ID IFNL4_HUMAN Reviewed; 179 AA. AC K9M1U5; K9M1A5; K9M269; K9M2P7; DT 01-MAY-2013, integrated into UniProtKB/Swiss-Prot. DT 06-MAR-2013, sequence version 1. DT 16-JAN-2019, entry version 26. DE RecName: Full=Interferon lambda-4; DE Short=IFN-lambda-4; DE Flags: Precursor; GN Name=IFNL4; OS Homo sapiens (Human). OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; OC Catarrhini; Hominidae; Homo. OX NCBI_TaxID=9606; RN [1] RP NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), FUNCTION, RP POLYMORPHISM, INDUCTION, AND SUBCELLULAR LOCATION. RX PubMed=23291588; DOI=10.1038/ng.2521; RA Prokunina-Olsson L., Muchmore B., Tang W., Pfeiffer R.M., Park H., RA Dickensheets H., Hergott D., Porter-Gill P., Mumy A., Kohaar I., RA Chen S., Brand N., Tarway M., Liu L., Sheikh F., Astemborski J., RA Bonkovsky H.L., Edlin B.R., Howell C.D., Morgan T.R., Thomas D.L., RA Rehermann B., Donnelly R.P., O'Brien T.R.; RT "A variant upstream of IFNL3 (IL28B) creating a new interferon gene RT IFNL4 is associated with impaired clearance of hepatitis C virus."; RL Nat. Genet. 45:164-171(2013). RN [2] RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RX PubMed=15057824; DOI=10.1038/nature02399; RA Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., RA Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., RA Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., RA Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M., RA Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., RA Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., RA Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., RA Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., RA Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., RA Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., RA Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., RA Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., RA Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., RA Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., RA Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., RA Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., RA Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., RA Rubin E.M., Lucas S.M.; RT "The DNA sequence and biology of human chromosome 19."; RL Nature 428:529-535(2004). CC -!- FUNCTION: Cytokine that may trigger an antiviral response CC activating the JAK-STAT pathway and up-regulating specifically CC some interferon-stimulated genes. {ECO:0000269|PubMed:23291588}. CC -!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:23291588}. CC Secreted {ECO:0000269|PubMed:23291588}. CC -!- ALTERNATIVE PRODUCTS: CC Event=Alternative splicing; Named isoforms=4; CC Comment=Additional isoforms seem to exist. However, they may be CC produced at very low levels due to a premature stop codon in the CC mRNA, leading to nonsense-mediated mRNA decay.; CC Name=1; Synonyms=IFNL4, p179; CC IsoId=K9M1U5-1; Sequence=Displayed; CC Note=Active form which is able to induce an antiviral response CC and prevent hepatitis C virus (HCV) replication in cell CC cultures.; CC Name=2; Synonyms=p170; CC IsoId=K9M1U5-2; Sequence=VSP_046394; CC Note=Inactive form.; CC Name=3; Synonyms=p131; CC IsoId=K9M1U5-3; Sequence=VSP_046393; CC Note=Inactive form unable to elicit an antiviral response.; CC Name=4; Synonyms=p107; CC IsoId=K9M1U5-4; Sequence=VSP_046392; CC Note=Inactive form unable to elicit an antiviral response.; CC -!- INDUCTION: Up-regulated by polyinosinic:polycytidylic acid CC (polyI:C) which mimics the double-stranded hepatitis C virus. CC {ECO:0000269|PubMed:23291588}. CC -!- POLYMORPHISM: Genetic variation in IFNL4 is associated with CC susceptibility to hepatitis C virus (HCV) infection [MIM:609532]. CC A one-base insertion, introducing a frameshift at position 22, CC results in inactivation of the gene in a majority of the CC population. That polymorphism is a good marker for predicting CC spontaneous HCV clearance and the response to treatment of chronic CC hepatitis C. Noteworthily, the allele producing a functional CC protein able to induce an antiviral response and to prevent HCV CC replication in cell cultures, is less frequent in human CC populations and is associated with impaired spontaneous clearance CC of HCV. CC -!- SIMILARITY: Belongs to the lambda interferon family. CC {ECO:0000305}. CC -!- CAUTION: The reference genome assembly, GRCh37, describes the non- CC functional copy of that gene, frameshifted at position 22, that is CC more frequent in human populations. {ECO:0000305}. CC ----------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC ----------------------------------------------------------------------- DR EMBL; JN806225; AFQ38550.1; -; mRNA. DR EMBL; JN806226; AFQ38551.1; -; mRNA. DR EMBL; JN806233; AFQ38558.1; -; mRNA. DR EMBL; JN806234; AFQ38559.1; -; mRNA. DR EMBL; AC011445; -; NOT_ANNOTATED_CDS; Genomic_DNA. DR RefSeq; NP_001263183.2; NM_001276254.2. [K9M1U5-1] DR UniGene; Hs.745579; -. DR ProteinModelPortal; K9M1U5; -. DR BioMuta; IFNL4; -. DR jPOST; K9M1U5; -. DR PRIDE; K9M1U5; -. DR GeneID; 101180976; -. DR KEGG; hsa:101180976; -. DR CTD; 101180976; -. DR DisGeNET; 101180976; -. DR GeneCards; IFNL4; -. DR HGNC; HGNC:44480; IFNL4. DR MalaCards; IFNL4; -. DR MIM; 615090; gene. DR neXtProt; NX_K9M1U5; -. DR Orphanet; 284102; Response to antiviral treatment in hepatitis C. DR InParanoid; K9M1U5; -. DR PRO; PR:K9M1U5; -. DR Proteomes; UP000005640; Unplaced. DR GO; GO:0005737; C:cytoplasm; IDA:UniProtKB. DR GO; GO:0005615; C:extracellular space; IDA:UniProtKB. DR GO; GO:0005125; F:cytokine activity; IMP:UniProtKB. DR GO; GO:0005102; F:signaling receptor binding; IBA:GO_Central. DR GO; GO:0051607; P:defense response to virus; IMP:UniProtKB. DR GO; GO:0045087; P:innate immune response; IBA:GO_Central. DR GO; GO:0050778; P:positive regulation of immune response; IEA:InterPro. DR GO; GO:0007260; P:tyrosine phosphorylation of STAT protein; IDA:UniProtKB. DR Gene3D; 1.20.1250.60; -; 1. DR InterPro; IPR038326; IFN-lambda_sf. DR InterPro; IPR029177; INF_lambda. DR PANTHER; PTHR31943; PTHR31943; 1. DR Pfam; PF15177; IL28A; 1. PE 2: Evidence at transcript level; KW Alternative splicing; Antiviral defense; Complete proteome; Cytokine; KW Cytoplasm; Reference proteome; Secreted; Signal. FT SIGNAL 1 21 {ECO:0000255}. FT CHAIN 22 179 Interferon lambda-4. FT /FTId=PRO_0000422094. FT VAR_SEQ 51 122 Missing (in isoform 4). FT {ECO:0000303|PubMed:23291588}. FT /FTId=VSP_046392. FT VAR_SEQ 75 122 Missing (in isoform 3). FT {ECO:0000303|PubMed:23291588}. FT /FTId=VSP_046393. FT VAR_SEQ 123 179 LELARPGSSRKVPGAQKRRHKPRRADSPRCRKASVVFNLLR FT LLTWELRLAAHSGPCL -> VSDGRAPPPLSPASFSASSGP FT RRAPALCQSVLLSGKTHPDRSRVLWVS (in isoform FT 2). {ECO:0000303|PubMed:23291588}. FT /FTId=VSP_046394. FT CONFLICT 161 161 L -> P (in Ref. 1; AFQ38550). FT {ECO:0000305}. SQ SEQUENCE 179 AA; 19675 MW; 2010E94B6224D0F7 CRC64; MRPSVWAAVA AGLWVLCTVI AAAPRRCLLS HYRSLEPRTL AAAKALRDRY EEEALSWGQR NCSFRPRRDP PRPSSCARLR HVARGIADAQ AVLSGLHRSE LLPGAGPILE LLAAAGRDVA ACLELARPGS SRKVPGAQKR RHKPRRADSP RCRKASVVFN LLRLLTWELR LAAHSGPCL //