLPGVFCGV	ECO:0000213	PubMed	34793243
P0DTD1	SLPGVFCGV is a linear peptidic epitope (epitope ID 1312041) tested in 16 T cell assays and 4 MHC ligand assays.	IEDB	1312041	3013	3021	SLPGVFCGV	ECO:0000213	PubMed	33911008
P0DTD1	SLPGVFCGV is a linear peptidic epitope (epitope ID 1312041) tested in 16 T cell assays and 4 MHC ligand assays.	IEDB	1312041	3013	3021	SLPGVFCGV	ECO:0000213	PubMed	33853928
P0DTD1	SMQNCVLKL is a linear peptidic epitope (epitope ID 1312043) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1312043	3344	3352	SMQNCVLKL	ECO:0000213	PubMed	34793243
P0DTD1	TLSEQLDFI is a linear peptidic epitope (epitope ID 1312047) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1312047	214	222	TLSEQLDFI	ECO:0000213	PubMed	34793243
P0DTD1	TLSEQLDFI is a linear peptidic epitope (epitope ID 1312047) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1312047	214	222	TLSEQLDFI	ECO:0000213	PubMed	39456150
P0DTD1	TVYEKLKPV is a linear peptidic epitope (epitope ID 1312048) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1312048	619	627	TVYEKLKPV	ECO:0000213	PubMed	34793243
P0DTD1	TVYEKLKPV is a linear peptidic epitope (epitope ID 1312048) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1312048	619	627	TVYEKLKPV	ECO:0000213	PubMed	33853928
P0DTD1	VINGDRWFL is a linear peptidic epitope (epitope ID 1312052) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1312052	3475	3483	VINGDRWFL	ECO:0000213	PubMed	34793243
P0DTD1	VLLAPLLSA is a linear peptidic epitope (epitope ID 1312053) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1312053	1143	1151	VLLAPLLSA	ECO:0000213	PubMed	34793243
P0DTD1	VLLAPLLSA is a linear peptidic epitope (epitope ID 1312053) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1312053	1143	1151	VLLAPLLSA	ECO:0000213	PubMed	37193826
P0DTD1	VLLSMQGAV is a linear peptidic epitope (epitope ID 1312054) tested in 3 T cell assays and 2 MHC ligand assays.	IEDB	1312054	3917	3925	VLLSMQGAV	ECO:0000213	PubMed	34793243
P0DTD1	VLSEARQHL is a linear peptidic epitope (epitope ID 1312055) tested in 6 T cell assays and 1 MHC ligand assay.	IEDB	1312055	38	46	VLSEARQHL	ECO:0000213	PubMed	39456150
P0DTD1	VLSEARQHL is a linear peptidic epitope (epitope ID 1312055) tested in 6 T cell assays and 1 MHC ligand assay.	IEDB	1312055	38	46	VLSEARQHL	ECO:0000213	PubMed	33853928
P0DTD1	VMVELVAEL is a linear peptidic epitope (epitope ID 1312058) tested in 19 T cell assays and 4 MHC ligand assays.	IEDB	1312058	84	92	VMVELVAEL	ECO:0000213	PubMed	34627082
P0DTD1	VMVELVAEL is a linear peptidic epitope (epitope ID 1312058) tested in 19 T cell assays and 4 MHC ligand assays.	IEDB	1312058	84	92	VMVELVAEL	ECO:0000213	PubMed	34793243
P0DTD1	VMVELVAEL is a linear peptidic epitope (epitope ID 1312058) tested in 19 T cell assays and 4 MHC ligand assays.	IEDB	1312058	84	92	VMVELVAEL	ECO:0000213	PubMed	33911008
P0DTD1	WMVMFTPLV is a linear peptidic epitope (epitope ID 1312059) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1312059	3128	3136	WMVMFTPLV	ECO:0000213	PubMed	34793243
P0DTD1	YLASGGQPI is a linear peptidic epitope (epitope ID 1312061) tested in 11 T cell assays and 2 MHC ligand assays.	IEDB	1312061	4283	4291	YLASGGQPI	ECO:0000213	PubMed	33911008
P0DTD1	YLATALLTL is a linear peptidic epitope (epitope ID 1312062) tested in 20 T cell assays and 10 MHC ligand assays.	IEDB	1312062	1675	1683	YLATALLTL	ECO:0000213	PubMed	34627082
P0DTD1	YLATALLTL is a linear peptidic epitope (epitope ID 1312062) tested in 20 T cell assays and 10 MHC ligand assays.	IEDB	1312062	1675	1683	YLATALLTL	ECO:0000213	PubMed	33911008
P0DTD1	YLATALLTL is a linear peptidic epitope (epitope ID 1312062) tested in 20 T cell assays and 10 MHC ligand assays.	IEDB	1312062	1675	1683	YLATALLTL	ECO:0000213	PubMed	33427749
P0DTD1	YLATALLTL is a linear peptidic epitope (epitope ID 1312062) tested in 20 T cell assays and 10 MHC ligand assays.	IEDB	1312062	1675	1683	YLATALLTL	ECO:0000213	PubMed	33853928
P0DTD1	YLEGSVRVV is a linear peptidic epitope (epitope ID 1312063) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1312063	2968	2976	YLEGSVRVV	ECO:0000213	PubMed	34793243
P0DTD1	YLNSTNVTI is a linear peptidic epitope (epitope ID 1312064) tested in 8 T cell assays and 2 MHC ligand assays.	IEDB	1312064	2270	2278	YLNSTNVTI	ECO:0000213	PubMed	34793243
P0DTD1	YMPYFFTLL is a linear peptidic epitope (epitope ID 1312066) tested in 5 T cell assays and 2 MHC ligand assays.	IEDB	1312066	2168	2176	YMPYFFTLL	ECO:0000213	PubMed	34793243
P0DTD1	AELAKNVSL is a linear peptidic epitope (epitope ID 1312109) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1312109	2618	2626	AELAKNVSL	ECO:0000213	PubMed	35104433
P0DTD1	AESHVDTDL is a linear peptidic epitope (epitope ID 1312110) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1312110	4645	4653	AESHVDTDL	ECO:0000213	PubMed	35104433
P0DTD1	AGFSLWVYK is a linear peptidic epitope (epitope ID 1312119) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1312119	6429	6437	AGFSLWVYK	ECO:0000213	PubMed	33427749
P0DTD1	AVAKHDFFK is a linear peptidic epitope (epitope ID 1312231) tested in 4 T cell assays and 3 MHC ligand assays.	IEDB	1312231	4487	4495	AVAKHDFFK	ECO:0000213	PubMed	34728796
P0DTD1	AYILFTRFF is a linear peptidic epitope (epitope ID 1312250) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1312250	2330	2338	AYILFTRFF	ECO:0000213	PubMed	33853928
P0DTD1	FLTENLLLY is a linear peptidic epitope (epitope ID 1312466) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1312466	1248	1256	FLTENLLLY	ECO:0000213	PubMed	34793243
P0DTD1	GFDYVYNPF is a linear peptidic epitope (epitope ID 1312540) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1312540	6157	6165	GFDYVYNPF	ECO:0000213	PubMed	35104433
P0DTD1	HANEYRLYL is a linear peptidic epitope (epitope ID 1312637) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1312637	6412	6420	HANEYRLYL	ECO:0000213	PubMed	35104433
P0DTD1	IQITISSFK is a linear peptidic epitope (epitope ID 1312770) tested in 3 T cell assays and 2 MHC ligand assays.	IEDB	1312770	2307	2315	IQITISSFK	ECO:0000213	PubMed	33853928
P0DTD1	KLFDRYFKY is a linear peptidic epitope (epitope ID 1312859) tested in 11 T cell assays and 1 MHC ligand assay.	IEDB	1312859	4673	4681	KLFDRYFKY	ECO:0000213	PubMed	34968416
P0DTD1	KLFDRYFKY is a linear peptidic epitope (epitope ID 1312859) tested in 11 T cell assays and 1 MHC ligand assay.	IEDB	1312859	4673	4681	KLFDRYFKY	ECO:0000213	PubMed	33427749
P0DTD1	KLFDRYFKY is a linear peptidic epitope (epitope ID 1312859) tested in 11 T cell assays and 1 MHC ligand assay.	IEDB	1312859	4673	4681	KLFDRYFKY	ECO:0000213	PubMed	33853928
P0DTD1	KLKDCVMYA is a linear peptidic epitope (epitope ID 1312861) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1312861	3678	3686	KLKDCVMYA	ECO:0000213	PubMed	34793243
P0DTD1	KLKDCVMYA is a linear peptidic epitope (epitope ID 1312861) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1312861	3678	3686	KLKDCVMYA	ECO:0000213	PubMed	33853928
P0DTD1	KRVDWTIEY is a linear peptidic epitope (epitope ID 1312899) tested in 5 T cell assays and 12 MHC ligand assays.	IEDB	1312899	6213	6221	KRVDWTIEY	ECO:0000213	PubMed	34171305
P0DTD1	KRVDWTIEY is a linear peptidic epitope (epitope ID 1312899) tested in 5 T cell assays and 12 MHC ligand assays.	IEDB	1312899	6213	6221	KRVDWTIEY	ECO:0000213	PubMed	35104433
P0DTD1	MYASAVVLL is a linear peptidic epitope (epitope ID 1313188) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1313188	3684	3692	MYASAVVLL	ECO:0000213	PubMed	33853928
P0DTD1	NLIDSYFVV is a linear peptidic epitope (epitope ID 1313213) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1313213	4456	4464	NLIDSYFVV	ECO:0000213	PubMed	34793243
P0DTD1	NLIDSYFVV is a linear peptidic epitope (epitope ID 1313213) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1313213	4456	4464	NLIDSYFVV	ECO:0000213	PubMed	33427749
P0DTD1	NLLKDCPAV is a linear peptidic epitope (epitope ID 1313218) tested in 7 T cell assays and 6 MHC ligand assays.	IEDB	1313218	4480	4488	NLLKDCPAV	ECO:0000213	PubMed	34506741
P0DTD1	NLLKDCPAV is a linear peptidic epitope (epitope ID 1313218) tested in 7 T cell assays and 6 MHC ligand assays.	IEDB	1313218	4480	4488	NLLKDCPAV	ECO:0000213	PubMed	34728796
P0DTD1	NLLKDCPAV is a linear peptidic epitope (epitope ID 1313218) tested in 7 T cell assays and 6 MHC ligand assays.	IEDB	1313218	4480	4488	NLLKDCPAV	ECO:0000213	PubMed	34793243
P0DTD1	NLLKDCPAV is a linear peptidic epitope (epitope ID 1313218) tested in 7 T cell assays and 6 MHC ligand assays.	IEDB	1313218	4480	4488	NLLKDCPAV	ECO:0000213	PubMed	35937077
P0DTD1	NLLKDCPAV is a linear peptidic epitope (epitope ID 1313218) tested in 7 T cell assays and 6 MHC ligand assays.	IEDB	1313218	4480	4488	NLLKDCPAV	ECO:0000213	PubMed	38781962
P0DTD1	SYATHSDKF is a linear peptidic epitope (epitope ID 1313717) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1313717	6294	6302	SYATHSDKF	ECO:0000213	PubMed	33853928
P0DTD1	TISLAGSYK is a linear peptidic epitope (epitope ID 1313745) tested in 6 T cell assays and 2 MHC ligand assays.	IEDB	1313745	1504	1512	TISLAGSYK	ECO:0000213	PubMed	35104433
P0DTD1	TISLAGSYK is a linear peptidic epitope (epitope ID 1313745) tested in 6 T cell assays and 2 MHC ligand assays.	IEDB	1313745	1504	1512	TISLAGSYK	ECO:0000213	PubMed	33427749
P0DTD1	TYACWHHSI is a linear peptidic epitope (epitope ID 1313818) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1313818	6148	6156	TYACWHHSI	ECO:0000213	PubMed	34506741
P0DTD1	TYACWHHSI is a linear peptidic epitope (epitope ID 1313818) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1313818	6148	6156	TYACWHHSI	ECO:0000213	PubMed	35104433
P0DTD1	TYACWHHSI is a linear peptidic epitope (epitope ID 1313818) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1313818	6148	6156	TYACWHHSI	ECO:0000213	PubMed	33427749
P0DTD1	TYACWHHSI is a linear peptidic epitope (epitope ID 1313818) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1313818	6148	6156	TYACWHHSI	ECO:0000213	PubMed	33853928
P0DTD1	VQSTQWSLF is a linear peptidic epitope (epitope ID 1313916) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1313916	3595	3603	VQSTQWSLF	ECO:0000213	PubMed	33972535
P0DTD1	VTDVTQLYL is a linear peptidic epitope (epitope ID 1313923) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1313923	5381	5389	VTDVTQLYL	ECO:0000213	PubMed	34793243
P0DTD1	WSMATYYLF is a linear peptidic epitope (epitope ID 1313970) tested in 5 T cell assays and 1 MHC ligand assay.	IEDB	1313970	900	908	WSMATYYLF	ECO:0000213	PubMed	34793243
P0DTD1	YYKKDNSYF is a linear peptidic epitope (epitope ID 1314075) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1314075	1899	1907	YYKKDNSYF	ECO:0000213	PubMed	34793243
P0DTD1	YYKKDNSYF is a linear peptidic epitope (epitope ID 1314075) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1314075	1899	1907	YYKKDNSYF	ECO:0000213	PubMed	35104433
P0DTD1	YYTSNPTTF is a linear peptidic epitope (epitope ID 1314077) tested in 8 T cell assays and 2 MHC ligand assays.	IEDB	1314077	1536	1544	YYTSNPTTF	ECO:0000213	PubMed	34793243
P0DTD1	YYTSNPTTF is a linear peptidic epitope (epitope ID 1314077) tested in 8 T cell assays and 2 MHC ligand assays.	IEDB	1314077	1536	1544	YYTSNPTTF	ECO:0000213	PubMed	33427749
P0DTD1	YYTSNPTTF is a linear peptidic epitope (epitope ID 1314077) tested in 8 T cell assays and 2 MHC ligand assays.	IEDB	1314077	1536	1544	YYTSNPTTF	ECO:0000213	PubMed	33853928
P0DTD1	APYIVGDVV is a linear peptidic epitope (epitope ID 1314779) tested in 3 T cell assays.	IEDB	1314779	1283	1291	APYIVGDVV	ECO:0000213	PubMed	34793243
P0DTD1	ASFDNFKFV is a linear peptidic epitope (epitope ID 1314857) tested in 2 T cell assays.	IEDB	1314857	1923	1931	ASFDNFKFV	ECO:0000213	PubMed	33853928
P0DTD1	DYKHYTPSF is a linear peptidic epitope (epitope ID 1315668) tested in 4 T cell assays.	IEDB	1315668	1971	1979	DYKHYTPSF	ECO:0000213	PubMed	34793243
P0DTD1	DYKHYTPSF is a linear peptidic epitope (epitope ID 1315668) tested in 4 T cell assays.	IEDB	1315668	1971	1979	DYKHYTPSF	ECO:0000213	PubMed	33853928
P0DTD1	EIDPKLDNY is a linear peptidic epitope (epitope ID 1315808) tested in 5 T cell assays.	IEDB	1315808	1891	1899	EIDPKLDNY	ECO:0000213	PubMed	34793243
P0DTD1	FLYENAFLP is a linear peptidic epitope (epitope ID 1316758) tested in 2 T cell assays.	IEDB	1316758	3605	3613	FLYENAFLP	ECO:0000213	PubMed	34793243
P0DTD1	FPLKLRGTA is a linear peptidic epitope (epitope ID 1316850) tested in 5 T cell assays.	IEDB	1316850	7048	7056	FPLKLRGTA	ECO:0000213	PubMed	34793243
P0DTD1	ITDVFYKENSY is a linear peptidic epitope (epitope ID 1318987) tested in 3 T cell assays.	IEDB	1318987	1863	1873	ITDVFYKENSY	ECO:0000213	PubMed	33853928
P0DTD1	ITFDNLKTL is a linear peptidic epitope (epitope ID 1319002) tested in 2 T cell assays.	IEDB	1319002	1551	1559	ITFDNLKTL	ECO:0000213	PubMed	34793243
P0DTD1	KLINIIIWF is a linear peptidic epitope (epitope ID 1319654) tested in 2 T cell assays.	IEDB	1319654	2225	2233	KLINIIIWF	ECO:0000213	PubMed	34793243
P0DTD1	KPNELSRVL is a linear peptidic epitope (epitope ID 1319902) tested in 7 T cell assays.	IEDB	1319902	2109	2117	KPNELSRVL	ECO:0000213	PubMed	34793243
P0DTD1	KPNELSRVL is a linear peptidic epitope (epitope ID 1319902) tested in 7 T cell assays.	IEDB	1319902	2109	2117	KPNELSRVL	ECO:0000213	PubMed	34968416
P0DTD1	KPNELSRVL is a linear peptidic epitope (epitope ID 1319902) tested in 7 T cell assays.	IEDB	1319902	2109	2117	KPNELSRVL	ECO:0000213	PubMed	33853928
P0DTD1	LVAEWFLAY is a linear peptidic epitope (epitope ID 1321432) tested in 4 T cell assays.	IEDB	1321432	2323	2331	LVAEWFLAY	ECO:0000213	PubMed	34968416
P0DTD1	QVVDMSMTY is a linear peptidic epitope (epitope ID 1323646) tested in 2 T cell assays.	IEDB	1323646	1582	1590	QVVDMSMTY	ECO:0000213	PubMed	33853928
P0DTD1	TDNYITTY is a linear peptidic epitope (epitope ID 1325390) tested in 2 T cell assays.	IEDB	1325390	1322	1329	TDNYITTY	ECO:0000213	PubMed	33853928
P0DTD1	TEIDPKLDNYY is a linear peptidic epitope (epitope ID 1325414) tested in 2 T cell assays.	IEDB	1325414	1890	1900	TEIDPKLDNYY	ECO:0000213	PubMed	33853928
P0DTD1	TPHTVLQAV is a linear peptidic epitope (epitope ID 1325812) tested in 3 T cell assays.	IEDB	1325812	5318	5326	TPHTVLQAV	ECO:0000213	PubMed	34793243
P0DTD1	TTDPSFLGRYM is a linear peptidic epitope (epitope ID 1325944) tested in 3 T cell assays.	IEDB	1325944	1637	1647	TTDPSFLGRYM	ECO:0000213	PubMed	33853928
P0DTD1	VENPHLMGWD is a linear peptidic epitope (epitope ID 1326307) tested in 3 T cell assays.	IEDB	1326307	5001	5010	VENPHLMGWD	ECO:0000213	PubMed	35383307
P0DTD1	VPFWITIAY is a linear peptidic epitope (epitope ID 1326965) tested in 3 T cell assays.	IEDB	1326965	3136	3144	VPFWITIAY	ECO:0000213	PubMed	34968416
P0DTD1	VSSPDAVTAY is a linear peptidic epitope (epitope ID 1327124) tested in 2 T cell assays.	IEDB	1327124	1477	1486	VSSPDAVTAY	ECO:0000213	PubMed	33853928
P0DTD1	WLDMVDTSL is a linear peptidic epitope (epitope ID 1327781) tested in 5 T cell assays.	IEDB	1327781	3666	3674	WLDMVDTSL	ECO:0000213	PubMed	34793243
P0DTD1	YLPYPDPSRI is a linear peptidic epitope (epitope ID 1328306) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1328306	5220	5229	YLPYPDPSRI	ECO:0000213	PubMed	34728796
P0DTD1	YTTTIKPVTY is a linear peptidic epitope (epitope ID 1328829) tested in 4 T cell assays.	IEDB	1328829	1873	1882	YTTTIKPVTY	ECO:0000213	PubMed	33853928
P0DTD1	APKEIIFL is a linear peptidic epitope (epitope ID 1330421) tested in 4 T cell assays.	IEDB	1330421	735	742	APKEIIFL	ECO:0000213	PubMed	33853928
P0DTD1	AVFDKNLYDK is a linear peptidic epitope (epitope ID 1330429) tested in 3 T cell assays.	IEDB	1330429	1176	1185	AVFDKNLYDK	ECO:0000213	PubMed	33427749
P0DTD1	FIDTKRGVY is a linear peptidic epitope (epitope ID 1330450) tested in 2 T cell assays.	IEDB	1330450	221	229	FIDTKRGVY	ECO:0000213	PubMed	34793243
P0DTD1	FLKKDAPYI is a linear peptidic epitope (epitope ID 1330451) tested in 3 T cell assays.	IEDB	1330451	1278	1286	FLKKDAPYI	ECO:0000213	PubMed	34793243
P0DTD1	ILMTARTVY is a linear peptidic epitope (epitope ID 1330486) tested in 2 T cell assays.	IEDB	1330486	3693	3701	ILMTARTVY	ECO:0000213	PubMed	33972535
P0DTD1	IPARARVECF is a linear peptidic epitope (epitope ID 1330488) tested in 4 T cell assays.	IEDB	1330488	5658	5667	IPARARVECF	ECO:0000213	PubMed	33853928
P0DTD1	KIFVDGVPFV is a linear peptidic epitope (epitope ID 1330492) tested in 5 T cell assays and 2 MHC ligand assays.	IEDB	1330492	4724	4733	KIFVDGVPFV	ECO:0000213	PubMed	34728796
P0DTD1	KIFVDGVPFV is a linear peptidic epitope (epitope ID 1330492) tested in 5 T cell assays and 2 MHC ligand assays.	IEDB	1330492	4724	4733	KIFVDGVPFV	ECO:0000213	PubMed	35937077
P0DTD1	KIFVDGVPFV is a linear peptidic epitope (epitope ID 1330492) tested in 5 T cell assays and 2 MHC ligand assays.	IEDB	1330492	4724	4733	KIFVDGVPFV	ECO:0000213	PubMed	38781962
P0DTD1	KIFVDGVPFV is a linear peptidic epitope (epitope ID 1330492) tested in 5 T cell assays and 2 MHC ligand assays.	IEDB	1330492	4724	4733	KIFVDGVPFV	ECO:0000213	PubMed	33853928
P0DTD1	KLVNKFLAL is a linear peptidic epitope (epitope ID 1330500) tested in 6 T cell assays.	IEDB	1330500	680	688	KLVNKFLAL	ECO:0000213	PubMed	34793243
P0DTD1	KLVNKFLAL is a linear peptidic epitope (epitope ID 1330500) tested in 6 T cell assays.	IEDB	1330500	680	688	KLVNKFLAL	ECO:0000213	PubMed	33853928
P0DTD1	KPVPEVKIL is a linear peptidic epitope (epitope ID 1330507) tested in 2 T cell assays.	IEDB	1330507	6516	6524	KPVPEVKIL	ECO:0000213	PubMed	34793243
P0DTD1	KPYIKWDLL is a linear peptidic epitope (epitope ID 1330508) tested in 5 T cell assays.	IEDB	1330508	4655	4663	KPYIKWDLL	ECO:0000213	PubMed	34793243
P0DTD1	KPYIKWDLL is a linear peptidic epitope (epitope ID 1330508) tested in 5 T cell assays.	IEDB	1330508	4655	4663	KPYIKWDLL	ECO:0000213	PubMed	33853928
P0DTD1	LLADKFPVL is a linear peptidic epitope (epitope ID 1330519) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1330519	6246	6254	LLADKFPVL	ECO:0000213	PubMed	34627082
P0DTD1	LLADKFPVL is a linear peptidic epitope (epitope ID 1330519) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1330519	6246	6254	LLADKFPVL	ECO:0000213	PubMed	33853928
P0DTD1	LPKGIMMNV is a linear peptidic epitope (epitope ID 1330521) tested in 5 T cell assays.	IEDB	1330521	6834	6842	LPKGIMMNV	ECO:0000213	PubMed	34793243
P0DTD1	LPKGIMMNV is a linear peptidic epitope (epitope ID 1330521) tested in 5 T cell assays.	IEDB	1330521	6834	6842	LPKGIMMNV	ECO:0000213	PubMed	33853928
P0DTD1	MFLARGIVF is a linear peptidic epitope (epitope ID 1330527) tested in 3 T cell assays.	IEDB	1330527	3752	3760	MFLARGIVF	ECO:0000213	PubMed	34793243
P0DTD1	MLDMYSVML is a linear peptidic epitope (epitope ID 1330528) tested in 7 T cell assays and 3 MHC ligand assays.	IEDB	1330528	5291	5299	MLDMYSVML	ECO:0000213	PubMed	34728796
P0DTD1	MLDMYSVML is a linear peptidic epitope (epitope ID 1330528) tested in 7 T cell assays and 3 MHC ligand assays.	IEDB	1330528	5291	5299	MLDMYSVML	ECO:0000213	PubMed	34793243
P0DTD1	MLSDTLKNL is a linear peptidic epitope (epitope ID 1330529) tested in 2 T cell assays.	IEDB	1330529	6094	6102	MLSDTLKNL	ECO:0000213	PubMed	34793243
P0DTD1	MPYFFTLLL is a linear peptidic epitope (epitope ID 1330532) tested in 2 T cell assays.	IEDB	1330532	2169	2177	MPYFFTLLL	ECO:0000213	PubMed	34793243
P0DTD1	NLSDRVVFV is a linear peptidic epitope (epitope ID 1330540) tested in 3 T cell assays.	IEDB	1330540	6101	6109	NLSDRVVFV	ECO:0000213	PubMed	34793243
P0DTD1	QGYKSVNITF is a linear peptidic epitope (epitope ID 1330556) tested in 2 T cell assays.	IEDB	1330556	834	843	QGYKSVNITF	ECO:0000213	PubMed	33853928
P0DTD1	QPGQTFSVL is a linear peptidic epitope (epitope ID 1330560) tested in 7 T cell assays and 2 MHC ligand assays.	IEDB	1330560	3370	3378	QPGQTFSVL	ECO:0000213	PubMed	34793243
P0DTD1	QPGQTFSVL is a linear peptidic epitope (epitope ID 1330560) tested in 7 T cell assays and 2 MHC ligand assays.	IEDB	1330560	3370	3378	QPGQTFSVL	ECO:0000213	PubMed	33427749
P0DTD1	RLANECAQV is a linear peptidic epitope (epitope ID 1330571) tested in 7 T cell assays and 3 MHC ligand assays.	IEDB	1330571	5046	5054	RLANECAQV	ECO:0000213	PubMed	34728796
P0DTD1	RLANECAQV is a linear peptidic epitope (epitope ID 1330571) tested in 7 T cell assays and 3 MHC ligand assays.	IEDB	1330571	5046	5054	RLANECAQV	ECO:0000213	PubMed	34793243
P0DTD1	RLANECAQV is a linear peptidic epitope (epitope ID 1330571) tested in 7 T cell assays and 3 MHC ligand assays.	IEDB	1330571	5046	5054	RLANECAQV	ECO:0000213	PubMed	35937077
P0DTD1	RLANECAQV is a linear peptidic epitope (epitope ID 1330571) tested in 7 T cell assays and 3 MHC ligand assays.	IEDB	1330571	5046	5054	RLANECAQV	ECO:0000213	PubMed	33853928
P0DTD1	RLIDAMMFT is a linear peptidic epitope (epitope ID 1330573) tested in 3 T cell assays.	IEDB	1330573	579	587	RLIDAMMFT	ECO:0000213	PubMed	39456150
P0DTD1	RLIDAMMFT is a linear peptidic epitope (epitope ID 1330573) tested in 3 T cell assays.	IEDB	1330573	579	587	RLIDAMMFT	ECO:0000213	PubMed	33853928
P0DTD1	RPQIGVVREF is a linear peptidic epitope (epitope ID 1330579) tested in 3 T cell assays.	IEDB	1330579	5814	5823	RPQIGVVREF	ECO:0000213	PubMed	33853928
P0DTD1	SLENVAFNV is a linear peptidic epitope (epitope ID 1330587) tested in 9 T cell assays.	IEDB	1330587	6453	6461	SLENVAFNV	ECO:0000213	PubMed	34506741
P0DTD1	SLENVAFNV is a linear peptidic epitope (epitope ID 1330587) tested in 9 T cell assays.	IEDB	1330587	6453	6461	SLENVAFNV	ECO:0000213	PubMed	34793243
P0DTD1	SLENVAFNV is a linear peptidic epitope (epitope ID 1330587) tested in 9 T cell assays.	IEDB	1330587	6453	6461	SLENVAFNV	ECO:0000213	PubMed	33853928
P0DTD1	SLLMPILTL is a linear peptidic epitope (epitope ID 1330588) tested in 11 T cell assays and 1 MHC ligand assay.	IEDB	1330588	4631	4639	SLLMPILTL	ECO:0000213	PubMed	34793243
P0DTD1	SLLMPILTL is a linear peptidic epitope (epitope ID 1330588) tested in 11 T cell assays and 1 MHC ligand assay.	IEDB	1330588	4631	4639	SLLMPILTL	ECO:0000213	PubMed	34919800
P0DTD1	SLLMPILTL is a linear peptidic epitope (epitope ID 1330588) tested in 11 T cell assays and 1 MHC ligand assay.	IEDB	1330588	4631	4639	SLLMPILTL	ECO:0000213	PubMed	33853928
P0DTD1	SPNLAWPLI is a linear peptidic epitope (epitope ID 1330595) tested in 2 T cell assays.	IEDB	1330595	4119	4127	SPNLAWPLI	ECO:0000213	PubMed	34793243
P0DTD1	SQLGGLHLL is a linear peptidic epitope (epitope ID 1330599) tested in 2 T cell assays.	IEDB	1330599	6695	6703	SQLGGLHLL	ECO:0000213	PubMed	34793243
P0DTD1	SYFVVKRHTF is a linear peptidic epitope (epitope ID 1330608) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1330608	4460	4469	SYFVVKRHTF	ECO:0000213	PubMed	34728796
P0DTD1	TLNDLNETL is a linear peptidic epitope (epitope ID 1330621) tested in 2 T cell assays.	IEDB	1330621	1437	1445	TLNDLNETL	ECO:0000213	PubMed	34793243
P0DTD1	TPAFDKSAF is a linear peptidic epitope (epitope ID 1330622) tested in 2 T cell assays.	IEDB	1330622	6353	6361	TPAFDKSAF	ECO:0000213	PubMed	34793243
P0DTD1	TSEDMLNPNY is a linear peptidic epitope (epitope ID 1330632) tested in 3 T cell assays.	IEDB	1330632	3308	3317	TSEDMLNPNY	ECO:0000213	PubMed	33853928
P0DTD1	VAKSHNIAL is a linear peptidic epitope (epitope ID 1330641) tested in 4 T cell assays.	IEDB	1330641	2703	2711	VAKSHNIAL	ECO:0000213	PubMed	33853928
P0DTD1	YDYLVSTQEF is a linear peptidic epitope (epitope ID 1330657) tested in 2 T cell assays.	IEDB	1330657	3811	3820	YDYLVSTQEF	ECO:0000213	PubMed	33853928
P0DTD1	YLITPVHVM is a linear peptidic epitope (epitope ID 1330659) tested in 7 T cell assays.	IEDB	1330659	2788	2796	YLITPVHVM	ECO:0000213	PubMed	33853928
P0DTD1	YLPYPDPSRIL is a linear peptidic epitope (epitope ID 1330660) tested in 3 T cell assays.	IEDB	1330660	5220	5230	YLPYPDPSRIL	ECO:0000213	PubMed	33853928
P0DTD1	YTERSEKSY is a linear peptidic epitope (epitope ID 1330663) tested in 3 T cell assays.	IEDB	1330663	241	249	YTERSEKSY	ECO:0000213	PubMed	34793243
P0DTD1	YVWKSYVHV is a linear peptidic epitope (epitope ID 1330664) tested in 4 T cell assays.	IEDB	1330664	2392	2400	YVWKSYVHV	ECO:0000213	PubMed	34793243
P0DTD1	YVWKSYVHV is a linear peptidic epitope (epitope ID 1330664) tested in 4 T cell assays.	IEDB	1330664	2392	2400	YVWKSYVHV	ECO:0000213	PubMed	37193826
P0DTD1	AHAEETRKL is a linear peptidic epitope (epitope ID 1330826) tested in 1 T cell assay.	IEDB	1330826	1380	1388	AHAEETRKL	ECO:0000213	PubMed	33853928
P0DTD1	AIVSTIQRKYK is a linear peptidic epitope (epitope ID 1330848) tested in 1 T cell assay.	IEDB	1330848	1397	1407	AIVSTIQRKYK	ECO:0000213	PubMed	33853928
P0DTD1	ALRKVPTDNY is a linear peptidic epitope (epitope ID 1330905) tested in 1 T cell assay.	IEDB	1330905	1316	1325	ALRKVPTDNY	ECO:0000213	PubMed	33853928
P0DTD1	APTLVPQEHYV is a linear peptidic epitope (epitope ID 1330999) tested in 1 T cell assay.	IEDB	1330999	5561	5571	APTLVPQEHYV	ECO:0000213	PubMed	33853928
P0DTD1	ARAGEAANF is a linear peptidic epitope (epitope ID 1331010) tested in 1 T cell assay.	IEDB	1331010	1702	1710	ARAGEAANF	ECO:0000213	PubMed	33853928
P0DTD1	ARLYYDSMSY is a linear peptidic epitope (epitope ID 1331013) tested in 1 T cell assay.	IEDB	1331013	4904	4913	ARLYYDSMSY	ECO:0000213	PubMed	33853928
P0DTD1	AVASKILGL is a linear peptidic epitope (epitope ID 1331069) tested in 3 T cell assays.	IEDB	1331069	5844	5852	AVASKILGL	ECO:0000213	PubMed	34793243
P0DTD1	AVASKILGL is a linear peptidic epitope (epitope ID 1331069) tested in 3 T cell assays.	IEDB	1331069	5844	5852	AVASKILGL	ECO:0000213	PubMed	33853928
P0DTD1	CLEASFNYL is a linear peptidic epitope (epitope ID 1331131) tested in 11 T cell assays and 1 MHC ligand assay.	IEDB	1331131	2210	2218	CLEASFNYL	ECO:0000213	PubMed	34793243
P0DTD1	CLEASFNYL is a linear peptidic epitope (epitope ID 1331131) tested in 11 T cell assays and 1 MHC ligand assay.	IEDB	1331131	2210	2218	CLEASFNYL	ECO:0000213	PubMed	33911008
P0DTD1	CTEIDPKLDNY is a linear peptidic epitope (epitope ID 1331147) tested in 6 T cell assays.	IEDB	1331147	1889	1899	CTEIDPKLDNY	ECO:0000213	PubMed	33853928
P0DTD1	DDYQGKPLEF is a linear peptidic epitope (epitope ID 1331178) tested in 1 T cell assay.	IEDB	1331178	953	962	DDYQGKPLEF	ECO:0000213	PubMed	33853928
P0DTD1	DSCNNYMLTY is a linear peptidic epitope (epitope ID 1331337) tested in 1 T cell assay.	IEDB	1331337	2668	2677	DSCNNYMLTY	ECO:0000213	PubMed	33853928
P0DTD1	EIKESVQTF is a linear peptidic epitope (epitope ID 1331598) tested in 5 T cell assays and 10 MHC ligand assays.	IEDB	1331598	670	678	EIKESVQTF	ECO:0000213	PubMed	33853928
P0DTD1	ELDERIDKV is a linear peptidic epitope (epitope ID 1331626) tested in 1 T cell assay.	IEDB	1331626	844	852	ELDERIDKV	ECO:0000213	PubMed	33853928
P0DTD1	ERHSLSHFV is a linear peptidic epitope (epitope ID 1331695) tested in 1 T cell assay.	IEDB	1331695	2514	2522	ERHSLSHFV	ECO:0000213	PubMed	33853928
P0DTD1	FAIGLALYY is a linear peptidic epitope (epitope ID 1331931) tested in 2 T cell assays.	IEDB	1331931	5615	5623	FAIGLALYY	ECO:0000213	PubMed	33853928
P0DTD1	FDIYNDKVAGF is a linear peptidic epitope (epitope ID 1331941) tested in 1 T cell assay.	IEDB	1331941	4427	4437	FDIYNDKVAGF	ECO:0000213	PubMed	33853928
P0DTD1	FEYYHTTDPSF is a linear peptidic epitope (epitope ID 1331946) tested in 1 T cell assay.	IEDB	1331946	1632	1642	FEYYHTTDPSF	ECO:0000213	PubMed	33853928
P0DTD1	FIERYKLEGY is a linear peptidic epitope (epitope ID 1331952) tested in 1 T cell assay.	IEDB	1331952	6673	6682	FIERYKLEGY	ECO:0000213	PubMed	33853928
P0DTD1	FIPMDSTVKNY is a linear peptidic epitope (epitope ID 1331953) tested in 1 T cell assay.	IEDB	1331953	6720	6730	FIPMDSTVKNY	ECO:0000213	PubMed	33853928
P0DTD1	FLLPSLATVA is a linear peptidic epitope (epitope ID 1331968) tested in 1 T cell assay.	IEDB	1331968	3639	3648	FLLPSLATVA	ECO:0000213	PubMed	33853928
P0DTD1	FLTENLLLYI is a linear peptidic epitope (epitope ID 1331972) tested in 3 T cell assays.	IEDB	1331972	1248	1257	FLTENLLLYI	ECO:0000213	PubMed	37193826
P0DTD1	FLTENLLLYI is a linear peptidic epitope (epitope ID 1331972) tested in 3 T cell assays.	IEDB	1331972	1248	1257	FLTENLLLYI	ECO:0000213	PubMed	39456150
P0DTD1	FLTENLLLYI is a linear peptidic epitope (epitope ID 1331972) tested in 3 T cell assays.	IEDB	1331972	1248	1257	FLTENLLLYI	ECO:0000213	PubMed	33853928
P0DTD1	FLYENAFLPFA is a linear peptidic epitope (epitope ID 1331974) tested in 1 T cell assay.	IEDB	1331974	3605	3615	FLYENAFLPFA	ECO:0000213	PubMed	33853928
P0DTD1	FTCASEYTGNY is a linear peptidic epitope (epitope ID 1332000) tested in 1 T cell assay.	IEDB	1332000	1821	1831	FTCASEYTGNY	ECO:0000213	PubMed	33853928
P0DTD1	FVNEFYAYL is a linear peptidic epitope (epitope ID 1332008) tested in 8 T cell assays and 3 MHC ligand assays.	IEDB	1332008	5133	5141	FVNEFYAYL	ECO:0000213	PubMed	34728796
P0DTD1	FVNEFYAYL is a linear peptidic epitope (epitope ID 1332008) tested in 8 T cell assays and 3 MHC ligand assays.	IEDB	1332008	5133	5141	FVNEFYAYL	ECO:0000213	PubMed	34793243
P0DTD1	FVNEFYAYL is a linear peptidic epitope (epitope ID 1332008) tested in 8 T cell assays and 3 MHC ligand assays.	IEDB	1332008	5133	5141	FVNEFYAYL	ECO:0000213	PubMed	35937077
P0DTD1	FVNEFYAYL is a linear peptidic epitope (epitope ID 1332008) tested in 8 T cell assays and 3 MHC ligand assays.	IEDB	1332008	5133	5141	FVNEFYAYL	ECO:0000213	PubMed	33853928
P0DTD1	FVVEVVDKY is a linear peptidic epitope (epitope ID 1332011) tested in 1 T cell assay.	IEDB	1332011	4863	4871	FVVEVVDKY	ECO:0000213	PubMed	33853928
P0DTD1	FWRNTNPIQL is a linear peptidic epitope (epitope ID 1332012) tested in 1 T cell assay.	IEDB	1332012	7028	7037	FWRNTNPIQL	ECO:0000213	PubMed	33853928
P0DTD1	FYLITPVHV is a linear peptidic epitope (epitope ID 1332014) tested in 1 T cell assay.	IEDB	1332014	2787	2795	FYLITPVHV	ECO:0000213	PubMed	33853928
P0DTD1	FYYVWKSY is a linear peptidic epitope (epitope ID 1332015) tested in 1 T cell assay.	IEDB	1332015	2390	2397	FYYVWKSY	ECO:0000213	PubMed	33853928
P0DTD1	FYYVWKSYV is a linear peptidic epitope (epitope ID 1332016) tested in 2 T cell assays.	IEDB	1332016	2390	2398	FYYVWKSYV	ECO:0000213	PubMed	33853928
P0DTD1	GFMGRIRSV is a linear peptidic epitope (epitope ID 1332037) tested in 1 T cell assay.	IEDB	1332037	295	303	GFMGRIRSV	ECO:0000213	PubMed	33853928
P0DTD1	GRVDGQVDL is a linear peptidic epitope (epitope ID 1332159) tested in 1 T cell assay.	IEDB	1332159	6577	6585	GRVDGQVDL	ECO:0000213	PubMed	33853928
P0DTD1	HFISNSWLMW is a linear peptidic epitope (epitope ID 1332236) tested in 1 T cell assay.	IEDB	1332236	2357	2366	HFISNSWLMW	ECO:0000213	PubMed	33853928
P0DTD1	HLDGEVITF is a linear peptidic epitope (epitope ID 1332250) tested in 1 T cell assay.	IEDB	1332250	1545	1553	HLDGEVITF	ECO:0000213	PubMed	33853928
P0DTD1	HLKDGTCGL is a linear peptidic epitope (epitope ID 1332257) tested in 1 T cell assay.	IEDB	1332257	45	53	HLKDGTCGL	ECO:0000213	PubMed	33853928
P0DTD1	HTQVVDMSMTY is a linear peptidic epitope (epitope ID 1332293) tested in 1 T cell assay.	IEDB	1332293	1580	1590	HTQVVDMSMTY	ECO:0000213	PubMed	33853928
P0DTD1	HVDTDLTKPY is a linear peptidic epitope (epitope ID 1332297) tested in 1 T cell assay.	IEDB	1332297	4648	4657	HVDTDLTKPY	ECO:0000213	PubMed	33853928
P0DTD1	HVGEIPVAY is a linear peptidic epitope (epitope ID 1332299) tested in 3 T cell assays.	IEDB	1332299	110	118	HVGEIPVAY	ECO:0000213	PubMed	33853928
P0DTD1	IFFITGNTL is a linear peptidic epitope (epitope ID 1332346) tested in 3 T cell assays.	IEDB	1332346	3768	3776	IFFITGNTL	ECO:0000213	PubMed	34793243
P0DTD1	IFFITGNTL is a linear peptidic epitope (epitope ID 1332346) tested in 3 T cell assays.	IEDB	1332346	3768	3776	IFFITGNTL	ECO:0000213	PubMed	33853928
P0DTD1	ILSPLYAFA is a linear peptidic epitope (epitope ID 1332376) tested in 2 T cell assays.	IEDB	1332376	529	537	ILSPLYAFA	ECO:0000213	PubMed	33853928
P0DTD1	IPARARVEC is a linear peptidic epitope (epitope ID 1332388) tested in 4 T cell assays.	IEDB	1332388	5658	5666	IPARARVEC	ECO:0000213	PubMed	34793243
P0DTD1	IPARARVEC is a linear peptidic epitope (epitope ID 1332388) tested in 4 T cell assays.	IEDB	1332388	5658	5666	IPARARVEC	ECO:0000213	PubMed	33853928
P0DTD1	IPVAYRKVLL is a linear peptidic epitope (epitope ID 1332394) tested in 3 T cell assays.	IEDB	1332394	114	123	IPVAYRKVLL	ECO:0000213	PubMed	33853928
P0DTD1	ITILDGISQY is a linear peptidic epitope (epitope ID 1332428) tested in 1 T cell assay.	IEDB	1332428	567	576	ITILDGISQY	ECO:0000213	PubMed	33853928
P0DTD1	KFADDLNQL is a linear peptidic epitope (epitope ID 1332461) tested in 1 T cell assay.	IEDB	1332461	1936	1944	KFADDLNQL	ECO:0000213	PubMed	33853928
P0DTD1	KIAEIPKEEV is a linear peptidic epitope (epitope ID 1332471) tested in 1 T cell assay.	IEDB	1332471	1202	1211	KIAEIPKEEV	ECO:0000213	PubMed	33853928
P0DTD1	KLLHKPIVWHV is a linear peptidic epitope (epitope ID 1332489) tested in 2 T cell assays.	IEDB	1332489	1984	1994	KLLHKPIVWHV	ECO:0000213	PubMed	37193826
P0DTD1	KLLHKPIVWHV is a linear peptidic epitope (epitope ID 1332489) tested in 2 T cell assays.	IEDB	1332489	1984	1994	KLLHKPIVWHV	ECO:0000213	PubMed	33853928
P0DTD1	KLVSSFLEM is a linear peptidic epitope (epitope ID 1332495) tested in 3 T cell assays.	IEDB	1332495	1185	1193	KLVSSFLEM	ECO:0000213	PubMed	34793243
P0DTD1	KLVSSFLEM is a linear peptidic epitope (epitope ID 1332495) tested in 3 T cell assays.	IEDB	1332495	1185	1193	KLVSSFLEM	ECO:0000213	PubMed	37193826
P0DTD1	KLVSSFLEM is a linear peptidic epitope (epitope ID 1332495) tested in 3 T cell assays.	IEDB	1332495	1185	1193	KLVSSFLEM	ECO:0000213	PubMed	33853928
P0DTD1	KMADQAMTQMY is a linear peptidic epitope (epitope ID 1332499) tested in 1 T cell assay.	IEDB	1332499	4003	4013	KMADQAMTQMY	ECO:0000213	PubMed	33853928
P0DTD1	KNLSDRVVFV is a linear peptidic epitope (epitope ID 1332510) tested in 2 T cell assays.	IEDB	1332510	6100	6109	KNLSDRVVFV	ECO:0000213	PubMed	33853928
P0DTD1	KPHNSHEGKTF is a linear peptidic epitope (epitope ID 1332516) tested in 3 T cell assays.	IEDB	1332516	1608	1618	KPHNSHEGKTF	ECO:0000213	PubMed	33853928
P0DTD1	KPPISFPL is a linear peptidic epitope (epitope ID 1332518) tested in 3 T cell assays.	IEDB	1332518	5400	5407	KPPISFPL	ECO:0000213	PubMed	33853928
P0DTD1	KPRSQMEIDF is a linear peptidic epitope (epitope ID 1332520) tested in 3 T cell assays.	IEDB	1332520	6656	6665	KPRSQMEIDF	ECO:0000213	PubMed	33853928
P0DTD1	KQGDDYVYL is a linear peptidic epitope (epitope ID 1332523) tested in 1 T cell assay.	IEDB	1332523	5213	5221	KQGDDYVYL	ECO:0000213	PubMed	33853928
P0DTD1	KSAFYILPSIISNEK is a linear peptidic epitope (epitope ID 1332526) tested in 16 T cell assays, 4 B cell assays, 8 MHC ligand assays and has 3D structure(s) 8cmf.	IEDB	1332526	1350	1364	KSAFYILPSIISNEK	ECO:0000213	PubMed	33911008
P0DTD1	KVDGVDVEL is a linear peptidic epitope (epitope ID 1332542) tested in 2 T cell assays.	IEDB	1332542	6486	6494	KVDGVDVEL	ECO:0000213	PubMed	34793243
P0DTD1	KVDGVDVEL is a linear peptidic epitope (epitope ID 1332542) tested in 2 T cell assays.	IEDB	1332542	6486	6494	KVDGVDVEL	ECO:0000213	PubMed	33853928
P0DTD1	KVDGVVQQL is a linear peptidic epitope (epitope ID 1332543) tested in 1 T cell assay.	IEDB	1332543	6633	6641	KVDGVVQQL	ECO:0000213	PubMed	33853928
P0DTD1	LEIPRRNVATL is a linear peptidic epitope (epitope ID 1332600) tested in 3 T cell assays.	IEDB	1332600	5914	5924	LEIPRRNVATL	ECO:0000213	PubMed	33853928
P0DTD1	LFLLPSLATV is a linear peptidic epitope (epitope ID 1332611) tested in 1 T cell assay.	IEDB	1332611	3638	3647	LFLLPSLATV	ECO:0000213	PubMed	33853928
P0DTD1	LGDVRETMSY is a linear peptidic epitope (epitope ID 1332615) tested in 1 T cell assay.	IEDB	1332615	1725	1734	LGDVRETMSY	ECO:0000213	PubMed	33853928
P0DTD1	LHKPIVWHV is a linear peptidic epitope (epitope ID 1332621) tested in 1 T cell assay.	IEDB	1332621	1986	1994	LHKPIVWHV	ECO:0000213	PubMed	33853928
P0DTD1	LKKLKKSL is a linear peptidic epitope (epitope ID 1332630) tested in 1 T cell assay.	IEDB	1332630	3977	3984	LKKLKKSL	ECO:0000213	PubMed	33853928
P0DTD1	LMVVIPDYNTY is a linear peptidic epitope (epitope ID 1332673) tested in 1 T cell assay.	IEDB	1332673	4070	4080	LMVVIPDYNTY	ECO:0000213	PubMed	33853928
P0DTD1	LRGTAVMSL is a linear peptidic epitope (epitope ID 1332705) tested in 1 T cell assay.	IEDB	1332705	7052	7060	LRGTAVMSL	ECO:0000213	PubMed	33853928
P0DTD1	LRIMASLVL is a linear peptidic epitope (epitope ID 1332706) tested in 1 T cell assay.	IEDB	1332706	5022	5030	LRIMASLVL	ECO:0000213	PubMed	33853928
P0DTD1	LRKHFSMMI is a linear peptidic epitope (epitope ID 1332707) tested in 1 T cell assay.	IEDB	1332707	5141	5149	LRKHFSMMI	ECO:0000213	PubMed	33853928
P0DTD1	LRPDTRYV is a linear peptidic epitope (epitope ID 1332709) tested in 1 T cell assay.	IEDB	1332709	2948	2955	LRPDTRYV	ECO:0000213	PubMed	33853928
P0DTD1	LRVEAFEYY is a linear peptidic epitope (epitope ID 1332710) tested in 1 T cell assay.	IEDB	1332710	1627	1635	LRVEAFEYY	ECO:0000213	PubMed	33853928
P0DTD1	LTIKKPNEL is a linear peptidic epitope (epitope ID 1332730) tested in 1 T cell assay.	IEDB	1332730	2105	2113	LTIKKPNEL	ECO:0000213	PubMed	33853928
P0DTD1	LVKQGDDYVY is a linear peptidic epitope (epitope ID 1332742) tested in 1 T cell assay.	IEDB	1332742	5211	5220	LVKQGDDYVY	ECO:0000213	PubMed	33853928
P0DTD1	LYLQYIRKL is a linear peptidic epitope (epitope ID 1332748) tested in 3 T cell assays.	IEDB	1332748	5275	5283	LYLQYIRKL	ECO:0000213	PubMed	33853928
P0DTD1	LYYQNNVFM is a linear peptidic epitope (epitope ID 1332749) tested in 1 T cell assay.	IEDB	1332749	5178	5186	LYYQNNVFM	ECO:0000213	PubMed	33853928
P0DTD1	MFDAYVNTF is a linear peptidic epitope (epitope ID 1332784) tested in 2 T cell assays.	IEDB	1332784	2590	2598	MFDAYVNTF	ECO:0000213	PubMed	34793243
P0DTD1	MFDAYVNTF is a linear peptidic epitope (epitope ID 1332784) tested in 2 T cell assays.	IEDB	1332784	2590	2598	MFDAYVNTF	ECO:0000213	PubMed	33853928
P0DTD1	MFVKHKHAF is a linear peptidic epitope (epitope ID 1332786) tested in 2 T cell assays.	IEDB	1332786	3627	3635	MFVKHKHAF	ECO:0000213	PubMed	33853928
P0DTD1	MLRIMASL is a linear peptidic epitope (epitope ID 1332809) tested in 1 T cell assay.	IEDB	1332809	5021	5028	MLRIMASL	ECO:0000213	PubMed	33853928
P0DTD1	MPNMLRIMASL is a linear peptidic epitope (epitope ID 1332822) tested in 3 T cell assays.	IEDB	1332822	5018	5028	MPNMLRIMASL	ECO:0000213	PubMed	33853928
P0DTD1	MYKGLPWNV is a linear peptidic epitope (epitope ID 1332850) tested in 1 T cell assay.	IEDB	1332850	6078	6086	MYKGLPWNV	ECO:0000213	PubMed	33853928
P0DTD1	NINLHTQVV is a linear peptidic epitope (epitope ID 1332909) tested in 2 T cell assays.	IEDB	1332909	1576	1584	NINLHTQVV	ECO:0000213	PubMed	33853928
P0DTD1	NLHSSRLSF is a linear peptidic epitope (epitope ID 1332924) tested in 1 T cell assay.	IEDB	1332924	4752	4760	NLHSSRLSF	ECO:0000213	PubMed	33853928
P0DTD1	NLKTLLSL is a linear peptidic epitope (epitope ID 1332929) tested in 1 T cell assay.	IEDB	1332929	1555	1562	NLKTLLSL	ECO:0000213	PubMed	33853928
P0DTD1	NLYDKLVSSFL is a linear peptidic epitope (epitope ID 1332947) tested in 1 T cell assay.	IEDB	1332947	1181	1191	NLYDKLVSSFL	ECO:0000213	PubMed	33853928
P0DTD1	NRYFRLTL is a linear peptidic epitope (epitope ID 1332980) tested in 2 T cell assays.	IEDB	1332980	3801	3808	NRYFRLTL	ECO:0000213	PubMed	33853928
P0DTD1	NSFSGYLKL is a linear peptidic epitope (epitope ID 1332984) tested in 1 T cell assay.	IEDB	1332984	1026	1034	NSFSGYLKL	ECO:0000213	PubMed	33853928
P0DTD1	NTFTRLQSL is a linear peptidic epitope (epitope ID 1332994) tested in 1 T cell assay.	IEDB	1332994	6446	6454	NTFTRLQSL	ECO:0000213	PubMed	33853928
P0DTD1	NTSRYWEPEFY is a linear peptidic epitope (epitope ID 1333001) tested in 1 T cell assay.	IEDB	1333001	5303	5313	NTSRYWEPEFY	ECO:0000213	PubMed	33853928
P0DTD1	NVIPTITQM is a linear peptidic epitope (epitope ID 1333028) tested in 2 T cell assays and 6 MHC ligand assays.	IEDB	1333028	4926	4934	NVIPTITQM	ECO:0000213	PubMed	38781962
P0DTD1	NVIPTITQM is a linear peptidic epitope (epitope ID 1333028) tested in 2 T cell assays and 6 MHC ligand assays.	IEDB	1333028	4926	4934	NVIPTITQM	ECO:0000213	PubMed	33853928
P0DTD1	NVKDFMSL is a linear peptidic epitope (epitope ID 1333034) tested in 1 T cell assay.	IEDB	1333034	2714	2721	NVKDFMSL	ECO:0000213	PubMed	33853928
P0DTD1	NYYKKDNSY is a linear peptidic epitope (epitope ID 1333067) tested in 1 T cell assay.	IEDB	1333067	1898	1906	NYYKKDNSY	ECO:0000213	PubMed	33853928
P0DTD1	RIKIVQMLSDTLKNL is a linear peptidic epitope (epitope ID 1333310) tested in 5 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1333310	6088	6102	RIKIVQMLSDTLKNL	ECO:0000213	PubMed	38605956
P0DTD1	RIKIVQMLSDTLKNL is a linear peptidic epitope (epitope ID 1333310) tested in 5 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1333310	6088	6102	RIKIVQMLSDTLKNL	ECO:0000213	PubMed	33911008
P0DTD1	RTIKVFTTV is a linear peptidic epitope (epitope ID 1333395) tested in 6 T cell assays.	IEDB	1333395	1566	1574	RTIKVFTTV	ECO:0000213	PubMed	34793243
P0DTD1	RTIKVFTTV is a linear peptidic epitope (epitope ID 1333395) tested in 6 T cell assays.	IEDB	1333395	1566	1574	RTIKVFTTV	ECO:0000213	PubMed	33853928
P0DTD1	SAKNRARTV is a linear peptidic epitope (epitope ID 1333433) tested in 1 T cell assay.	IEDB	1333433	4941	4949	SAKNRARTV	ECO:0000213	PubMed	33853928
P0DTD1	SALWEIQQVV is a linear peptidic epitope (epitope ID 1333435) tested in 4 T cell assays.	IEDB	1333435	4093	4102	SALWEIQQVV	ECO:0000213	PubMed	33853928
P0DTD1	SAMVRMYIF is a linear peptidic epitope (epitope ID 1333441) tested in 1 T cell assay.	IEDB	1333441	2378	2386	SAMVRMYIF	ECO:0000213	PubMed	33853928
P0DTD1	SAPPAQYEL is a linear peptidic epitope (epitope ID 1333443) tested in 2 T cell assays.	IEDB	1333443	1808	1816	SAPPAQYEL	ECO:0000213	PubMed	33853928
P0DTD1	SDGTGTIY is a linear peptidic epitope (epitope ID 1333468) tested in 1 T cell assay.	IEDB	1333468	4199	4206	SDGTGTIY	ECO:0000213	PubMed	33853928
P0DTD1	SFGPLVRKI is a linear peptidic epitope (epitope ID 1333522) tested in 1 T cell assay.	IEDB	1333522	4717	4725	SFGPLVRKI	ECO:0000213	PubMed	33853928
P0DTD1	SFLPGVYSV is a linear peptidic epitope (epitope ID 1333525) tested in 2 T cell assays.	IEDB	1333525	3099	3107	SFLPGVYSV	ECO:0000213	PubMed	34793243
P0DTD1	SFLPGVYSV is a linear peptidic epitope (epitope ID 1333525) tested in 2 T cell assays.	IEDB	1333525	3099	3107	SFLPGVYSV	ECO:0000213	PubMed	33853928
P0DTD1	SLDTYPSLETI is a linear peptidic epitope (epitope ID 1333584) tested in 4 T cell assays.	IEDB	1333584	2297	2307	SLDTYPSLETI	ECO:0000213	PubMed	33853928
P0DTD1	SLRPDTRYVL is a linear peptidic epitope (epitope ID 1333636) tested in 2 T cell assays.	IEDB	1333636	2947	2956	SLRPDTRYVL	ECO:0000213	PubMed	33853928
P0DTD1	SLYVNKHAF is a linear peptidic epitope (epitope ID 1333653) tested in 1 T cell assay.	IEDB	1333653	6343	6351	SLYVNKHAF	ECO:0000213	PubMed	33853928
P0DTD1	SNSGSDVLY is a linear peptidic epitope (epitope ID 1333691) tested in 2 T cell assays.	IEDB	1333691	3242	3250	SNSGSDVLY	ECO:0000213	PubMed	33853928
P0DTD1	SRVLGLKTL is a linear peptidic epitope (epitope ID 1333777) tested in 2 T cell assays.	IEDB	1333777	2114	2122	SRVLGLKTL	ECO:0000213	PubMed	33853928
P0DTD1	SRYWEPEF is a linear peptidic epitope (epitope ID 1333778) tested in 1 T cell assay.	IEDB	1333778	5305	5312	SRYWEPEF	ECO:0000213	PubMed	33853928
P0DTD1	SSEAFLIGCNY is a linear peptidic epitope (epitope ID 1333785) tested in 1 T cell assay.	IEDB	1333785	6999	7009	SSEAFLIGCNY	ECO:0000213	PubMed	33853928
P0DTD1	STSAFVETV is a linear peptidic epitope (epitope ID 1333818) tested in 8 T cell assays and 10 MHC ligand assays.	IEDB	1333818	483	491	STSAFVETV	ECO:0000213	PubMed	34793243
P0DTD1	SVVSKVVKV is a linear peptidic epitope (epitope ID 1333878) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1333878	6764	6772	SVVSKVVKV	ECO:0000213	PubMed	34171305
P0DTD1	SVVSKVVKV is a linear peptidic epitope (epitope ID 1333878) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1333878	6764	6772	SVVSKVVKV	ECO:0000213	PubMed	33853928
P0DTD1	SVYYTSNPTTF is a linear peptidic epitope (epitope ID 1333885) tested in 1 T cell assay.	IEDB	1333885	1534	1544	SVYYTSNPTTF	ECO:0000213	PubMed	33853928
P0DTD1	TANPKTPKY is a linear peptidic epitope (epitope ID 1333907) tested in 4 T cell assays.	IEDB	1333907	3356	3364	TANPKTPKY	ECO:0000213	PubMed	33853928
P0DTD1	TDLEGNFY is a linear peptidic epitope (epitope ID 1333923) tested in 1 T cell assay.	IEDB	1333923	3438	3445	TDLEGNFY	ECO:0000213	PubMed	33853928
P0DTD1	TFISAARQGF is a linear peptidic epitope (epitope ID 1333952) tested in 2 T cell assays.	IEDB	1333952	2632	2641	TFISAARQGF	ECO:0000213	PubMed	33853928
P0DTD1	TFNGECPNF is a linear peptidic epitope (epitope ID 1333955) tested in 1 T cell assay.	IEDB	1333955	265	273	TFNGECPNF	ECO:0000213	PubMed	33853928
P0DTD1	TICAPLTVF is a linear peptidic epitope (epitope ID 1333959) tested in 1 T cell assay.	IEDB	1333959	6566	6574	TICAPLTVF	ECO:0000213	PubMed	33853928
P0DTD1	TIEVNSFSGY is a linear peptidic epitope (epitope ID 1333964) tested in 1 T cell assay.	IEDB	1333964	1022	1031	TIEVNSFSGY	ECO:0000213	PubMed	33853928
P0DTD1	TITQMNLKY is a linear peptidic epitope (epitope ID 1333978) tested in 1 T cell assay.	IEDB	1333978	4930	4938	TITQMNLKY	ECO:0000213	PubMed	33853928
P0DTD1	TPVVQTIEV is a linear peptidic epitope (epitope ID 1334054) tested in 3 T cell assays.	IEDB	1334054	1017	1025	TPVVQTIEV	ECO:0000213	PubMed	33853928
P0DTD1	TTYPGQGLNGY is a linear peptidic epitope (epitope ID 1334084) tested in 1 T cell assay.	IEDB	1334084	1327	1337	TTYPGQGLNGY	ECO:0000213	PubMed	33853928
P0DTD1	TYERHSLSHF is a linear peptidic epitope (epitope ID 1334119) tested in 1 T cell assay.	IEDB	1334119	2512	2521	TYERHSLSHF	ECO:0000213	PubMed	33853928
P0DTD1	TYKNTCDGTTF is a linear peptidic epitope (epitope ID 1334121) tested in 1 T cell assay.	IEDB	1334121	4079	4089	TYKNTCDGTTF	ECO:0000213	PubMed	33853928
P0DTD1	VKNGSIHLY is a linear peptidic epitope (epitope ID 1334202) tested in 1 T cell assay.	IEDB	1334202	2496	2504	VKNGSIHLY	ECO:0000213	PubMed	33853928
P0DTD1	VLAAECTIF is a linear peptidic epitope (epitope ID 1334206) tested in 1 T cell assay.	IEDB	1334206	2914	2922	VLAAECTIF	ECO:0000213	PubMed	33853928
P0DTD1	VLNEKCSAY is a linear peptidic epitope (epitope ID 1334230) tested in 2 T cell assays.	IEDB	1334230	852	860	VLNEKCSAY	ECO:0000213	PubMed	33853928
P0DTD1	VMYASAVVLL is a linear peptidic epitope (epitope ID 1334248) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	1334248	3683	3692	VMYASAVVLL	ECO:0000213	PubMed	33853928
P0DTD1	VPANSTVL is a linear peptidic epitope (epitope ID 1334253) tested in 3 T cell assays.	IEDB	1334253	4260	4267	VPANSTVL	ECO:0000213	PubMed	33853928
P0DTD1	VPGLPGTIL is a linear peptidic epitope (epitope ID 1334258) tested in 4 T cell assays.	IEDB	1334258	2866	2874	VPGLPGTIL	ECO:0000213	PubMed	34793243
P0DTD1	VPGLPGTIL is a linear peptidic epitope (epitope ID 1334258) tested in 4 T cell assays.	IEDB	1334258	2866	2874	VPGLPGTIL	ECO:0000213	PubMed	33853928
P0DTD1	VPHVGEIPV is a linear peptidic epitope (epitope ID 1334260) tested in 5 T cell assays.	IEDB	1334260	108	116	VPHVGEIPV	ECO:0000213	PubMed	34793243
P0DTD1	VPHVGEIPV is a linear peptidic epitope (epitope ID 1334260) tested in 5 T cell assays.	IEDB	1334260	108	116	VPHVGEIPV	ECO:0000213	PubMed	33853928
P0DTD1	VPQEHYVRI is a linear peptidic epitope (epitope ID 1334265) tested in 1 T cell assay.	IEDB	1334265	5565	5573	VPQEHYVRI	ECO:0000213	PubMed	33853928
P0DTD1	VRETMSYLF is a linear peptidic epitope (epitope ID 1334274) tested in 1 T cell assay.	IEDB	1334274	1728	1736	VRETMSYLF	ECO:0000213	PubMed	33853928
P0DTD1	VRIQPGQTF is a linear peptidic epitope (epitope ID 1334276) tested in 2 T cell assays.	IEDB	1334276	3367	3375	VRIQPGQTF	ECO:0000213	PubMed	33853928
P0DTD1	VRNLQHRLY is a linear peptidic epitope (epitope ID 1334277) tested in 1 T cell assay.	IEDB	1334277	5112	5120	VRNLQHRLY	ECO:0000213	PubMed	33853928
P0DTD1	VRQALLKTV is a linear peptidic epitope (epitope ID 1334278) tested in 1 T cell assay.	IEDB	1334278	4574	4582	VRQALLKTV	ECO:0000213	PubMed	33853928
P0DTD1	VRSIFSRTL is a linear peptidic epitope (epitope ID 1334279) tested in 1 T cell assay.	IEDB	1334279	544	552	VRSIFSRTL	ECO:0000213	PubMed	33853928
P0DTD1	VVQQLPETY is a linear peptidic epitope (epitope ID 1334302) tested in 1 T cell assay.	IEDB	1334302	6637	6645	VVQQLPETY	ECO:0000213	PubMed	33853928
P0DTD1	WKYPQVNGL is a linear peptidic epitope (epitope ID 1334309) tested in 1 T cell assay.	IEDB	1334309	1656	1664	WKYPQVNGL	ECO:0000213	PubMed	33853928
P0DTD1	WRNTNPIQL is a linear peptidic epitope (epitope ID 1334312) tested in 1 T cell assay.	IEDB	1334312	7029	7037	WRNTNPIQL	ECO:0000213	PubMed	33853928
P0DTD1	YADVFHLYL is a linear peptidic epitope (epitope ID 1334320) tested in 8 T cell assays.	IEDB	1334320	5269	5277	YADVFHLYL	ECO:0000213	PubMed	34793243
P0DTD1	YADVFHLYL is a linear peptidic epitope (epitope ID 1334320) tested in 8 T cell assays.	IEDB	1334320	5269	5277	YADVFHLYL	ECO:0000213	PubMed	33853928
P0DTD1	YAKPFLNKV is a linear peptidic epitope (epitope ID 1334323) tested in 1 T cell assay.	IEDB	1334323	2141	2149	YAKPFLNKV	ECO:0000213	PubMed	33853928
P0DTD1	YASAVVLLI is a linear peptidic epitope (epitope ID 1334326) tested in 2 T cell assays.	IEDB	1334326	3685	3693	YASAVVLLI	ECO:0000213	PubMed	34793243
P0DTD1	YASAVVLLI is a linear peptidic epitope (epitope ID 1334326) tested in 2 T cell assays.	IEDB	1334326	3685	3693	YASAVVLLI	ECO:0000213	PubMed	33853928
P0DTD1	YAYLRKHF is a linear peptidic epitope (epitope ID 1334335) tested in 2 T cell assays.	IEDB	1334335	5138	5145	YAYLRKHF	ECO:0000213	PubMed	33853928
P0DTD1	YEKLKPVL is a linear peptidic epitope (epitope ID 1334341) tested in 1 T cell assay.	IEDB	1334341	621	628	YEKLKPVL	ECO:0000213	PubMed	33853928
P0DTD1	YFDKAGQKTY is a linear peptidic epitope (epitope ID 1334344) tested in 1 T cell assay.	IEDB	1334344	2504	2513	YFDKAGQKTY	ECO:0000213	PubMed	33853928
P0DTD1	YFIKGLNNL is a linear peptidic epitope (epitope ID 1334346) tested in 1 T cell assay.	IEDB	1334346	4229	4237	YFIKGLNNL	ECO:0000213	PubMed	33853928
P0DTD1	YFMRFRRAF is a linear peptidic epitope (epitope ID 1334348) tested in 3 T cell assays.	IEDB	1334348	3063	3071	YFMRFRRAF	ECO:0000213	PubMed	33853928
P0DTD1	YFVVKRHTF is a linear peptidic epitope (epitope ID 1334350) tested in 2 T cell assays.	IEDB	1334350	4461	4469	YFVVKRHTF	ECO:0000213	PubMed	33853928
P0DTD1	YKIEELFYSY is a linear peptidic epitope (epitope ID 1334361) tested in 1 T cell assay.	IEDB	1334361	6286	6295	YKIEELFYSY	ECO:0000213	PubMed	33853928
P0DTD1	YLFDESGEF is a linear peptidic epitope (epitope ID 1334362) tested in 4 T cell assays.	IEDB	1334362	906	914	YLFDESGEF	ECO:0000213	PubMed	34793243
P0DTD1	YLFDESGEF is a linear peptidic epitope (epitope ID 1334362) tested in 4 T cell assays.	IEDB	1334362	906	914	YLFDESGEF	ECO:0000213	PubMed	33853928
P0DTD1	YLKLTDNVY is a linear peptidic epitope (epitope ID 1334364) tested in 1 T cell assay.	IEDB	1334364	1031	1039	YLKLTDNVY	ECO:0000213	PubMed	33853928
P0DTD1	YLKRRVVF is a linear peptidic epitope (epitope ID 1334365) tested in 1 T cell assay.	IEDB	1334365	3160	3167	YLKRRVVF	ECO:0000213	PubMed	33853928
P0DTD1	YLYFIKGLNNL is a linear peptidic epitope (epitope ID 1334374) tested in 1 T cell assay.	IEDB	1334374	4227	4237	YLYFIKGLNNL	ECO:0000213	PubMed	33853928
P0DTD1	YMHHMELPTGV is a linear peptidic epitope (epitope ID 1334376) tested in 1 T cell assay.	IEDB	1334376	3424	3434	YMHHMELPTGV	ECO:0000213	PubMed	33853928
P0DTD1	YNLWNTFTRL is a linear peptidic epitope (epitope ID 1334384) tested in 1 T cell assay.	IEDB	1334384	6442	6451	YNLWNTFTRL	ECO:0000213	PubMed	33853928
P0DTD1	YRGTTTYKL is a linear peptidic epitope (epitope ID 1334397) tested in 1 T cell assay.	IEDB	1334397	5535	5543	YRGTTTYKL	ECO:0000213	PubMed	33853928
P0DTD1	YRSLPGVF is a linear peptidic epitope (epitope ID 1334399) tested in 1 T cell assay.	IEDB	1334399	3011	3018	YRSLPGVF	ECO:0000213	PubMed	33853928
P0DTD1	YRYNLPTM is a linear peptidic epitope (epitope ID 1334400) tested in 2 T cell assays.	IEDB	1334400	4848	4855	YRYNLPTM	ECO:0000213	PubMed	33853928
P0DTD1	YRYNLPTMC is a linear peptidic epitope (epitope ID 1334401) tested in 1 T cell assay.	IEDB	1334401	4848	4856	YRYNLPTMC	ECO:0000213	PubMed	33853928
P0DTD1	YTELEPPCRF is a linear peptidic epitope (epitope ID 1334412) tested in 1 T cell assay.	IEDB	1334412	4206	4215	YTELEPPCRF	ECO:0000213	PubMed	33853928
P0DTD1	YYKKDNSY is a linear peptidic epitope (epitope ID 1334429) tested in 1 T cell assay.	IEDB	1334429	1899	1906	YYKKDNSY	ECO:0000213	PubMed	33853928
P0DTD1	YYTSNPTTFHL is a linear peptidic epitope (epitope ID 1334431) tested in 1 T cell assay.	IEDB	1334431	1536	1546	YYTSNPTTFHL	ECO:0000213	PubMed	33853928
P0DTD1	ISDEFSSNV is a linear peptidic epitope (epitope ID 1338837) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1338837	5582	5590	ISDEFSSNV	ECO:0000213	PubMed	34793243
P0DTD1	EHEHEIAWYTER is a linear peptidic epitope (epitope ID 1427664) tested in 9 B cell assays.	IEDB	1427664	233	244	EHEHEIAWYTER	ECO:0000213	PubMed	37766081
P0DTD1	HTANKWDLIISD is a linear peptidic epitope (epitope ID 1448391) tested in 9 B cell assays.	IEDB	1448391	6917	6928	HTANKWDLIISD	ECO:0000213	PubMed	37766081
P0DTD1	AARLTPCGTGTSTDV is a linear peptidic epitope (epitope ID 1539367) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1539367	4408	4422	AARLTPCGTGTSTDV	ECO:0000213	PubMed	37215095
P0DTD1	ADKYVRNLQHRLYEC is a linear peptidic epitope (epitope ID 1539397) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1539397	5108	5122	ADKYVRNLQHRLYEC	ECO:0000213	PubMed	37215095
P0DTD1	AKFLKTNCCRFQEKD is a linear peptidic epitope (epitope ID 1539479) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1539479	4438	4452	AKFLKTNCCRFQEKD	ECO:0000213	PubMed	37215095
P0DTD1	ALFAYTKRNVIPTIT is a linear peptidic epitope (epitope ID 1539495) tested in 6 T cell assays, 4 B cell assays and 14 MHC ligand assays.	IEDB	1539495	4918	4932	ALFAYTKRNVIPTIT	ECO:0000213	PubMed	37215095
P0DTD1	ALLSTDGNKIADKYV is a linear peptidic epitope (epitope ID 1539503) tested in 6 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1539503	5098	5112	ALLSTDGNKIADKYV	ECO:0000213	PubMed	37215095
P0DTD1	ALLTLQQIEL is a linear peptidic epitope (epitope ID 1539504) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1539504	1679	1688	ALLTLQQIEL	ECO:0000213	PubMed	37193826
P0DTD1	ANECAQVLSEMVMCG is a linear peptidic epitope (epitope ID 1539533) tested in 6 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	1539533	5048	5062	ANECAQVLSEMVMCG	ECO:0000213	PubMed	37215095
P0DTD1	ANLGERVRQALLKTV is a linear peptidic epitope (epitope ID 1539537) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1539537	4568	4582	ANLGERVRQALLKTV	ECO:0000213	PubMed	37215095
P0DTD1	AYPLTKHPNQEYADV is a linear peptidic epitope (epitope ID 1539654) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1539654	5258	5272	AYPLTKHPNQEYADV	ECO:0000213	PubMed	37215095
P0DTD1	CILHCANFNVLFSTV is a linear peptidic epitope (epitope ID 1539706) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1539706	4698	4712	CILHCANFNVLFSTV	ECO:0000213	PubMed	37215095
P0DTD1	CSLSHRFYRLANECA is a linear peptidic epitope (epitope ID 1539758) tested in 6 T cell assays, 4 B cell assays and 15 MHC ligand assays.	IEDB	1539758	5038	5052	CSLSHRFYRLANECA	ECO:0000213	PubMed	37215095
P0DTD1	DGSIIQFPNTYLEGS is a linear peptidic epitope (epitope ID 1539859) tested in 4 B cell assays and 6 MHC ligand assays.	IEDB	1539859	2958	2972	DGSIIQFPNTYLEGS	ECO:0000213	PubMed	38117652
P0DTD1	DGVPFVVSTGYHFRE is a linear peptidic epitope (epitope ID 1539865) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1539865	4728	4742	DGVPFVVSTGYHFRE	ECO:0000213	PubMed	37215095
P0DTD1	DIVKTDGTLMIERFV is a linear peptidic epitope (epitope ID 1539890) tested in 6 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1539890	5238	5252	DIVKTDGTLMIERFV	ECO:0000213	PubMed	37215095
P0DTD1	DIYNDKVAGFAKFLK is a linear peptidic epitope (epitope ID 1539891) tested in 6 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1539891	4428	4442	DIYNDKVAGFAKFLK	ECO:0000213	PubMed	37215095
P0DTD1	DLVYALRHFDEGNCD is a linear peptidic epitope (epitope ID 1539924) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1539924	4518	4532	DLVYALRHFDEGNCD	ECO:0000213	PubMed	37215095
P0DTD1	DVDTDFVNEFYAYLR is a linear peptidic epitope (epitope ID 1539986) tested in 8 T cell assays, 4 B cell assays and 14 MHC ligand assays.	IEDB	1539986	5128	5142	DVDTDFVNEFYAYLR	ECO:0000213	PubMed	37215095
P0DTD1	DVDTDFVNEFYAYLR is a linear peptidic epitope (epitope ID 1539986) tested in 8 T cell assays, 4 B cell assays and 14 MHC ligand assays.	IEDB	1539986	5128	5142	DVDTDFVNEFYAYLR	ECO:0000213	PubMed	34758478
P0DTD1	EGNCDTLKEILVTYN is a linear peptidic epitope (epitope ID 1540070) tested in 6 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	1540070	4528	4542	EGNCDTLKEILVTYN	ECO:0000213	PubMed	37215095
P0DTD1	ELKHFFFAQDGNAAI is a linear peptidic epitope (epitope ID 1540105) tested in 11 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	1540105	4828	4842	ELKHFFFAQDGNAAI	ECO:0000213	PubMed	37215095
P0DTD1	ELKHFFFAQDGNAAI is a linear peptidic epitope (epitope ID 1540105) tested in 11 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	1540105	4828	4842	ELKHFFFAQDGNAAI	ECO:0000213	PubMed	34758478
P0DTD1	EYADVFHLYLQYIRK is a linear peptidic epitope (epitope ID 1540185) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1540185	5268	5282	EYADVFHLYLQYIRK	ECO:0000213	PubMed	37215095
P0DTD1	FGPLVRKIFVDGVPF is a linear peptidic epitope (epitope ID 1540246) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1540246	4718	4732	FGPLVRKIFVDGVPF	ECO:0000213	PubMed	37215095
P0DTD1	FNKWGKARLYYDSMS is a linear peptidic epitope (epitope ID 1540301) tested in 8 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1540301	4898	4912	FNKWGKARLYYDSMS	ECO:0000213	PubMed	34758478
P0DTD1	FNSTYASQGLVASIK is a linear peptidic epitope (epitope ID 1540305) tested in 6 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	1540305	5158	5172	FNSTYASQGLVASIK	ECO:0000213	PubMed	37215095
P0DTD1	FSVAALTNNVAFQTV is a linear peptidic epitope (epitope ID 1540343) tested in 6 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	1540343	4788	4802	FSVAALTNNVAFQTV	ECO:0000213	PubMed	37215095
P0DTD1	GCINANQVIVNNLDK is a linear peptidic epitope (epitope ID 1540406) tested in 6 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	1540406	4878	4892	GCINANQVIVNNLDK	ECO:0000213	PubMed	37215095
P0DTD1	GGWHNMLKTVYSDVE is a linear peptidic epitope (epitope ID 1540474) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1540474	4988	5002	GGWHNMLKTVYSDVE	ECO:0000213	PubMed	37215095
P0DTD1	GNAAISDYDYYRYNL is a linear peptidic epitope (epitope ID 1540530) tested in 8 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1540530	4838	4852	GNAAISDYDYYRYNL	ECO:0000213	PubMed	34758478
P0DTD1	GWDYPKCDRAMPNML is a linear peptidic epitope (epitope ID 1540645) tested in 6 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	1540645	5008	5022	GWDYPKCDRAMPNML	ECO:0000213	PubMed	37215095
P0DTD1	HTMLVKQGDDYVYLP is a linear peptidic epitope (epitope ID 1540722) tested in 6 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	1540722	5208	5222	HTMLVKQGDDYVYLP	ECO:0000213	PubMed	37215095
P0DTD1	HVDTDLTKPYIKWDL is a linear peptidic epitope (epitope ID 1540727) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1540727	4648	4662	HVDTDLTKPYIKWDL	ECO:0000213	PubMed	37215095
P0DTD1	ICQAVTANVNALLST is a linear peptidic epitope (epitope ID 1540751) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1540751	5088	5102	ICQAVTANVNALLST	ECO:0000213	PubMed	37215095
P0DTD1	IDGDMVPHISRQRLT is a linear peptidic epitope (epitope ID 1540756) tested in 6 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	1540756	4498	4512	IDGDMVPHISRQRLT	ECO:0000213	PubMed	37215095
P0DTD1	IERFVSLAIDAYPLT is a linear peptidic epitope (epitope ID 1540771) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1540771	5248	5262	IERFVSLAIDAYPLT	ECO:0000213	PubMed	37215095
P0DTD1	IKWDLLKYDFTEERL is a linear peptidic epitope (epitope ID 1540810) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1540810	4658	4672	IKWDLLKYDFTEERL	ECO:0000213	PubMed	37215095
P0DTD1	IRQLLFVVEVVDKYF is a linear peptidic epitope (epitope ID 1540858) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1540858	4858	4872	IRQLLFVVEVVDKYF	ECO:0000213	PubMed	37215095
P0DTD1	IYNLLKDCPAVAKHD is a linear peptidic epitope (epitope ID 1540917) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1540917	4478	4492	IYNLLKDCPAVAKHD	ECO:0000213	PubMed	37215095
P0DTD1	KPGGTSSGDATTAYA is a linear peptidic epitope (epitope ID 1541093) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1541093	5068	5082	KPGGTSSGDATTAYA	ECO:0000213	PubMed	37215095
P0DTD1	LKSIAATRGATVVIG is a linear peptidic epitope (epitope ID 1541342) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1541342	4968	4982	LKSIAATRGATVVIG	ECO:0000213	PubMed	37215095
P0DTD1	LSFKELLVYAADPAM is a linear peptidic epitope (epitope ID 1541486) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1541486	4758	4772	LSFKELLVYAADPAM	ECO:0000213	PubMed	37215095
P0DTD1	LVTYNCCDDDYFNKK is a linear peptidic epitope (epitope ID 1541547) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1541547	4538	4552	LVTYNCCDDDYFNKK	ECO:0000213	PubMed	37215095
P0DTD1	LYYQNNVFMSEAKCW is a linear peptidic epitope (epitope ID 1541573) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1541573	5178	5192	LYYQNNVFMSEAKCW	ECO:0000213	PubMed	37215095
P0DTD1	MCDIRQLLF is a linear peptidic epitope (epitope ID 1541582) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1541582	4855	4863	MCDIRQLLF	ECO:0000213	PubMed	34793243
P0DTD1	MILSDDAVVCFNSTY is a linear peptidic epitope (epitope ID 1541601) tested in 6 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	1541601	5148	5162	MILSDDAVVCFNSTY	ECO:0000213	PubMed	37215095
P0DTD1	MLTNDNTSRYWEPEF is a linear peptidic epitope (epitope ID 1541614) tested in 6 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	1541614	5298	5312	MLTNDNTSRYWEPEF	ECO:0000213	PubMed	37215095
P0DTD1	MRNAGIVGVLTLDNQ is a linear peptidic epitope (epitope ID 1541637) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1541637	4588	4602	MRNAGIVGVLTLDNQ	ECO:0000213	PubMed	37215095
P0DTD1	MVMCGGSLYVKPGGT is a linear peptidic epitope (epitope ID 1541658) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1541658	5058	5072	MVMCGGSLYVKPGGT	ECO:0000213	PubMed	37215095
P0DTD1	NKDFYDFAVSKGFFK is a linear peptidic epitope (epitope ID 1541748) tested in 7 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	1541748	4808	4822	NKDFYDFAVSKGFFK	ECO:0000213	PubMed	37215095
P0DTD1	NKDFYDFAVSKGFFK is a linear peptidic epitope (epitope ID 1541748) tested in 7 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	1541748	4808	4822	NKDFYDFAVSKGFFK	ECO:0000213	PubMed	34758478
P0DTD1	NKLCEEMLDNRATLQ is a linear peptidic epitope (epitope ID 1541752) tested in 2 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	1541752	3928	3942	NKLCEEMLDNRATLQ	ECO:0000213	PubMed	34758478
P0DTD1	NLLLDKRTTCFSVAA is a linear peptidic epitope (epitope ID 1541770) tested in 6 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	1541770	4778	4792	NLLLDKRTTCFSVAA	ECO:0000213	PubMed	37215095
P0DTD1	NNLDKSAGFPFNKWG is a linear peptidic epitope (epitope ID 1541790) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1541790	4888	4902	NNLDKSAGFPFNKWG	ECO:0000213	PubMed	37215095
P0DTD1	NQDVNLHSSRLSFKE is a linear peptidic epitope (epitope ID 1541806) tested in 6 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	1541806	4748	4762	NQDVNLHSSRLSFKE	ECO:0000213	PubMed	37215095
P0DTD1	PNCVNCLDDRCILHC is a linear peptidic epitope (epitope ID 1541987) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1541987	4688	4702	PNCVNCLDDRCILHC	ECO:0000213	PubMed	37215095
P0DTD1	QYIRKLHDELTGHML is a linear peptidic epitope (epitope ID 1542224) tested in 6 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1542224	5278	5292	QYIRKLHDELTGHML	ECO:0000213	PubMed	37215095
P0DTD1	RILGAGCFVDDIVKT is a linear peptidic epitope (epitope ID 1542269) tested in 6 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	1542269	5228	5242	RILGAGCFVDDIVKT	ECO:0000213	PubMed	37215095
P0DTD1	RLYECLYRNRDVDTD is a linear peptidic epitope (epitope ID 1542297) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1542297	5118	5132	RLYECLYRNRDVDTD	ECO:0000213	PubMed	37215095
P0DTD1	RQRLTKYTMADLVYA is a linear peptidic epitope (epitope ID 1542314) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1542314	4508	4522	RQRLTKYTMADLVYA	ECO:0000213	PubMed	37215095
P0DTD1	SYYSLLMPILTLTRA is a linear peptidic epitope (epitope ID 1542661) tested in 6 T cell assays, 4 B cell assays and 14 MHC ligand assays.	IEDB	1542661	4628	4642	SYYSLLMPILTLTRA	ECO:0000213	PubMed	37215095
P0DTD1	TEERLKLFDRYFKYW is a linear peptidic epitope (epitope ID 1542708) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1542708	4668	4682	TEERLKLFDRYFKYW	ECO:0000213	PubMed	37215095
P0DTD1	TFSNYQHEETIYNLL is a linear peptidic epitope (epitope ID 1542740) tested in 6 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	1542740	4468	4482	TFSNYQHEETIYNLL	ECO:0000213	PubMed	37215095
P0DTD1	TKGPHEFCSQHTMLV is a linear peptidic epitope (epitope ID 1542806) tested in 6 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	1542806	5198	5212	TKGPHEFCSQHTMLV	ECO:0000213	PubMed	37215095
P0DTD1	TLDNQDLNGNWYDFG is a linear peptidic epitope (epitope ID 1542822) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1542822	4598	4612	TLDNQDLNGNWYDFG	ECO:0000213	PubMed	37215095
P0DTD1	TLTRALTAESHVDTD is a linear peptidic epitope (epitope ID 1542844) tested in 6 T cell assays, 4 B cell assays and 14 MHC ligand assays.	IEDB	1542844	4638	4652	TLTRALTAESHVDTD	ECO:0000213	PubMed	37215095
P0DTD1	TPGSGVPVVDSYYSL is a linear peptidic epitope (epitope ID 1542870) tested in 6 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1542870	4618	4632	TPGSGVPVVDSYYSL	ECO:0000213	PubMed	37215095
P0DTD1	TTAYANSVFNICQAV is a linear peptidic epitope (epitope ID 1542923) tested in 9 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	1542923	5078	5092	TTAYANSVFNICQAV	ECO:0000213	PubMed	37215095
P0DTD1	TVAGVSICSTMTNRQ is a linear peptidic epitope (epitope ID 1542950) tested in 6 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	1542950	4948	4962	TVAGVSICSTMTNRQ	ECO:0000213	PubMed	37215095
P0DTD1	TVVIGTSKFYGGWHN is a linear peptidic epitope (epitope ID 1542970) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1542970	4978	4992	TVVIGTSKFYGGWHN	ECO:0000213	PubMed	37215095
P0DTD1	VAKHDFFKFRIDGDM is a linear peptidic epitope (epitope ID 1542997) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1542997	4488	4502	VAKHDFFKFRIDGDM	ECO:0000213	PubMed	37215095
P0DTD1	VASIKNFKSVLYYQN is a linear peptidic epitope (epitope ID 1543005) tested in 6 T cell assays, 4 B cell assays and 5 MHC ligand assays.	IEDB	1543005	5168	5182	VASIKNFKSVLYYQN	ECO:0000213	PubMed	37215095
P0DTD1	VDKYFDCYDGGCINA is a linear peptidic epitope (epitope ID 1543028) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1543028	4868	4882	VDKYFDCYDGGCINA	ECO:0000213	PubMed	37215095
P0DTD1	VENPDILRVYANLGE is a linear peptidic epitope (epitope ID 1543062) tested in 9 T cell assays, 4 B cell assays and 6 MHC ligand assays.	IEDB	1543062	4558	4572	VENPDILRVYANLGE	ECO:0000213	PubMed	37215095
P0DTD1	VVDSYYSLL is a linear peptidic epitope (epitope ID 1543291) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1543291	4625	4633	VVDSYYSLL	ECO:0000213	PubMed	34793243
P0DTD1	VVDSYYSLL is a linear peptidic epitope (epitope ID 1543291) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1543291	4625	4633	VVDSYYSLL	ECO:0000213	PubMed	38781962
P0DTD1	WEPEFYEAMYTPHTV is a linear peptidic epitope (epitope ID 1543342) tested in 6 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	1543342	5308	5322	WEPEFYEAMYTPHTV	ECO:0000213	PubMed	37215095
P0DTD1	WYDFGDFIQTTPGSG is a linear peptidic epitope (epitope ID 1543385) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1543385	4608	4622	WYDFGDFIQTTPGSG	ECO:0000213	PubMed	37215095
P0DTD1	YAISAKNRARTVAGV is a linear peptidic epitope (epitope ID 1543397) tested in 7 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1543397	4938	4952	YAISAKNRARTVAGV	ECO:0000213	PubMed	37215095
P0DTD1	YFKYWDQTYHPNCVN is a linear peptidic epitope (epitope ID 1543423) tested in 6 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	1543423	4678	4692	YFKYWDQTYHPNCVN	ECO:0000213	PubMed	37215095
P0DTD1	YFNKKDWYDFVENPD is a linear peptidic epitope (epitope ID 1543426) tested in 6 T cell assays, 4 B cell assays and 4 MHC ligand assays.	IEDB	1543426	4548	4562	YFNKKDWYDFVENPD	ECO:0000213	PubMed	37215095
P0DTD1	YRYNLPTMCDIRQLL is a linear peptidic epitope (epitope ID 1543523) tested in 8 T cell assays, 4 B cell assays and 14 MHC ligand assays.	IEDB	1543523	4848	4862	YRYNLPTMCDIRQLL	ECO:0000213	PubMed	37215095
P0DTD1	YSDVENPHLMGWDYP is a linear peptidic epitope (epitope ID 1543525) tested in 6 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1543525	4998	5012	YSDVENPHLMGWDYP	ECO:0000213	PubMed	37215095
P0DTD1	YVYLPYPDPSRILGA is a linear peptidic epitope (epitope ID 1543563) tested in 9 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1543563	5218	5232	YVYLPYPDPSRILGA	ECO:0000213	PubMed	37215095
P0DTD1	YVYLPYPDPSRILGA is a linear peptidic epitope (epitope ID 1543563) tested in 9 T cell assays, 4 B cell assays and 3 MHC ligand assays.	IEDB	1543563	5218	5232	YVYLPYPDPSRILGA	ECO:0000213	PubMed	34758478
P0DTD1	EWFLAYILF is a linear peptidic epitope (epitope ID 1596995) tested in 2 T cell assays.	IEDB	1596995	2326	2334	EWFLAYILF	ECO:0000213	PubMed	34793243
P0DTD1	FLPGVYSVI is a linear peptidic epitope (epitope ID 1597017) tested in 4 T cell assays.	IEDB	1597017	3100	3108	FLPGVYSVI	ECO:0000213	PubMed	34793243
P0DTD1	FVAAIFYLI is a linear peptidic epitope (epitope ID 1597029) tested in 2 T cell assays.	IEDB	1597029	2782	2790	FVAAIFYLI	ECO:0000213	PubMed	34793243
P0DTD1	HVETFYPKL is a linear peptidic epitope (epitope ID 1597063) tested in 3 T cell assays.	IEDB	1597063	6789	6797	HVETFYPKL	ECO:0000213	PubMed	34506741
P0DTD1	IQLSSYSLF is a linear peptidic epitope (epitope ID 1597094) tested in 1 T cell assay.	IEDB	1597094	7035	7043	IQLSSYSLF	ECO:0000213	PubMed	34506741
P0DTD1	KLDGFMGRI is a linear peptidic epitope (epitope ID 1597118) tested in 3 T cell assays.	IEDB	1597118	292	300	KLDGFMGRI	ECO:0000213	PubMed	34793243
P0DTD1	QLEMELTPV is a linear peptidic epitope (epitope ID 1597273) tested in 3 T cell assays.	IEDB	1597273	1011	1019	QLEMELTPV	ECO:0000213	PubMed	34793243
P0DTD1	SQDLSVVSK is a linear peptidic epitope (epitope ID 1597346) tested in 2 T cell assays.	IEDB	1597346	6760	6768	SQDLSVVSK	ECO:0000213	PubMed	34506741
P0DTD1	SVKGLQPSV is a linear peptidic epitope (epitope ID 1597355) tested in 1 T cell assay.	IEDB	1597355	6599	6607	SVKGLQPSV	ECO:0000213	PubMed	34506741
P0DTD1	SYYSLLMPI is a linear peptidic epitope (epitope ID 1597357) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1597357	4628	4636	SYYSLLMPI	ECO:0000213	PubMed	34506741
P0DTD1	SYYSLLMPI is a linear peptidic epitope (epitope ID 1597357) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1597357	4628	4636	SYYSLLMPI	ECO:0000213	PubMed	34728796
P0DTD1	YICGFIQQK is a linear peptidic epitope (epitope ID 1597426) tested in 2 T cell assays.	IEDB	1597426	6950	6958	YICGFIQQK	ECO:0000213	PubMed	34506741
P0DTD1	FLIGCNYL is a linear peptidic epitope (epitope ID 1597687) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	1597687	7003	7010	FLIGCNYL	ECO:0000213	PubMed	34627082
P0DTD1	AMRNAGIVGV is a linear peptidic epitope (epitope ID 1645287) tested in 3 T cell assays and 2 MHC ligand assays.	IEDB	1645287	4587	4596	AMRNAGIVGV	ECO:0000213	PubMed	34728796
P0DTD1	AMRNAGIVGV is a linear peptidic epitope (epitope ID 1645287) tested in 3 T cell assays and 2 MHC ligand assays.	IEDB	1645287	4587	4596	AMRNAGIVGV	ECO:0000213	PubMed	35937077
P0DTD1	ATRGATVVI is a linear peptidic epitope (epitope ID 1646544) tested in 2 T cell assays.	IEDB	1646544	4973	4981	ATRGATVVI	ECO:0000213	PubMed	34793243
P0DTD1	CSLSHRFYR is a linear peptidic epitope (epitope ID 1648859) tested in 2 T cell assays and 2 MHC ligand assays.	IEDB	1648859	5038	5046	CSLSHRFYR	ECO:0000213	PubMed	34728796
P0DTD1	CSQHTMLVK is a linear peptidic epitope (epitope ID 1648882) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1648882	5205	5213	CSQHTMLVK	ECO:0000213	PubMed	34728796
P0DTD1	LSFKELLVYA is a linear peptidic epitope (epitope ID 1677710) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	1677710	4758	4767	LSFKELLVYA	ECO:0000213	PubMed	34728796
P0DTD1	MLKTVYSDV is a linear peptidic epitope (epitope ID 1679951) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	1679951	4993	5001	MLKTVYSDV	ECO:0000213	PubMed	34728796
P0DTD1	QLLFVVEVV is a linear peptidic epitope (epitope ID 1688296) tested in 3 T cell assays and 2 MHC ligand assays.	IEDB	1688296	4860	4868	QLLFVVEVV	ECO:0000213	PubMed	34728796
P0DTD1	QLLFVVEVV is a linear peptidic epitope (epitope ID 1688296) tested in 3 T cell assays and 2 MHC ligand assays.	IEDB	1688296	4860	4868	QLLFVVEVV	ECO:0000213	PubMed	34793243
P0DTD1	QLLFVVEVV is a linear peptidic epitope (epitope ID 1688296) tested in 3 T cell assays and 2 MHC ligand assays.	IEDB	1688296	4860	4868	QLLFVVEVV	ECO:0000213	PubMed	35937077
P0DTD1	SVAALTNNV is a linear peptidic epitope (epitope ID 1696182) tested in 2 T cell assays.	IEDB	1696182	4789	4797	SVAALTNNV	ECO:0000213	PubMed	34793243
P0DTD1	AMDEFIERY is a linear peptidic epitope (epitope ID 1855507) tested in 3 T cell assays.	IEDB	1855507	6669	6677	AMDEFIERY	ECO:0000213	PubMed	34793243
P0DTD1	HSIGFDYVY is a linear peptidic epitope (epitope ID 1857693) tested in 2 T cell assays.	IEDB	1857693	6154	6162	HSIGFDYVY	ECO:0000213	PubMed	34968416
P0DTD1	KPVETSNSF is a linear peptidic epitope (epitope ID 1858285) tested in 3 T cell assays.	IEDB	1858285	2017	2025	KPVETSNSF	ECO:0000213	PubMed	34793243
P0DTD1	LTNIFGTVY is a linear peptidic epitope (epitope ID 1858751) tested in 2 T cell assays.	IEDB	1858751	613	621	LTNIFGTVY	ECO:0000213	PubMed	34968416
P0DTD1	KVDTANPKTPK is a linear peptidic epitope (epitope ID 1861786) tested in 1 B cell assay.	IEDB	1861786	3353	3363	KVDTANPKTPK	ECO:0000213	PubMed	35074422
P0DTD1	DGTLMIERFVSLAID is a linear peptidic epitope (epitope ID 1870775) tested in 11 T cell assays and 4 MHC ligand assays.	IEDB	1870775	5243	5257	DGTLMIERFVSLAID	ECO:0000213	PubMed	37215095
P0DTD1	DGTLMIERFVSLAID is a linear peptidic epitope (epitope ID 1870775) tested in 11 T cell assays and 4 MHC ligand assays.	IEDB	1870775	5243	5257	DGTLMIERFVSLAID	ECO:0000213	PubMed	34758478
P0DTD1	EGSSVELKHFFFAQD is a linear peptidic epitope (epitope ID 1870780) tested in 8 T cell assays and 4 MHC ligand assays.	IEDB	1870780	4823	4837	EGSSVELKHFFFAQD	ECO:0000213	PubMed	37215095
P0DTD1	FTSLEIPRRNVATLQ is a linear peptidic epitope (epitope ID 1870787) tested in 2 T cell assays, 8 B cell assays and 3 MHC ligand assays.	IEDB	1870787	5911	5925	FTSLEIPRRNVATLQ	ECO:0000213	PubMed	34758478
P0DTD1	TSLLVLVQSTQWSLF is a linear peptidic epitope (epitope ID 1870817) tested in 1 T cell assay, 8 B cell assays and 3 MHC ligand assays.	IEDB	1870817	3589	3603	TSLLVLVQSTQWSLF	ECO:0000213	PubMed	35104433
P0DTD1	KLINIIIWFL is a linear peptidic epitope (epitope ID 1906343) tested in 9 T cell assays and 2 MHC ligand assays.	IEDB	1906343	2225	2234	KLINIIIWFL	ECO:0000213	PubMed	39456150
P0DTD1	TTIQTIVEV is a linear peptidic epitope (epitope ID 1938120) tested in 5 T cell assays and 2 MHC ligand assays.	IEDB	1938120	1000	1008	TTIQTIVEV	ECO:0000213	PubMed	34793243
P0DTD1	NVIPTITQMNL is a linear peptidic epitope (epitope ID 1951795) tested in 5 T cell assays.	IEDB	1951795	4926	4936	NVIPTITQMNL	ECO:0000213	PubMed	35196796
P0DTD1	YAFEHIVY is a linear peptidic epitope (epitope ID 1957592) tested in 6 T cell assays.	IEDB	1957592	6682	6689	YAFEHIVY	ECO:0000213	PubMed	35196796
P0DTD1	ASQGLVASIKNFKSV is a linear peptidic epitope (epitope ID 2117610) tested in 6 T cell assays and 6 MHC ligand assays.	IEDB	2117610	5163	5177	ASQGLVASIKNFKSV	ECO:0000213	PubMed	37215095
P0DTD1	CLDDRCILHCANFNV is a linear peptidic epitope (epitope ID 2117932) tested in 6 T cell assays and 6 MHC ligand assays.	IEDB	2117932	4693	4707	CLDDRCILHCANFNV	ECO:0000213	PubMed	37215095
P0DTD1	DAVVCFNSTYASQGL is a linear peptidic epitope (epitope ID 2118106) tested in 6 T cell assays and 6 MHC ligand assays.	IEDB	2118106	5153	5167	DAVVCFNSTYASQGL	ECO:0000213	PubMed	37215095
P0DTD1	DFAVSKGFFKEGSSV is a linear peptidic epitope (epitope ID 2118248) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	2118248	4813	4827	DFAVSKGFFKEGSSV	ECO:0000213	PubMed	37215095
P0DTD1	DFIQTTPGSGVPVVD is a linear peptidic epitope (epitope ID 2118254) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	2118254	4613	4627	DFIQTTPGSGVPVVD	ECO:0000213	PubMed	37215095
P0DTD1	DGNKIADKYVRNLQH is a linear peptidic epitope (epitope ID 2118318) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	2118318	5103	5117	DGNKIADKYVRNLQH	ECO:0000213	PubMed	37215095
P0DTD1	DMYSVMLTNDNTSRY is a linear peptidic epitope (epitope ID 2118548) tested in 6 T cell assays and 5 MHC ligand assays.	IEDB	2118548	5293	5307	DMYSVMLTNDNTSRY	ECO:0000213	PubMed	37215095
P0DTD1	EFCSQHTMLVKQGDD is a linear peptidic epitope (epitope ID 2119303) tested in 6 T cell assays and 6 MHC ligand assays.	IEDB	2119303	5203	5217	EFCSQHTMLVKQGDD	ECO:0000213	PubMed	37215095
P0DTD1	FFAQDGNAAISDYDY is a linear peptidic epitope (epitope ID 2120170) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	2120170	4833	4847	FFAQDGNAAISDYDY	ECO:0000213	PubMed	37215095
P0DTD1	GCFVDDIVKTDGTLM is a linear peptidic epitope (epitope ID 2120586) tested in 6 T cell assays and 5 MHC ligand assays.	IEDB	2120586	5233	5247	GCFVDDIVKTDGTLM	ECO:0000213	PubMed	37215095
P0DTD1	GSLYVKPGGTSSGDA is a linear peptidic epitope (epitope ID 2121329) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	2121329	5063	5077	GSLYVKPGGTSSGDA	ECO:0000213	PubMed	37215095
P0DTD1	HAASGNLLLDKRTTC is a linear peptidic epitope (epitope ID 2121498) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	2121498	4773	4787	HAASGNLLLDKRTTC	ECO:0000213	PubMed	37215095
P0DTD1	KCDRAMPNMLRIMAS is a linear peptidic epitope (epitope ID 2122633) tested in 9 T cell assays and 6 MHC ligand assays.	IEDB	2122633	5013	5027	KCDRAMPNMLRIMAS	ECO:0000213	PubMed	37215095
P0DTD1	KHFSMMILSDDAVVC is a linear peptidic epitope (epitope ID 2122892) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	2122892	5143	5157	KHFSMMILSDDAVVC	ECO:0000213	PubMed	37215095
P0DTD1	KKDWYDFVENPDILR is a linear peptidic epitope (epitope ID 2122953) tested in 1 T cell assay, 8 B cell assays and 4 MHC ligand assays.	IEDB	2122953	4551	4565	KKDWYDFVENPDILR	ECO:0000213	PubMed	38781962
P0DTD1	KPGNFNKDFYDFAVS is a linear peptidic epitope (epitope ID 2123202) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	2123202	4803	4817	KPGNFNKDFYDFAVS	ECO:0000213	PubMed	37215095
P0DTD1	KQGDDYVYLPYPDPS is a linear peptidic epitope (epitope ID 2123334) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	2123334	5213	5227	KQGDDYVYLPYPDPS	ECO:0000213	PubMed	37215095
P0DTD1	KRTTCFSVAALTNNV is a linear peptidic epitope (epitope ID 2123403) tested in 6 T cell assays and 6 MHC ligand assays.	IEDB	2123403	4783	4797	KRTTCFSVAALTNNV	ECO:0000213	PubMed	37215095
P0DTD1	LGVVHNQDVNLHSSR is a linear peptidic epitope (epitope ID 2124005) tested in 6 T cell assays and 6 MHC ligand assays.	IEDB	2124005	4743	4757	LGVVHNQDVNLHSSR	ECO:0000213	PubMed	37215095
P0DTD1	LTNNVAFQTVKPGNF is a linear peptidic epitope (epitope ID 2124718) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	2124718	4793	4807	LTNNVAFQTVKPGNF	ECO:0000213	PubMed	37215095
P0DTD1	NFKSVLYYQNNVFMS is a linear peptidic epitope (epitope ID 2125391) tested in 6 T cell assays and 5 MHC ligand assays.	IEDB	2125391	5173	5187	NFKSVLYYQNNVFMS	ECO:0000213	PubMed	37215095
P0DTD1	NQVIVNNLDKSAGFP is a linear peptidic epitope (epitope ID 2125698) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	2125698	4883	4897	NQVIVNNLDKSAGFP	ECO:0000213	PubMed	37215095
P0DTD1	NVFMSEAKCWTETDL is a linear peptidic epitope (epitope ID 2125810) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	2125810	5183	5197	NVFMSEAKCWTETDL	ECO:0000213	PubMed	37215095
P0DTD1	QHEETIYNLLKDCPA is a linear peptidic epitope (epitope ID 2126350) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	2126350	4473	4487	QHEETIYNLLKDCPA	ECO:0000213	PubMed	37215095
P0DTD1	QVLSEMVMCGGSLYV is a linear peptidic epitope (epitope ID 2126601) tested in 6 T cell assays and 6 MHC ligand assays.	IEDB	2126601	5053	5067	QVLSEMVMCGGSLYV	ECO:0000213	PubMed	37215095
P0DTD1	RFYRLANECAQVLSE is a linear peptidic epitope (epitope ID 2126793) tested in 7 T cell assays and 17 MHC ligand assays.	IEDB	2126793	5043	5057	RFYRLANECAQVLSE	ECO:0000213	PubMed	37215095
P0DTD1	SADAQSFLNRVCGVS is a linear peptidic epitope (epitope ID 2127241) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	2127241	4393	4407	SADAQSFLNRVCGVS	ECO:0000213	PubMed	37215095
P0DTD1	SDYDYYRYNLPTMCD is a linear peptidic epitope (epitope ID 2127409) tested in 6 T cell assays and 15 MHC ligand assays.	IEDB	2127409	4843	4857	SDYDYYRYNLPTMCD	ECO:0000213	PubMed	37215095
P0DTD1	SICSTMTNRQFHQKL is a linear peptidic epitope (epitope ID 2127662) tested in 6 T cell assays and 5 MHC ligand assays.	IEDB	2127662	4953	4967	SICSTMTNRQFHQKL	ECO:0000213	PubMed	37215095
P0DTD1	TANVNALLSTDGNKI is a linear peptidic epitope (epitope ID 2128509) tested in 9 T cell assays and 5 MHC ligand assays.	IEDB	2128509	5093	5107	TANVNALLSTDGNKI	ECO:0000213	PubMed	37215095
P0DTD1	TKRNVIPTITQMNLK is a linear peptidic epitope (epitope ID 2128812) tested in 9 T cell assays and 6 MHC ligand assays.	IEDB	2128812	4923	4937	TKRNVIPTITQMNLK	ECO:0000213	PubMed	37215095
P0DTD1	VPVVDSYYSLLMPIL is a linear peptidic epitope (epitope ID 2130020) tested in 6 T cell assays and 4 MHC ligand assays.	IEDB	2130020	4623	4637	VPVVDSYYSLLMPIL	ECO:0000213	PubMed	37215095
P0DTD1	DLNGNWYDFGDFIQT is a linear peptidic epitope (epitope ID 2131183) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2131183	4603	4617	DLNGNWYDFGDFIQT	ECO:0000213	PubMed	37215095
P0DTD1	DQTYHPNCVNCLDDR is a linear peptidic epitope (epitope ID 2131217) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2131217	4683	4697	DQTYHPNCVNCLDDR	ECO:0000213	PubMed	37215095
P0DTD1	DWYDFVENPDILRVY is a linear peptidic epitope (epitope ID 2131245) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2131245	4553	4567	DWYDFVENPDILRVY	ECO:0000213	PubMed	37215095
P0DTD1	FHLYLQYIRKLHDEL is a linear peptidic epitope (epitope ID 2131441) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2131441	5273	5287	FHLYLQYIRKLHDEL	ECO:0000213	PubMed	37215095
P0DTD1	FHQKLLKSIAATRGA is a linear peptidic epitope (epitope ID 2131442) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2131442	4963	4977	FHQKLLKSIAATRGA	ECO:0000213	PubMed	37215095
P0DTD1	FVNEFYAYLRKHFSM is a linear peptidic epitope (epitope ID 2131541) tested in 6 T cell assays and 14 MHC ligand assays.	IEDB	2131541	5133	5147	FVNEFYAYLRKHFSM	ECO:0000213	PubMed	37215095
P0DTD1	FVVEVVDKYFDCYDG is a linear peptidic epitope (epitope ID 2131548) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2131548	4863	4877	FVVEVVDKYFDCYDG	ECO:0000213	PubMed	37215095
P0DTD1	IFVDGVPFV is a linear peptidic epitope (epitope ID 2131839) tested in 4 T cell assays and 1 MHC ligand assay.	IEDB	2131839	4725	4733	IFVDGVPFV	ECO:0000213	PubMed	34210785
P0DTD1	ILRVYANLGERVRQA is a linear peptidic epitope (epitope ID 2131918) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2131918	4563	4577	ILRVYANLGERVRQA	ECO:0000213	PubMed	37215095
P0DTD1	IVGVLTLDNQDLNGN is a linear peptidic epitope (epitope ID 2132010) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132010	4593	4607	IVGVLTLDNQDLNGN	ECO:0000213	PubMed	37215095
P0DTD1	KARLYYDSMSYEDQD is a linear peptidic epitope (epitope ID 2132035) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132035	4903	4917	KARLYYDSMSYEDQD	ECO:0000213	PubMed	37215095
P0DTD1	KDCPAVAKHDFFKFR is a linear peptidic epitope (epitope ID 2132043) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132043	4483	4497	KDCPAVAKHDFFKFR	ECO:0000213	PubMed	37215095
P0DTD1	KHPNQEYADVFHLYL is a linear peptidic epitope (epitope ID 2132081) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132081	5263	5277	KHPNQEYADVFHLYL	ECO:0000213	PubMed	37215095
P0DTD1	KHTTCCSLSHRFYRL is a linear peptidic epitope (epitope ID 2132082) tested in 6 T cell assays and 14 MHC ligand assays.	IEDB	2132082	5033	5047	KHTTCCSLSHRFYRL	ECO:0000213	PubMed	37215095
P0DTD1	KLFDRYFKYWDQTYH is a linear peptidic epitope (epitope ID 2132107) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132107	4673	4687	KLFDRYFKYWDQTYH	ECO:0000213	PubMed	37215095
P0DTD1	KNRARTVAGVSICST is a linear peptidic epitope (epitope ID 2132130) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132130	4943	4957	KNRARTVAGVSICST	ECO:0000213	PubMed	37215095
P0DTD1	KVAGFAKFLKTNCCR is a linear peptidic epitope (epitope ID 2132184) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132184	4433	4447	KVAGFAKFLKTNCCR	ECO:0000213	PubMed	37215095
P0DTD1	KYTMADLVYALRHFD is a linear peptidic epitope (epitope ID 2132206) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132206	4513	4527	KYTMADLVYALRHFD	ECO:0000213	PubMed	37215095
P0DTD1	LMPILTLTRALTAES is a linear peptidic epitope (epitope ID 2132372) tested in 6 T cell assays and 14 MHC ligand assays.	IEDB	2132372	4633	4647	LMPILTLTRALTAES	ECO:0000213	PubMed	37215095
P0DTD1	LRHFDEGNCDTLKEI is a linear peptidic epitope (epitope ID 2132424) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132424	4523	4537	LRHFDEGNCDTLKEI	ECO:0000213	PubMed	37215095
P0DTD1	LTAESHVDTDLTKPY is a linear peptidic epitope (epitope ID 2132456) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132456	4643	4657	LTAESHVDTDLTKPY	ECO:0000213	PubMed	37215095
P0DTD1	LTKPYIKWDLLKYDF is a linear peptidic epitope (epitope ID 2132463) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132463	4653	4667	LTKPYIKWDLLKYDF	ECO:0000213	PubMed	37215095
P0DTD1	LYRNRDVDTDFVNEF is a linear peptidic epitope (epitope ID 2132518) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132518	5123	5137	LYRNRDVDTDFVNEF	ECO:0000213	PubMed	37215095
P0DTD1	MLKTVYSDVENPHLM is a linear peptidic epitope (epitope ID 2132554) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132554	4993	5007	MLKTVYSDVENPHLM	ECO:0000213	PubMed	37215095
P0DTD1	NPHLMGWDYPKCDRA is a linear peptidic epitope (epitope ID 2132681) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132681	5003	5017	NPHLMGWDYPKCDRA	ECO:0000213	PubMed	37215095
P0DTD1	NTSRYWEPEFYEAMY is a linear peptidic epitope (epitope ID 2132716) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132716	5303	5317	NTSRYWEPEFYEAMY	ECO:0000213	PubMed	37215095
P0DTD1	PCGTGTSTDVVYRAF is a linear peptidic epitope (epitope ID 2132747) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132747	4413	4427	PCGTGTSTDVVYRAF	ECO:0000213	PubMed	37215095
P0DTD1	PTMCDIRQLLFVVEV is a linear peptidic epitope (epitope ID 2132833) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132833	4853	4867	PTMCDIRQLLFVVEV	ECO:0000213	PubMed	37215095
P0DTD1	QFCDAMRNAGIVGVL is a linear peptidic epitope (epitope ID 2132881) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2132881	4583	4597	QFCDAMRNAGIVGVL	ECO:0000213	PubMed	37215095
P0DTD1	RIMASLVLARKHTTC is a linear peptidic epitope (epitope ID 2133001) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2133001	5023	5037	RIMASLVLARKHTTC	ECO:0000213	PubMed	37215095
P0DTD1	RNLQHRLYECLYRNR is a linear peptidic epitope (epitope ID 2133021) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2133021	5113	5127	RNLQHRLYECLYRNR	ECO:0000213	PubMed	37215095
P0DTD1	RVRQALLKTVQFCDA is a linear peptidic epitope (epitope ID 2133059) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2133059	4573	4587	RVRQALLKTVQFCDA	ECO:0000213	PubMed	37215095
P0DTD1	SAGFPFNKWGKARLY is a linear peptidic epitope (epitope ID 2133077) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2133077	4893	4907	SAGFPFNKWGKARLY	ECO:0000213	PubMed	37215095
P0DTD1	SSGDATTAYANSVFN is a linear peptidic epitope (epitope ID 2133238) tested in 6 T cell assays and 14 MHC ligand assays.	IEDB	2133238	5073	5087	SSGDATTAYANSVFN	ECO:0000213	PubMed	37215095
P0DTD1	TETDLTKGPHEFCSQ is a linear peptidic epitope (epitope ID 2133339) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2133339	5193	5207	TETDLTKGPHEFCSQ	ECO:0000213	PubMed	37215095
P0DTD1	TLKEILVTYNCCDDD is a linear peptidic epitope (epitope ID 2133395) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2133395	4533	4547	TLKEILVTYNCCDDD	ECO:0000213	PubMed	37215095
P0DTD1	TNCCRFQEKDEDDNL is a linear peptidic epitope (epitope ID 2133418) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2133418	4443	4457	TNCCRFQEKDEDDNL	ECO:0000213	PubMed	37215095
P0DTD1	TSKFYGGWHNMLKTV is a linear peptidic epitope (epitope ID 2133463) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2133463	4983	4997	TSKFYGGWHNMLKTV	ECO:0000213	PubMed	37215095
P0DTD1	VPHISRQRLTKYTMA is a linear peptidic epitope (epitope ID 2133690) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2133690	4503	4517	VPHISRQRLTKYTMA	ECO:0000213	PubMed	37215095
P0DTD1	VYRAFDIYNDKVAGF is a linear peptidic epitope (epitope ID 2133802) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2133802	4423	4437	VYRAFDIYNDKVAGF	ECO:0000213	PubMed	37215095
P0DTD1	YEDQDALFAYTKRNV is a linear peptidic epitope (epitope ID 2133871) tested in 6 T cell assays and 14 MHC ligand assays.	IEDB	2133871	4913	4927	YEDQDALFAYTKRNV	ECO:0000213	PubMed	37215095
P0DTD1	YPDPSRILGAGCFVD is a linear peptidic epitope (epitope ID 2133935) tested in 6 T cell assays and 3 MHC ligand assays.	IEDB	2133935	5223	5237	YPDPSRILGAGCFVD	ECO:0000213	PubMed	37215095
P0DTD1	AHIQWMVMF is a linear peptidic epitope (epitope ID 2133992) tested in 1 T cell assay.	IEDB	2133992	3124	3132	AHIQWMVMF	ECO:0000213	PubMed	34793243
P0DTD1	ALNNIINNA is a linear peptidic epitope (epitope ID 2133995) tested in 2 T cell assays.	IEDB	2133995	4044	4052	ALNNIINNA	ECO:0000213	PubMed	34793243
P0DTD1	ALPETTADI is a linear peptidic epitope (epitope ID 2133996) tested in 2 T cell assays.	IEDB	2133996	5686	5694	ALPETTADI	ECO:0000213	PubMed	34793243
P0DTD1	ALYYPSARI is a linear peptidic epitope (epitope ID 2133999) tested in 2 T cell assays.	IEDB	2133999	5620	5628	ALYYPSARI	ECO:0000213	PubMed	34793243
P0DTD1	AMMFTSDLA is a linear peptidic epitope (epitope ID 2134002) tested in 1 T cell assay.	IEDB	2134002	583	591	AMMFTSDLA	ECO:0000213	PubMed	34793243
P0DTD1	APISAMVRM is a linear peptidic epitope (epitope ID 2134005) tested in 3 T cell assays.	IEDB	2134005	2375	2383	APISAMVRM	ECO:0000213	PubMed	34793243
P0DTD1	APISAMVRM is a linear peptidic epitope (epitope ID 2134005) tested in 3 T cell assays.	IEDB	2134005	2375	2383	APISAMVRM	ECO:0000213	PubMed	38045681
P0DTD1	AVIKTLQPV is a linear peptidic epitope (epitope ID 2134012) tested in 2 T cell assays.	IEDB	2134012	878	886	AVIKTLQPV	ECO:0000213	PubMed	34793243
P0DTD1	AVIKTLQPV is a linear peptidic epitope (epitope ID 2134012) tested in 2 T cell assays.	IEDB	2134012	878	886	AVIKTLQPV	ECO:0000213	PubMed	37193826
P0DTD1	AVLDMCASL is a linear peptidic epitope (epitope ID 2134013) tested in 1 T cell assay.	IEDB	2134013	3523	3531	AVLDMCASL	ECO:0000213	PubMed	34793243
P0DTD1	CLAVHECFV is a linear peptidic epitope (epitope ID 2134015) tested in 2 T cell assays.	IEDB	2134015	6204	6212	CLAVHECFV	ECO:0000213	PubMed	34793243
P0DTD1	CLAYYFMRF is a linear peptidic epitope (epitope ID 2134016) tested in 1 T cell assay.	IEDB	2134016	3059	3067	CLAYYFMRF	ECO:0000213	PubMed	34793243
P0DTD1	CLGSLIYST is a linear peptidic epitope (epitope ID 2134017) tested in 1 T cell assay.	IEDB	2134017	2239	2247	CLGSLIYST	ECO:0000213	PubMed	34793243
P0DTD1	CLTPVYSFL is a linear peptidic epitope (epitope ID 2134018) tested in 2 T cell assays.	IEDB	2134018	3093	3101	CLTPVYSFL	ECO:0000213	PubMed	34793243
P0DTD1	CPACHNSEV is a linear peptidic epitope (epitope ID 2134019) tested in 1 T cell assay.	IEDB	2134019	370	378	CPACHNSEV	ECO:0000213	PubMed	34793243
P0DTD1	CVMYASAVV is a linear peptidic epitope (epitope ID 2134022) tested in 1 T cell assay.	IEDB	2134022	3682	3690	CVMYASAVV	ECO:0000213	PubMed	34793243
P0DTD1	DYTEISFML is a linear peptidic epitope (epitope ID 2134037) tested in 1 T cell assay.	IEDB	2134037	6775	6783	DYTEISFML	ECO:0000213	PubMed	34793243
P0DTD1	ELTSMKYFV is a linear peptidic epitope (epitope ID 2134040) tested in 2 T cell assays.	IEDB	2134040	6116	6124	ELTSMKYFV	ECO:0000213	PubMed	34793243
P0DTD1	EWSMATYYL is a linear peptidic epitope (epitope ID 2134046) tested in 1 T cell assay.	IEDB	2134046	899	907	EWSMATYYL	ECO:0000213	PubMed	34793243
P0DTD1	FFSYFAVHF is a linear peptidic epitope (epitope ID 2134049) tested in 1 T cell assay.	IEDB	2134049	2350	2358	FFSYFAVHF	ECO:0000213	PubMed	34793243
P0DTD1	FISTCACEI is a linear peptidic epitope (epitope ID 2134051) tested in 2 T cell assays.	IEDB	2134051	651	659	FISTCACEI	ECO:0000213	PubMed	34793243
P0DTD1	FLCLFLLPS is a linear peptidic epitope (epitope ID 2134054) tested in 2 T cell assays.	IEDB	2134054	3635	3643	FLCLFLLPS	ECO:0000213	PubMed	34793243
P0DTD1	FLEGETLPT is a linear peptidic epitope (epitope ID 2134057) tested in 1 T cell assay.	IEDB	2134057	741	749	FLEGETLPT	ECO:0000213	PubMed	34793243
P0DTD1	FLIGCNYLG is a linear peptidic epitope (epitope ID 2134059) tested in 2 T cell assays.	IEDB	2134059	7003	7011	FLIGCNYLG	ECO:0000213	PubMed	34793243
P0DTD1	FLNKVVSTT is a linear peptidic epitope (epitope ID 2134060) tested in 2 T cell assays.	IEDB	2134060	2145	2153	FLNKVVSTT	ECO:0000213	PubMed	34793243
P0DTD1	FLPFAMGII is a linear peptidic epitope (epitope ID 2134061) tested in 1 T cell assay and 1 MHC ligand assay.	IEDB	2134061	3611	3619	FLPFAMGII	ECO:0000213	PubMed	34793243
P0DTD1	FMCVEYCPI is a linear peptidic epitope (epitope ID 2134065) tested in 2 T cell assays.	IEDB	2134065	3760	3768	FMCVEYCPI	ECO:0000213	PubMed	34793243
P0DTD1	FMIDVQQWG is a linear peptidic epitope (epitope ID 2134066) tested in 2 T cell assays.	IEDB	2134066	6165	6173	FMIDVQQWG	ECO:0000213	PubMed	34793243
P0DTD1	FMSEAKCWT is a linear peptidic epitope (epitope ID 2134067) tested in 1 T cell assay.	IEDB	2134067	5185	5193	FMSEAKCWT	ECO:0000213	PubMed	34793243
P0DTD1	FPDLNGDVV is a linear peptidic epitope (epitope ID 2134068) tested in 1 T cell assay.	IEDB	2134068	1960	1968	FPDLNGDVV	ECO:0000213	PubMed	34793243
P0DTD1	FPLCANGQV is a linear peptidic epitope (epitope ID 2134070) tested in 1 T cell assay.	IEDB	2134070	5405	5413	FPLCANGQV	ECO:0000213	PubMed	34793243
P0DTD1	FSASTSAFV is a linear peptidic epitope (epitope ID 2134073) tested in 2 T cell assays.	IEDB	2134073	480	488	FSASTSAFV	ECO:0000213	PubMed	34793243
P0DTD1	FTPLVPFWI is a linear peptidic epitope (epitope ID 2134079) tested in 1 T cell assay.	IEDB	2134079	3132	3140	FTPLVPFWI	ECO:0000213	PubMed	34793243
P0DTD1	FTVLCLTPV is a linear peptidic epitope (epitope ID 2134080) tested in 2 T cell assays.	IEDB	2134080	3089	3097	FTVLCLTPV	ECO:0000213	PubMed	34793243
P0DTD1	FVCDNIKFA is a linear peptidic epitope (epitope ID 2134081) tested in 2 T cell assays.	IEDB	2134081	1930	1938	FVCDNIKFA	ECO:0000213	PubMed	34793243
P0DTD1	FVFPLNSII is a linear peptidic epitope (epitope ID 2134082) tested in 1 T cell assay.	IEDB	2134082	273	281	FVFPLNSII	ECO:0000213	PubMed	34793243
P0DTD1	FVMMSAPPA is a linear peptidic epitope (epitope ID 2134083) tested in 3 T cell assays.	IEDB	2134083	1804	1812	FVMMSAPPA	ECO:0000213	PubMed	34793243
P0DTD1	FVMMSAPPA is a linear peptidic epitope (epitope ID 2134083) tested in 3 T cell assays.	IEDB	2134083	1804	1812	FVMMSAPPA	ECO:0000213	PubMed	37193826
P0DTD1	FWITIAYII is a linear peptidic epitope (epitope ID 2134084) tested in 1 T cell assay.	IEDB	2134084	3138	3146	FWITIAYII	ECO:0000213	PubMed	34793243
P0DTD1	FYWFFSNYL is a linear peptidic epitope (epitope ID 2134086) tested in 2 T cell assays.	IEDB	2134086	3153	3161	FYWFFSNYL	ECO:0000213	PubMed	34793243
P0DTD1	GIIAMSAFA is a linear peptidic epitope (epitope ID 2134092) tested in 2 T cell assays.	IEDB	2134092	3617	3625	GIIAMSAFA	ECO:0000213	PubMed	34793243
P0DTD1	GLALYYPSA is a linear peptidic epitope (epitope ID 2134093) tested in 1 T cell assay.	IEDB	2134093	5618	5626	GLALYYPSA	ECO:0000213	PubMed	34793243
P0DTD1	GLFKDCSKV is a linear peptidic epitope (epitope ID 2134094) tested in 2 T cell assays.	IEDB	2134094	5931	5939	GLFKDCSKV	ECO:0000213	PubMed	34793243
P0DTD1	GLPWNVVRI is a linear peptidic epitope (epitope ID 2134096) tested in 3 T cell assays.	IEDB	2134096	6081	6089	GLPWNVVRI	ECO:0000213	PubMed	34793243
P0DTD1	GVFCGVDAV is a linear peptidic epitope (epitope ID 2134099) tested in 1 T cell assay.	IEDB	2134099	3016	3024	GVFCGVDAV	ECO:0000213	PubMed	34793243
P0DTD1	HSDKFTDGV is a linear peptidic epitope (epitope ID 2134102) tested in 1 T cell assay.	IEDB	2134102	6298	6306	HSDKFTDGV	ECO:0000213	PubMed	34793243
P0DTD1	HTDLMAAYV is a linear peptidic epitope (epitope ID 2134104) tested in 2 T cell assays.	IEDB	2134104	2092	2100	HTDLMAAYV	ECO:0000213	PubMed	34793243
P0DTD1	ILAYCNKTV is a linear peptidic epitope (epitope ID 2134112) tested in 2 T cell assays.	IEDB	2134112	1714	1722	ILAYCNKTV	ECO:0000213	PubMed	34793243
P0DTD1	ILRKGGRTI is a linear peptidic epitope (epitope ID 2134114) tested in 1 T cell assay.	IEDB	2134114	396	404	ILRKGGRTI	ECO:0000213	PubMed	34793243
P0DTD1	IMMNVAKYT is a linear peptidic epitope (epitope ID 2134116) tested in 1 T cell assay.	IEDB	2134116	6838	6846	IMMNVAKYT	ECO:0000213	PubMed	34793243
P0DTD1	IPVAYRKVL is a linear peptidic epitope (epitope ID 2134121) tested in 2 T cell assays.	IEDB	2134121	114	122	IPVAYRKVL	ECO:0000213	PubMed	34793243
P0DTD1	KITEHSWNA is a linear peptidic epitope (epitope ID 2134137) tested in 2 T cell assays.	IEDB	2134137	6968	6976	KITEHSWNA	ECO:0000213	PubMed	34793243
P0DTD1	KLASHMYCS is a linear peptidic epitope (epitope ID 2134138) tested in 2 T cell assays.	IEDB	2134138	915	923	KLASHMYCS	ECO:0000213	PubMed	34793243
P0DTD1	KLLKSIAAT is a linear peptidic epitope (epitope ID 2134140) tested in 1 T cell assay.	IEDB	2134140	4966	4974	KLLKSIAAT	ECO:0000213	PubMed	34793243
P0DTD1	KLQFTSLEI is a linear peptidic epitope (epitope ID 2134141) tested in 2 T cell assays.	IEDB	2134141	5908	5916	KLQFTSLEI	ECO:0000213	PubMed	34793243
P0DTD1	KMFDAYVNT is a linear peptidic epitope (epitope ID 2134142) tested in 2 T cell assays.	IEDB	2134142	2589	2597	KMFDAYVNT	ECO:0000213	PubMed	34793243
P0DTD1	KMFDAYVNT is a linear peptidic epitope (epitope ID 2134142) tested in 2 T cell assays.	IEDB	2134142	2589	2597	KMFDAYVNT	ECO:0000213	PubMed	37193826
P0DTD1	KMVSLLSVL is a linear peptidic epitope (epitope ID 2134143) tested in 1 T cell assay.	IEDB	2134143	3910	3918	KMVSLLSVL	ECO:0000213	PubMed	34793243
P0DTD1	KPASRELKV is a linear peptidic epitope (epitope ID 2134146) tested in 1 T cell assay.	IEDB	2134146	1949	1957	KPASRELKV	ECO:0000213	PubMed	34793243
P0DTD1	KQLIKVTLV is a linear peptidic epitope (epitope ID 2134148) tested in 2 T cell assays.	IEDB	2134148	2771	2779	KQLIKVTLV	ECO:0000213	PubMed	34793243
P0DTD1	KQLPFFYYS is a linear peptidic epitope (epitope ID 2134149) tested in 2 T cell assays.	IEDB	2134149	6365	6373	KQLPFFYYS	ECO:0000213	PubMed	34793243
P0DTD1	KSVNITFEL is a linear peptidic epitope (epitope ID 2134151) tested in 3 T cell assays.	IEDB	2134151	837	845	KSVNITFEL	ECO:0000213	PubMed	34793243
P0DTD1	LFTRFFYVL is a linear peptidic epitope (epitope ID 2134158) tested in 2 T cell assays.	IEDB	2134158	2333	2341	LFTRFFYVL	ECO:0000213	PubMed	34793243
P0DTD1	LLTILTSLL is a linear peptidic epitope (epitope ID 2134163) tested in 1 T cell assay.	IEDB	2134163	3584	3592	LLTILTSLL	ECO:0000213	PubMed	34793243
P0DTD1	LLTNMFTPL is a linear peptidic epitope (epitope ID 2134164) tested in 1 T cell assay.	IEDB	2134164	3026	3034	LLTNMFTPL	ECO:0000213	PubMed	34793243
P0DTD1	LMCQPILLL is a linear peptidic epitope (epitope ID 2134165) tested in 2 T cell assays.	IEDB	2134165	2564	2572	LMCQPILLL	ECO:0000213	PubMed	34793243
P0DTD1	LMGHFAWWT is a linear peptidic epitope (epitope ID 2134166) tested in 1 T cell assay.	IEDB	2134166	6981	6989	LMGHFAWWT	ECO:0000213	PubMed	34793243
P0DTD1	LMNVLTLVY is a linear peptidic epitope (epitope ID 2134168) tested in 3 T cell assays and 1 MHC ligand assay.	IEDB	2134168	3711	3719	LMNVLTLVY	ECO:0000213	PubMed	34793243
P0DTD1	LPGCDGGSL is a linear peptidic epitope (epitope ID 2134173) tested in 2 T cell assays.	IEDB	2134173	6336	6344	LPGCDGGSL	ECO:0000213	PubMed	34793243
P0DTD1	LPSYAAFAT is a linear peptidic epitope (epitope ID 2134177) tested in 1 T cell assay.	IEDB	2134177	3951	3959	LPSYAAFAT	ECO:0000213	PubMed	34793243
P0DTD1	LQAENVTGL is a linear peptidic epitope (epitope ID 2134179) tested in 1 T cell assay.	IEDB	2134179	5924	5932	LQAENVTGL	ECO:0000213	PubMed	34793243
P0DTD1	LQAGNATEV is a linear peptidic epitope (epitope ID 2134180) tested in 1 T cell assay.	IEDB	2134180	4252	4260	LQAGNATEV	ECO:0000213	PubMed	34793243
P0DTD1	LQNNELSPV is a linear peptidic epitope (epitope ID 2134181) tested in 1 T cell assay.	IEDB	2134181	4139	4147	LQNNELSPV	ECO:0000213	PubMed	34793243
P0DTD1	LSDLQDLKW is a linear peptidic epitope (epitope ID 2134182) tested in 1 T cell assay.	IEDB	2134182	4185	4193	LSDLQDLKW	ECO:0000213	PubMed	34793243
P0DTD1	LSDRVVFVL is a linear peptidic epitope (epitope ID 2134183) tested in 1 T cell assay.	IEDB	2134183	6102	6110	LSDRVVFVL	ECO:0000213	PubMed	34793243
P0DTD1	LTSHTVMPL is a linear peptidic epitope (epitope ID 2134185) tested in 1 T cell assay.	IEDB	2134185	5551	5559	LTSHTVMPL	ECO:0000213	PubMed	34793243
P0DTD1	LVFLFVAAI is a linear peptidic epitope (epitope ID 2134187) tested in 1 T cell assay.	IEDB	2134187	2778	2786	LVFLFVAAI	ECO:0000213	PubMed	34793243
P0DTD1	LVQSTQWSL is a linear peptidic epitope (epitope ID 2134189) tested in 2 T cell assays.	IEDB	2134189	3594	3602	LVQSTQWSL	ECO:0000213	PubMed	34793243
P0DTD1	MIDVQQWGF is a linear peptidic epitope (epitope ID 2134195) tested in 1 T cell assay.	IEDB	2134195	6166	6174	MIDVQQWGF	ECO:0000213	PubMed	34793243
P0DTD1	MLNPNYEDL is a linear peptidic epitope (epitope ID 2134196) tested in 2 T cell assays.	IEDB	2134196	3312	3320	MLNPNYEDL	ECO:0000213	PubMed	34793243
P0DTD1	MMFTSDLAT is a linear peptidic epitope (epitope ID 2134197) tested in 1 T cell assay.	IEDB	2134197	584	592	MMFTSDLAT	ECO:0000213	PubMed	34793243
P0DTD1	MMILSDDAV is a linear peptidic epitope (epitope ID 2134198) tested in 2 T cell assays.	IEDB	2134198	5147	5155	MMILSDDAV	ECO:0000213	PubMed	34793243
P0DTD1	MQVESDDYI is a linear peptidic epitope (epitope ID 2134202) tested in 2 T cell assays.	IEDB	2134202	1083	1091	MQVESDDYI	ECO:0000213	PubMed	34793243
P0DTD1	MSAFAMMFV is a linear peptidic epitope (epitope ID 2134203) tested in 3 T cell assays.	IEDB	2134203	3621	3629	MSAFAMMFV	ECO:0000213	PubMed	34793243
P0DTD1	MSDVKCTSV is a linear peptidic epitope (epitope ID 2134204) tested in 2 T cell assays.	IEDB	2134204	3862	3870	MSDVKCTSV	ECO:0000213	PubMed	34793243
P0DTD1	MVTNNTFTL is a linear peptidic epitope (epitope ID 2134205) tested in 2 T cell assays.	IEDB	2134205	807	815	MVTNNTFTL	ECO:0000213	PubMed	34793243
P0DTD1	NFSKLINII is a linear peptidic epitope (epitope ID 2134206) tested in 1 T cell assay.	IEDB	2134206	2222	2230	NFSKLINII	ECO:0000213	PubMed	34793243
P0DTD1	NLHPDSATL is a linear peptidic epitope (epitope ID 2134210) tested in 2 T cell assays.	IEDB	2134210	1262	1270	NLHPDSATL	ECO:0000213	PubMed	34793243
P0DTD1	NLQSNHDLY is a linear peptidic epitope (epitope ID 2134211) tested in 1 T cell assay.	IEDB	2134211	6177	6185	NLQSNHDLY	ECO:0000213	PubMed	34793243
P0DTD1	NMMVTNNTF is a linear peptidic epitope (epitope ID 2134212) tested in 1 T cell assay.	IEDB	2134212	805	813	NMMVTNNTF	ECO:0000213	PubMed	34793243
P0DTD1	NSSTCMMCY is a linear peptidic epitope (epitope ID 2134218) tested in 2 T cell assays.	IEDB	2134218	2405	2413	NSSTCMMCY	ECO:0000213	PubMed	34793243
P0DTD1	NTFSSTFNV is a linear peptidic epitope (epitope ID 2134220) tested in 4 T cell assays.	IEDB	2134220	2596	2604	NTFSSTFNV	ECO:0000213	PubMed	34793243
P0DTD1	NTFSSTFNV is a linear peptidic epitope (epitope ID 2134220) tested in 4 T cell assays.	IEDB	2134220	2596	2604	NTFSSTFNV	ECO:0000213	PubMed	37193826
P0DTD1	NTLQCIMLV is a linear peptidic epitope (epitope ID 2134221) tested in 2 T cell assays.	IEDB	2134221	3774	3782	NTLQCIMLV	ECO:0000213	PubMed	34793243
P0DTD1	NVLTLVYKV is a linear peptidic epitope (epitope ID 2134223) tested in 2 T cell assays.	IEDB	2134223	3713	3721	NVLTLVYKV	ECO:0000213	PubMed	34793243
P0DTD1	QADVEWKFY is a linear peptidic epitope (epitope ID 2134234) tested in 1 T cell assay.	IEDB	2134234	6268	6276	QADVEWKFY	ECO:0000213	PubMed	34793243
P0DTD1	QAWQPGVAM is a linear peptidic epitope (epitope ID 2134236) tested in 2 T cell assays.	IEDB	2134236	6801	6809	QAWQPGVAM	ECO:0000213	PubMed	34793243
P0DTD1	QINDMILSL is a linear peptidic epitope (epitope ID 2134238) tested in 2 T cell assays.	IEDB	2134238	7064	7072	QINDMILSL	ECO:0000213	PubMed	34793243
P0DTD1	QINDMILSL is a linear peptidic epitope (epitope ID 2134238) tested in 2 T cell assays.	IEDB	2134238	7064	7072	QINDMILSL	ECO:0000213	PubMed	39456150
P0DTD1	QMAPISAMV is a linear peptidic epitope (epitope ID 2134240) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	2134240	2373	2381	QMAPISAMV	ECO:0000213	PubMed	34793243
P0DTD1	QVVSDIDYV is a linear peptidic epitope (epitope ID 2134246) tested in 2 T cell assays.	IEDB	2134246	6383	6391	QVVSDIDYV	ECO:0000213	PubMed	34793243
P0DTD1	RAMPNMLRI is a linear peptidic epitope (epitope ID 2134248) tested in 2 T cell assays.	IEDB	2134248	5016	5024	RAMPNMLRI	ECO:0000213	PubMed	34793243
P0DTD1	RIMASLVLA is a linear peptidic epitope (epitope ID 2134253) tested in 1 T cell assay.	IEDB	2134253	5023	5031	RIMASLVLA	ECO:0000213	PubMed	34793243
P0DTD1	RLSFKELLV is a linear peptidic epitope (epitope ID 2134254) tested in 2 T cell assays.	IEDB	2134254	4757	4765	RLSFKELLV	ECO:0000213	PubMed	34793243
P0DTD1	RLSFKELLV is a linear peptidic epitope (epitope ID 2134254) tested in 2 T cell assays.	IEDB	2134254	4757	4765	RLSFKELLV	ECO:0000213	PubMed	38781962
P0DTD1	RLYLDAYNM is a linear peptidic epitope (epitope ID 2134256) tested in 1 T cell assay.	IEDB	2134256	6417	6425	RLYLDAYNM	ECO:0000213	PubMed	34793243
P0DTD1	RVCTNYMPY is a linear peptidic epitope (epitope ID 2134265) tested in 1 T cell assay.	IEDB	2134265	2163	2171	RVCTNYMPY	ECO:0000213	PubMed	34793243
P0DTD1	SACVLAAEC is a linear peptidic epitope (epitope ID 2134266) tested in 1 T cell assay.	IEDB	2134266	2911	2919	SACVLAAEC	ECO:0000213	PubMed	34793243
P0DTD1	SLLVLVQST is a linear peptidic epitope (epitope ID 2134272) tested in 1 T cell assay.	IEDB	2134272	3590	3598	SLLVLVQST	ECO:0000213	PubMed	34793243
P0DTD1	SMDNSPNLA is a linear peptidic epitope (epitope ID 2134276) tested in 2 T cell assays.	IEDB	2134276	4115	4123	SMDNSPNLA	ECO:0000213	PubMed	34793243
P0DTD1	SMMILSDDA is a linear peptidic epitope (epitope ID 2134277) tested in 2 T cell assays.	IEDB	2134277	5146	5154	SMMILSDDA	ECO:0000213	PubMed	34793243
P0DTD1	STQWSLFFF is a linear peptidic epitope (epitope ID 2134286) tested in 1 T cell assay.	IEDB	2134286	3597	3605	STQWSLFFF	ECO:0000213	PubMed	34793243
P0DTD1	SVFNICQAV is a linear peptidic epitope (epitope ID 2134288) tested in 2 T cell assays.	IEDB	2134288	5084	5092	SVFNICQAV	ECO:0000213	PubMed	34793243
P0DTD1	SVIYLYLTF is a linear peptidic epitope (epitope ID 2134289) tested in 1 T cell assay.	IEDB	2134289	3106	3114	SVIYLYLTF	ECO:0000213	PubMed	34793243
P0DTD1	SVLYYQNNV is a linear peptidic epitope (epitope ID 2134290) tested in 2 T cell assays.	IEDB	2134290	5176	5184	SVLYYQNNV	ECO:0000213	PubMed	34793243
P0DTD1	TCDGTTFTY is a linear peptidic epitope (epitope ID 2134292) tested in 2 T cell assays.	IEDB	2134292	4083	4091	TCDGTTFTY	ECO:0000213	PubMed	34793243
P0DTD1	TILTSLLVL is a linear peptidic epitope (epitope ID 2134295) tested in 1 T cell assay.	IEDB	2134295	3586	3594	TILTSLLVL	ECO:0000213	PubMed	34793243
P0DTD1	TIVEVQPQL is a linear peptidic epitope (epitope ID 2134296) tested in 2 T cell assays.	IEDB	2134296	1004	1012	TIVEVQPQL	ECO:0000213	PubMed	34793243
P0DTD1	TLKNTVCTV is a linear peptidic epitope (epitope ID 2134298) tested in 2 T cell assays.	IEDB	2134298	4364	4372	TLKNTVCTV	ECO:0000213	PubMed	34793243
P0DTD1	TLLFLMSFT is a linear peptidic epitope (epitope ID 2134299) tested in 1 T cell assay.	IEDB	2134299	3082	3090	TLLFLMSFT	ECO:0000213	PubMed	34793243
P0DTD1	TLNDFNLVA is a linear peptidic epitope (epitope ID 2134300) tested in 2 T cell assays.	IEDB	2134300	3489	3497	TLNDFNLVA	ECO:0000213	PubMed	34793243
P0DTD1	TLVFLFVAA is a linear peptidic epitope (epitope ID 2134302) tested in 1 T cell assay.	IEDB	2134302	2777	2785	TLVFLFVAA	ECO:0000213	PubMed	34793243
P0DTD1	TMCDIRQLL is a linear peptidic epitope (epitope ID 2134303) tested in 2 T cell assays.	IEDB	2134303	4854	4862	TMCDIRQLL	ECO:0000213	PubMed	34793243
P0DTD1	TQMNLKYAI is a linear peptidic epitope (epitope ID 2134305) tested in 2 T cell assays.	IEDB	2134305	4932	4940	TQMNLKYAI	ECO:0000213	PubMed	34793243
P0DTD1	TQMNLKYAI is a linear peptidic epitope (epitope ID 2134305) tested in 2 T cell assays.	IEDB	2134305	4932	4940	TQMNLKYAI	ECO:0000213	PubMed	38781962
P0DTD1	TQWSLFFFL is a linear peptidic epitope (epitope ID 2134306) tested in 2 T cell assays.	IEDB	2134306	3598	3606	TQWSLFFFL	ECO:0000213	PubMed	34793243
P0DTD1	TSAMQTMLF is a linear peptidic epitope (epitope ID 2134308) tested in 3 T cell assays.	IEDB	2134308	4026	4034	TSAMQTMLF	ECO:0000213	PubMed	34793243
P0DTD1	TSQWLTNIF is a linear peptidic epitope (epitope ID 2134312) tested in 3 T cell assays.	IEDB	2134312	609	617	TSQWLTNIF	ECO:0000213	PubMed	34793243
P0DTD1	TTLNDFNLV is a linear peptidic epitope (epitope ID 2134314) tested in 1 T cell assay.	IEDB	2134314	3488	3496	TTLNDFNLV	ECO:0000213	PubMed	34793243
P0DTD1	VAFNTLLFL is a linear peptidic epitope (epitope ID 2134318) tested in 1 T cell assay.	IEDB	2134318	3078	3086	VAFNTLLFL	ECO:0000213	PubMed	34793243
P0DTD1	VLCNSQTSL is a linear peptidic epitope (epitope ID 2134325) tested in 1 T cell assay.	IEDB	2134325	5330	5338	VLCNSQTSL	ECO:0000213	PubMed	34793243
P0DTD1	VLQVRDVLV is a linear peptidic epitope (epitope ID 2134326) tested in 1 T cell assay.	IEDB	2134326	20	28	VLQVRDVLV	ECO:0000213	PubMed	34793243
P0DTD1	VLSTFISAA is a linear peptidic epitope (epitope ID 2134328) tested in 2 T cell assays.	IEDB	2134328	2629	2637	VLSTFISAA	ECO:0000213	PubMed	34793243
P0DTD1	VMHANYIFW is a linear peptidic epitope (epitope ID 2134330) tested in 2 T cell assays.	IEDB	2134330	7021	7029	VMHANYIFW	ECO:0000213	PubMed	34793243
P0DTD1	VMYASAVVL is a linear peptidic epitope (epitope ID 2134331) tested in 2 T cell assays and 1 MHC ligand assay.	IEDB	2134331	3683	3691	VMYASAVVL	ECO:0000213	PubMed	34793243
P0DTD1	VQMAPISAM is a linear peptidic epitope (epitope ID 2134337) tested in 2 T cell assays.	IEDB	2134337	2372	2380	VQMAPISAM	ECO:0000213	PubMed	34793243
P0DTD1	VQMAPISAM is a linear peptidic epitope (epitope ID 2134337) tested in 2 T cell assays.	IEDB	2134337	2372	2380	VQMAPISAM	ECO:0000213	PubMed	38045681
P0DTD1	WLTNIFGTV is a linear peptidic epitope (epitope ID 2134343) tested in 1 T cell assay.	IEDB	2134343	612	620	WLTNIFGTV	ECO:0000213	PubMed	34793243
P0DTD1	YLAVFDKNL is a linear peptidic epitope (epitope ID 2134357) tested in 2 T cell assays.	IEDB	2134357	1174	1182	YLAVFDKNL	ECO:0000213	PubMed	34793243
P0DTD1	YLGGMSYYC is a linear peptidic epitope (epitope ID 2134359) tested in 3 T cell assays.	IEDB	2134359	5388	5396	YLGGMSYYC	ECO:0000213	PubMed	34793243
P0DTD1	YMHHMELPT is a linear peptidic epitope (epitope ID 2134362) tested in 1 T cell assay.	IEDB	2134362	3424	3432	YMHHMELPT	ECO:0000213	PubMed	34793243
P0DTD1	YMRSLKVPA is a linear peptidic epitope (epitope ID 2134364) tested in 1 T cell assay.	IEDB	2134364	1465	1473	YMRSLKVPA	ECO:0000213	PubMed	34793243
P0DTD1	YPLECIKDL is a linear peptidic epitope (epitope ID 2134365) tested in 1 T cell assay.	IEDB	2134365	196	204	YPLECIKDL	ECO:0000213	PubMed	34793243
P0DTD1	YQVNGYPNM is a linear peptidic epitope (epitope ID 2134367) tested in 1 T cell assay.	IEDB	2134367	5989	5997	YQVNGYPNM	ECO:0000213	PubMed	34793243
P0DTD1	YTACSHAAV is a linear peptidic epitope (epitope ID 2134369) tested in 3 T cell assays.	IEDB	2134369	5630	5638	YTACSHAAV	ECO:0000213	PubMed	34793243
P0DTD1	YTDFATSAC is a linear peptidic epitope (epitope ID 2134370) tested in 1 T cell assay.	IEDB	2134370	2905	2913	YTDFATSAC	ECO:0000213	PubMed	34793243
P0DTD1	YTNDKACPL is a linear peptidic epitope (epitope ID 2134374) tested in 1 T cell assay.	IEDB	2134374	2845	2853	YTNDKACPL	ECO:0000213	PubMed	34793243
P0DTD1	YTVELGTEV is a linear peptidic epitope (epitope ID 2134376) tested in 2 T cell assays.	IEDB	2134376	860	868	YTVELGTEV	ECO:0000213	PubMed	34793243
P0DTD1	YTVELGTEV is a linear peptidic epitope (epitope ID 2134376) tested in 2 T cell assays.	IEDB	2134376	860	868	YTVELGTEV	ECO:0000213	PubMed	37193826
P0DTD1	YVDNSSLTI is a linear peptidic epitope (epitope ID 2134379) tested in 4 T cell assays.	IEDB	2134379	2099	2107	YVDNSSLTI	ECO:0000213	PubMed	34793243
P0DTD1	YVDNSSLTI is a linear peptidic epitope (epitope ID 2134379) tested in 4 T cell assays.	IEDB	2134379	2099	2107	YVDNSSLTI	ECO:0000213	PubMed	37193826
P0DTD1	LLMPILTL is a linear peptidic epitope (epitope ID 2157376) tested in 6 T cell assays.	IEDB	2157376	4632	4639	LLMPILTL	ECO:0000213	PubMed	34919800
P0DTD1	FCLEASFNYL is a linear peptidic epitope (epitope ID 2223994) tested in 1 T cell assay.	IEDB	2223994	2209	2218	FCLEASFNYL	ECO:0000213	PubMed	37193826
P0DTD1	FGLVAEWFLA is a linear peptidic epitope (epitope ID 2223995) tested in 1 T cell assay.	IEDB	2223995	2321	2330	FGLVAEWFLA	ECO:0000213	PubMed	37193826
P0DTD1	FLTENLLLYID is a linear peptidic epitope (epitope ID 2223996) tested in 1 T cell assay.	IEDB	2223996	1248	1258	FLTENLLLYID	ECO:0000213	PubMed	37193826
P0DTD1	GLVAEWFLA is a linear peptidic epitope (epitope ID 2224011) tested in 1 T cell assay.	IEDB	2224011	2322	2330	GLVAEWFLA	ECO:0000213	PubMed	37193826
P0DTD1	LLDQALVSDV is a linear peptidic epitope (epitope ID 2224029) tested in 1 T cell assay.	IEDB	2224029	2571	2580	LLDQALVSDV	ECO:0000213	PubMed	37193826
P0DTD1	MQLFFSYFA is a linear peptidic epitope (epitope ID 2224038) tested in 5 T cell assays.	IEDB	2224038	2347	2355	MQLFFSYFA	ECO:0000213	PubMed	37193826
P0DTD1	MQLFFSYFAV is a linear peptidic epitope (epitope ID 2224039) tested in 1 T cell assay.	IEDB	2224039	2347	2356	MQLFFSYFAV	ECO:0000213	PubMed	37193826
P0DTD1	TLATHGLAAV is a linear peptidic epitope (epitope ID 2224075) tested in 5 T cell assays.	IEDB	2224075	2121	2130	TLATHGLAAV	ECO:0000213	PubMed	37193826
P0DTD1	TLVTMPLGYV is a linear peptidic epitope (epitope ID 2224076) tested in 1 T cell assay.	IEDB	2224076	1444	1453	TLVTMPLGYV	ECO:0000213	PubMed	37193826
P0DTD1	YILFTRFFYV is a linear peptidic epitope (epitope ID 2224090) tested in 1 T cell assay.	IEDB	2224090	2331	2340	YILFTRFFYV	ECO:0000213	PubMed	37193826
P0DTD1	YLVQQESPFV is a linear peptidic epitope (epitope ID 2224093) tested in 1 T cell assay.	IEDB	2224093	1796	1805	YLVQQESPFV	ECO:0000213	PubMed	37193826
P0DTD1	YVNTFSSTFNV is a linear peptidic epitope (epitope ID 2224098) tested in 1 T cell assay.	IEDB	2224098	2594	2604	YVNTFSSTFNV	ECO:0000213	PubMed	37193826
P0DTD1	YVWKSYVHVV is a linear peptidic epitope (epitope ID 2224099) tested in 1 T cell assay.	IEDB	2224099	2392	2401	YVWKSYVHVV	ECO:0000213	PubMed	37193826
P0DTD1	SLPINVIVF is a linear peptidic epitope (epitope ID 2231941) tested in 11 T cell assays and 1 MHC ligand assay.	IEDB	2231941	2535	2543	SLPINVIVF	ECO:0000213	PubMed	37390223
P0DTD1	EAIRHVRAWI is a linear peptidic epitope (epitope ID 2243430) tested in 3 B cell assays.	IEDB	2243430	6003	6012	EAIRHVRAWI	ECO:0000213	PubMed	37766081
P0DTD1	LPTGTLLVDSD is a linear peptidic epitope (epitope ID 2243473) tested in 3 B cell assays.	IEDB	2243473	6887	6897	LPTGTLLVDSD	ECO:0000213	PubMed	37766081
P0DTD1	VSTGYHFRELG is a linear peptidic epitope (epitope ID 2243519) tested in 3 B cell assays.	IEDB	2243519	4734	4744	VSTGYHFRELG	ECO:0000213	PubMed	37766081
P0DTD1	VYEKLKPVLD is a linear peptidic epitope (epitope ID 2243520) tested in 3 B cell assays.	IEDB	2243520	620	629	VYEKLKPVLD	ECO:0000213	PubMed	37766081
P0DTD1	YVIFTQTTET is a linear peptidic epitope (epitope ID 2243523) tested in 3 B cell assays.	IEDB	2243523	5867	5876	YVIFTQTTET	ECO:0000213	PubMed	37766081
P0DTD1	AIMQLFFSYF is a linear peptidic epitope (epitope ID 2249072) tested in 1 T cell assay.	IEDB	2249072	2345	2354	AIMQLFFSYF	ECO:0000213	PubMed	38045681
P0DTD1	ALYNKYKYF is a linear peptidic epitope (epitope ID 2249074) tested in 1 T cell assay.	IEDB	2249074	3209	3217	ALYNKYKYF	ECO:0000213	PubMed	38045681
P0DTD1	AMSAFAMMF is a linear peptidic epitope (epitope ID 2249075) tested in 1 T cell assay.	IEDB	2249075	3620	3628	AMSAFAMMF	ECO:0000213	PubMed	38045681
P0DTD1	APISAMVRMY is a linear peptidic epitope (epitope ID 2249076) tested in 1 T cell assay.	IEDB	2249076	2375	2384	APISAMVRMY	ECO:0000213	PubMed	38045681
P0DTD1	FHLDGEVITF is a linear peptidic epitope (epitope ID 2249082) tested in 1 T cell assay.	IEDB	2249082	1544	1553	FHLDGEVITF	ECO:0000213	PubMed	38045681
P0DTD1	GLAAIMQLFF is a linear peptidic epitope (epitope ID 2249085) tested in 1 T cell assay.	IEDB	2249085	2342	2351	GLAAIMQLFF	ECO:0000213	PubMed	38045681
P0DTD1	HFYWFFSNY is a linear peptidic epitope (epitope ID 2249087) tested in 1 T cell assay.	IEDB	2249087	3152	3160	HFYWFFSNY	ECO:0000213	PubMed	38045681
P0DTD1	IAMSAFAMM is a linear peptidic epitope (epitope ID 2249089) tested in 1 T cell assay.	IEDB	2249089	3619	3627	IAMSAFAMM	ECO:0000213	PubMed	38045681
P0DTD1	KFYGGWHNM is a linear peptidic epitope (epitope ID 2249093) tested in 1 T cell assay.	IEDB	2249093	4985	4993	KFYGGWHNM	ECO:0000213	PubMed	38045681
P0DTD1	KHFYWFFSNY is a linear peptidic epitope (epitope ID 2249094) tested in 1 T cell assay.	IEDB	2249094	3151	3160	KHFYWFFSNY	ECO:0000213	PubMed	38045681
P0DTD1	LFFSYFAVHF is a linear peptidic epitope (epitope ID 2249095) tested in 1 T cell assay.	IEDB	2249095	2349	2358	LFFSYFAVHF	ECO:0000213	PubMed	38045681
P0DTD1	MGIIAMSAF is a linear peptidic epitope (epitope ID 2249097) tested in 1 T cell assay.	IEDB	2249097	3616	3624	MGIIAMSAF	ECO:0000213	PubMed	38045681
P0DTD1	MMFVKHKHA is a linear peptidic epitope (epitope ID 2249098) tested in 1 T cell assay.	IEDB	2249098	3626	3634	MMFVKHKHA	ECO:0000213	PubMed	38045681
P0DTD1	MSYEDQDALF is a linear peptidic epitope (epitope ID 2249099) tested in 1 T cell assay.	IEDB	2249099	4911	4920	MSYEDQDALF	ECO:0000213	PubMed	38045681
P0DTD1	RARTVAGVSI is a linear peptidic epitope (epitope ID 2249101) tested in 1 T cell assay.	IEDB	2249101	4945	4954	RARTVAGVSI	ECO:0000213	PubMed	38045681
P0DTD1	REVRTIKVF is a linear peptidic epitope (epitope ID 2249102) tested in 1 T cell assay.	IEDB	2249102	1563	1571	REVRTIKVF	ECO:0000213	PubMed	38045681
P0DTD1	RTIKGTHHW is a linear peptidic epitope (epitope ID 2249103) tested in 1 T cell assay.	IEDB	2249103	3574	3582	RTIKGTHHW	ECO:0000213	PubMed	38045681
P0DTD1	VVRQCSGVTF is a linear peptidic epitope (epitope ID 2249109) tested in 1 T cell assay.	IEDB	2249109	3559	3568	VVRQCSGVTF	ECO:0000213	PubMed	38045681
P0DTD1	WLIINLVQM is a linear peptidic epitope (epitope ID 2249111) tested in 1 T cell assay.	IEDB	2249111	2366	2374	WLIINLVQM	ECO:0000213	PubMed	38045681
P0DTD1	YMPASWVMRI is a linear peptidic epitope (epitope ID 2249114) tested in 1 T cell assay.	IEDB	2249114	3654	3663	YMPASWVMRI	ECO:0000213	PubMed	38045681
P0DTD1	EKMVSLLSVLLSM is a linear peptidic epitope (epitope ID 2249816) tested in 1 T cell assay and 7 MHC ligand assays.	IEDB	2249816	3909	3921	EKMVSLLSVLLSM	ECO:0000213	PubMed	38124752
P0DTD1	GSIIQFPNTYLEGS is a linear peptidic epitope (epitope ID 2250272) tested in 1 MHC ligand assay.	IEDB	2250272	2959	2972	GSIIQFPNTYLEGS	ECO:0000213	PubMed	38117652
P0DTD1	EAMYTPHTV is a linear peptidic epitope (epitope ID 2259130) tested in 1 T cell assay.	IEDB	2259130	5314	5322	EAMYTPHTV	ECO:0000213	PubMed	38781962
P0DTD1	FTEERLKLF is a linear peptidic epitope (epitope ID 2259165) tested in 1 T cell assay.	IEDB	2259165	4667	4675	FTEERLKLF	ECO:0000213	PubMed	38781962
P0DTD1	GIMMNVAKY is a linear peptidic epitope (epitope ID 2259173) tested in 1 T cell assay.	IEDB	2259173	6837	6845	GIMMNVAKY	ECO:0000213	PubMed	38781962
P0DTD1	HPNQEYADV is a linear peptidic epitope (epitope ID 2259179) tested in 1 T cell assay.	IEDB	2259179	5264	5272	HPNQEYADV	ECO:0000213	PubMed	38781962
P0DTD1	MIERFVSLAI is a linear peptidic epitope (epitope ID 2259211) tested in 1 T cell assay.	IEDB	2259211	5247	5256	MIERFVSLAI	ECO:0000213	PubMed	38781962
P0DTD1	NDSKEGFFTY is a linear peptidic epitope (epitope ID 2259213) tested in 1 T cell assay.	IEDB	2259213	6941	6950	NDSKEGFFTY	ECO:0000213	PubMed	38781962
P0DTD1	STDVVYRAF is a linear peptidic epitope (epitope ID 2259240) tested in 1 T cell assay.	IEDB	2259240	4419	4427	STDVVYRAF	ECO:0000213	PubMed	38781962
P0DTD1	VPFVVSTGY is a linear peptidic epitope (epitope ID 2259249) tested in 1 T cell assay.	IEDB	2259249	4730	4738	VPFVVSTGY	ECO:0000213	PubMed	38781962
P0DTD1	YAADPAMHA is a linear peptidic epitope (epitope ID 2259255) tested in 1 T cell assay.	IEDB	2259255	4766	4774	YAADPAMHA	ECO:0000213	PubMed	38781962
P0DTD1	YEAMYTPHTV is a linear peptidic epitope (epitope ID 2259258) tested in 1 T cell assay.	IEDB	2259258	5313	5322	YEAMYTPHTV	ECO:0000213	PubMed	38781962
P0DTD1	YQHEETIYNL is a linear peptidic epitope (epitope ID 2259260) tested in 1 T cell assay.	IEDB	2259260	4472	4481	YQHEETIYNL	ECO:0000213	PubMed	38781962
P0DTD1	SLFDMSKFPL is a linear peptidic epitope (epitope ID 2268576) tested in 1 T cell assay.	IEDB	2268576	7041	7050	SLFDMSKFPL	ECO:0000213	PubMed	39456150
P0DTD1	STGYHFREL is a linear peptidic epitope (epitope ID 2269842) tested in 6 T cell assays.	IEDB	2269842	4735	4743	STGYHFREL	ECO:0000213	PubMed	39589869
P0DTD1	TGYHFREL is a linear peptidic epitope (epitope ID 2269852) tested in 3 T cell assays.	IEDB	2269852	4736	4743	TGYHFREL	ECO:0000213	PubMed	39589869
P0DTD2	DEFVVVTV is a linear peptidic epitope (epitope ID 1331197) tested in 4 T cell assays and 10 MHC ligand assays.	IEDB	1331197	89	96	DEFVVVTV	ECO:0000213	PubMed	34171305
P0DTD2	ELPDEFVVV is a linear peptidic epitope (epitope ID 1331654) tested in 5 T cell assays and 10 MHC ligand assays.	IEDB	1331654	86	94	ELPDEFVVV	ECO:0000213	PubMed	34171305
P0DTD2	ELPDEFVVVTV is a linear peptidic epitope (epitope ID 1331655) tested in 5 T cell assays and 10 MHC ligand assays.	IEDB	1331655	86	96	ELPDEFVVVTV	ECO:0000213	PubMed	34171305
P0DTD2	KAFQLTPIAV is a linear peptidic epitope (epitope ID 1332442) tested in 5 T cell assays and 10 MHC ligand assays.	IEDB	1332442	67	76	KAFQLTPIAV	ECO:0000213	PubMed	34171305
P0DTD2	LEDKAFQL is a linear peptidic epitope (epitope ID 1332593) tested in 4 T cell assays and 10 MHC ligand assays.	IEDB	1332593	64	71	LEDKAFQL	ECO:0000213	PubMed	34171305
P0DTD2	SLEDKAFQL is a linear peptidic epitope (epitope ID 1333588) tested in 5 T cell assays and 11 MHC ligand assays.	IEDB	1333588	63	71	SLEDKAFQL	ECO:0000213	PubMed	34166618
P0DTD2	SLEDKAFQL is a linear peptidic epitope (epitope ID 1333588) tested in 5 T cell assays and 11 MHC ligand assays.	IEDB	1333588	63	71	SLEDKAFQL	ECO:0000213	PubMed	34171305
P0DTD2	KISEMHPAL is a linear peptidic epitope (epitope ID 2134136) tested in 1 T cell assay.	IEDB	2134136	4	12	KISEMHPAL	ECO:0000213	PubMed	34793243
P0DTD2	KVYPIILRL is a linear peptidic epitope (epitope ID 2134152) tested in 2 T cell assays.	IEDB	2134152	40	48	KVYPIILRL	ECO:0000213	PubMed	34793243
P0DTD2	RLVDPQIQL is a linear peptidic epitope (epitope ID 2134255) tested in 1 T cell assay.	IEDB	2134255	13	21	RLVDPQIQL	ECO:0000213	PubMed	34793243
P0DTD2	TTEELPDEF is a linear peptidic epitope (epitope ID 2134313) tested in 1 T cell assay.	IEDB	2134313	83	91	TTEELPDEF	ECO:0000213	PubMed	34793243
P0DTD2	KLATTEELPDE is a linear peptidic epitope (epitope ID 2250714) tested in 1 T cell assay.	IEDB	2250714	80	90	KLATTEELPDE	ECO:0000213	PubMed	38105139
P0DTD2	LVDPQIQL is a linear peptidic epitope (epitope ID 2251137) tested in 1 T cell assay.	IEDB	2251137	14	21	LVDPQIQL	ECO:0000213	PubMed	38105139
P0DTD2	PKISEMHPALRLVD is a linear peptidic epitope (epitope ID 2251497) tested in 1 T cell assay.	IEDB	2251497	3	16	PKISEMHPALRLVD	ECO:0000213	PubMed	38105139
P0DTD2	TEELPDEF is a linear peptidic epitope (epitope ID 2252212) tested in 1 T cell assay.	IEDB	2252212	84	91	TEELPDEF	ECO:0000213	PubMed	38105139
P0DTD3	AMAVMLLLL is a linear peptidic epitope (epitope ID 2134000) tested in 1 T cell assay.	IEDB	2134000	59	67	AMAVMLLLL	ECO:0000213	PubMed	34793243
P0DTD3	LLEWLAMAV is a linear peptidic epitope (epitope ID 2134161) tested in 1 T cell assay.	IEDB	2134161	54	62	LLEWLAMAV	ECO:0000213	PubMed	34793243
P0DTD3	LLLEWLAMA is a linear peptidic epitope (epitope ID 2134162) tested in 2 T cell assays.	IEDB	2134162	53	61	LLLEWLAMA	ECO:0000213	PubMed	34793243
P0DTD3	VPHHVVATV is a linear peptidic epitope (epitope ID 2134333) tested in 1 T cell assay.	IEDB	2134333	32	40	VPHHVVATV	ECO:0000213	PubMed	34793243
P0DTD8	AFLLFLVLI is a linear peptidic epitope (epitope ID 1349) tested in 1 T cell assay and 6 MHC ligand assays.	IEDB	1349	15	23	AFLLFLVLI	ECO:0000213	PubMed	34793243
P0DTD8	LIDFYLCFL is a linear peptidic epitope (epitope ID 36477) tested in 2 T cell assays and 10 MHC ligand assays.	IEDB	36477	6	14	LIDFYLCFL	ECO:0000213	PubMed	34793243
P0DTD8	LLFLVLIML is a linear peptidic epitope (epitope ID 37279) tested in 2 T cell assays and 10 MHC ligand assays.	IEDB	37279	17	25	LLFLVLIML	ECO:0000213	PubMed	34793243
P0DTD8	DFYLCFLAFLLFLVL is a linear peptidic epitope (epitope ID 1331247) tested in 10 T cell assays and 3 MHC ligand assays.	IEDB	1331247	8	22	DFYLCFLAFLLFLVL	ECO:0000213	PubMed	38605956
P0DTD8	IIFWFSLEL is a linear peptidic epitope (epitope ID 1332358) tested in 7 T cell assays and 2 MHC ligand assays.	IEDB	1332358	26	34	IIFWFSLEL	ECO:0000213	PubMed	34793243
P0DTD8	IIFWFSLEL is a linear peptidic epitope (epitope ID 1332358) tested in 7 T cell assays and 2 MHC ligand assays.	IEDB	1332358	26	34	IIFWFSLEL	ECO:0000213	PubMed	38605956
P0DTD8	ELSLIDFYL is a linear peptidic epitope (epitope ID 2134039) tested in 1 T cell assay.	IEDB	2134039	3	11	ELSLIDFYL	ECO:0000213	PubMed	34793243
P0DTG1	ALHFLLFFRALPKS is a linear peptidic epitope (epitope ID 2249321) tested in 1 MHC ligand assay.	IEDB	2249321	28	41	ALHFLLFFRALPKS	ECO:0000213	PubMed	38117652
