{ "uniprot_canonical_ac": "A0A0R4IJS9-1", "uniprot_ac": "A0A0R4IJS9", "uniprot_id": "A0A0R4IJS9_DANRE", "mass": { "chemical_mass": 34725.0, "monoisotopic_mass": 34725.0 }, "refseq": { "ac": "NP_001230273", "name": "forkhead box protein Q1a", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230273" }, "gene_names": [ { "name": "foxq1a", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9", "id": "A0A0R4IJS9" }, { "name": "foxq1a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230273", "id": "NP_001230273" }, { "name": "foxq1l; zgc:162905", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230273", "id": "NP_001230273" }, { "name": "foxq1l", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9", "id": "A0A0R4IJS9" }, { "name": "zgc:162905", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9", "id": "A0A0R4IJS9" } ], "protein_names": [ { "name": "Forkhead box Q1a", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IJS9/entry#names_and_taxonomy", "id": "A0A0R4IJS9" }, { "name": "Forkhead box protein Q1a", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IJS9/entry#names_and_taxonomy", "id": "A0A0R4IJS9" }, { "name": "forkhead box protein Q1a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230273", "id": "NP_001230273" } ], "function": [ { "annotation": "This study provides the first genetic mutant analyses of zebrafish foxq1a and foxq1b. Foxq1a, but not foxq1b, was transcriptionally regulated during a bacterial response, while the expression of foxq1a was detected in sorted macrophages and upregulated in foxq1a-deficient mutants. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001230273", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230273" }, { "database": "PubMed", "id": "29534099", "url": "https://glygen.org/publication/PubMed/29534099" } ] }, { "annotation": "VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CU856140.13, EH435319.1 and EH461319.1. On Aug 12, 2011 this sequence version replaced XP_003197856.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.", "evidence": [ { "database": "RefSeq", "id": "NP_001230273", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230273" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "foxq1a", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-070424-74", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-070424-74", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000030896", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000030896", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd20034", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20034", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "100537750", "url": "https://www.ncbi.nlm.nih.gov/gene/100537750", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001766", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001766", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018122", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018122", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030456", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030456", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036388", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036388", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036390", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036390", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047518", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047518", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050211", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050211", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:100537750", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:100537750", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FPAVSWP", "url": "https://omabrowser.org/oma/group/FPAVSWP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4IJS9", "url": "https://www.orthodb.org/?gene=A0A0R4IJS9", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11829", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11829", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11829:SF385", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11829:SF385", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00250", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00250", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001230273", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230273", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4IJS9-1", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-070424-74", "url": "https://zfin.org/ZDB-GENE-070424-74", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MSMHSSSATGSYTALSLFELSEALPMKLEVFCGSHYDSKPAELCSDAEGSIPSPVSAEEELGSDGDCVAHSPAPVADTKGKPYTRRPKPPYSYIALIAMAIRDSNSGRLTLAEINDYLMKKFPFFRGSYTGWRNSVRHNLSLNDCFLKVLRDPSRPWGKDNYWMLNPHSEYTFADGVFRRRRKRISKKTGREPEGPVQTHALDSNDSIATPPSSGKFTSSFAIESILSRPFRREDRPVLSPDTWPGGVDTVLPYVMLRSYGALEDPSMSRRQRDFFAFQLPPECLSIPHTSAAVPAPATAGYHPFKIDYLLS", "length": 312, "header": "tr|A0A0R4IJS9-1|A0A0R4IJS9_DANRE Isoform 1 of Forkhead box Q1a OS=Danio rerio OX=7955 GN=foxq1a PE=4 SV=1 CANONICAL=A0A0R4IJS9-1" }, "isoforms": [ { "isoform_ac": "A0A0R4IJS9-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IJS9/entry#A0A0R4IJS9-1", "sequence": { "sequence": "MSMHSSSATGSYTALSLFELSEALPMKLEVFCGSHYDSKPAELCSDAEGSIPSPVSAEEELGSDGDCVAHSPAPVADTKGKPYTRRPKPPYSYIALIAMAIRDSNSGRLTLAEINDYLMKKFPFFRGSYTGWRNSVRHNLSLNDCFLKVLRDPSRPWGKDNYWMLNPHSEYTFADGVFRRRRKRISKKTGREPEGPVQTHALDSNDSIATPPSSGKFTSSFAIESILSRPFRREDRPVLSPDTWPGGVDTVLPYVMLRSYGALEDPSMSRRQRDFFAFQLPPECLSIPHTSAAVPAPATAGYHPFKIDYLLS", "length": 312, "header": "tr|A0A0R4IJS9-1|A0A0R4IJS9_DANRE Isoform 1 of Forkhead box Q1a OS=Danio rerio OX=7955 GN=foxq1a PE=4 SV=1 CANONICAL=A0A0R4IJS9-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "2,3,7,8-Tetrachlorodibenzo-p-dioxin upregulates FoxQ1b in zebrafish jaw primordium.", "journal": "Chem. Res. Toxicol.", "date": "2010", "authors": "Planchart Antonio, Mattingly Carolyn J", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "reference": [ { "type": "PubMed", "id": "20055451", "url": "https://glygen.org/publication/PubMed/20055451" } ] }, { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "RFX transcription factors are essential for hearing in mice.", "journal": "Nat. Commun.", "date": "2015", "authors": "Elkon Ran, Milon Beatrice, Morrison Laura, Shah Manan, Vijayakumar Sarath, Racherla Manoj, Leitch Carmen C, Silipino Lorna, Hadi Shadan, Weiss-Gayet Mich\u00e8le, Barras Emmanu\u00e8le, Schmid Christoph D, Ait-Lounis Aouatef, Barnes Ashley, Song Yang, Eisenman David J, Eliyahu Efrat, Frolenkov Gregory I, Strome Scott E, Durand B\u00e9n\u00e9dicte, Zaghloul Norann A, Jones Sherri M, Reith Walter, Hertzano Ronna", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "reference": [ { "type": "PubMed", "id": "26469318", "url": "https://glygen.org/publication/PubMed/26469318" } ] }, { "title": "The Morphogenesis of Cranial Sutures in Zebrafish.", "journal": "PLoS ONE", "date": "2016", "authors": "Topczewska Jolanta M, Shoela Ramy A, Tomaszewski Joanna P, Mirmira Rupa B, Gosain Arun K", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "reference": [ { "type": "PubMed", "id": "27829009", "url": "https://glygen.org/publication/PubMed/27829009" } ] }, { "title": "Genetic analysis of zebrafish homologs of human FOXQ1, foxq1a and foxq1b, in innate immune cell development and bacterial host response.", "journal": "PLoS ONE", "date": "2018", "authors": "Earley Alison M, Dixon Cameron T, Shiau Celia E", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" }, { "database": "RefSeq", "id": "NP_001230273", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230273" } ], "reference": [ { "type": "PubMed", "id": "29534099", "url": "https://glygen.org/publication/PubMed/29534099" } ] }, { "title": "A new member of the forkhead box protein family in zebrafish: Domain composition, phylogenetic implication and embryonic expression pattern.", "journal": "Gene Expr. Patterns", "date": "2020", "authors": "Zeng Chih-Wei, Sheu Jin-Chuan, Tsai Huai-Jen", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "reference": [ { "type": "PubMed", "id": "31917260", "url": "https://glygen.org/publication/PubMed/31917260" } ] }, { "title": "The Axenfeld-Rieger Syndrome Gene FOXC1 Contributes to Left-Right Patterning.", "journal": "Genes (Basel)", "date": "2021", "authors": "Chrystal Paul W, French Curtis R, Jean Francesca, Havrylov Serhiy, van Baarle Suey, Peturson Ann-Marie, Xu Pengfei, Crump J Gage, Pilgrim David B, Lehmann Ordan J, Waskiewicz Andrew J", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "reference": [ { "type": "PubMed", "id": "33530637", "url": "https://glygen.org/publication/PubMed/33530637" } ] }, { "title": "Characterization of Biological Pathways Regulating Acute Cold Resistance of Zebrafish.", "journal": "Int. J. Mol. Sci.", "date": "2021", "authors": "Ren Jing, Long Yong, Liu Ran, Song Guili, Li Qing, Cui Zongbin", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "reference": [ { "type": "PubMed", "id": "33809683", "url": "https://glygen.org/publication/PubMed/33809683" } ] }, { "title": "Mapping single-cell atlases throughout Metazoa unravels cell type evolution.", "journal": "Elife", "date": "2021", "authors": "Tarashansky Alexander J, Musser Jacob M, Khariton Margarita, Li Pengyang, Arendt Detlev, Quake Stephen R, Wang Bo", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "reference": [ { "type": "PubMed", "id": "33944782", "url": "https://glygen.org/publication/PubMed/33944782" } ] }, { "title": "Foxq2 determines blue cone identity in zebrafish.", "journal": "Sci. Adv.", "date": "2021", "authors": "Ogawa Yohey, Shiraki Tomoya, Fukada Yoshitaka, Kojima Daisuke", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "reference": [ { "type": "PubMed", "id": "34613771", "url": "https://glygen.org/publication/PubMed/34613771" } ] }, { "title": "CRISPR-Cas9-mediated functional dissection of the foxc1 genomic region in zebrafish identifies critical conserved cis-regulatory elements.", "journal": "Hum. Genomics", "date": "2022", "authors": "Ferre-Fern\u00e1ndez Jes\u00fas-Jos\u00e9, Muheisen Sanaa, Thompson Samuel, Semina Elena V", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "reference": [ { "type": "PubMed", "id": "36284357", "url": "https://glygen.org/publication/PubMed/36284357" } ] } ], "pathway": [ { "id": "dre:100537750", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:100537750", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O70220-1", "protein_name": "Forkhead box protein Q1", "gene_name": "Foxq1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKLEVFVPRAAHGDKMGSDLEGAGSSDVPSPLSAAGDDSLGSDGDCAANSPAAGSGAGDLEGGGGERNSSGGPSAQDGPEATDDSRTQASAAGPCAGGVGGGEGARSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRTTVSASGLRPEEAPPGPAGTPQPAPAARSSPIARSPARQEERSSPASKFSSSFAIDSILSKPFRSRRDGDSALGVQLPWGAAPCPPLRAYPALLPAAPGGALLPLCAYGASEPTLLASRGTEVQPAAPLLLAPLSTAAPAKPFRGPETAGAAHLYCPLRLPTALQAAAACGPGPHLSYPVETLLA", "length": 400 }, "evidence": [ { "id": "HGNC:20951", "url": "https://alliancegenome.org/gene/HGNC:20951#orthology", "database": "AGR" }, { "id": "MGI:1298228", "url": "https://alliancegenome.org/gene/MGI:1298228#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-070424-74", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-070424-74#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P40466-1", "protein_name": "Fork head protein homolog 1", "gene_name": "FKH1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MSVTSREQKFSGKYSSYTAQDRQGLVNAVTCVLSSSSDPVAVSSDYSNSLSIAREVNAYAKIAGCDWTYYVQKLEVTIGRNTDSLNLNAVPGTVVKKNIDIDLGPAKIVSRKHAAIRFNLESGSWELQIFGRNGAKVNFRRIPTGPDSPPTVLQSGCIIDIGGVQMIFILPEQETIISDYCLNHLMPKLLSTYGTNGNNNPLLRNIIEGSTYLREQRLQEEARLQQLDHLHTPLSSSSDVNPIGDPHGDTIMMEEDEEDENYTRGGIRPNTYTSSSNNAVTNGNVPHIENPSDLSLDENRYIKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKISDEVRRDFLNKWNAGKLSKIRRGASVTRQLQLHMSKFGEIPAPESSSIDPRGIKAQKVKKSLQATSSILGESAPQLQRTQLTGQISTTTSMDVTTNANVNNSSLS", "length": 484 }, "evidence": [ { "id": "HGNC:20951", "url": "https://alliancegenome.org/gene/HGNC:20951#orthology", "database": "AGR" }, { "id": "MGI:1298228", "url": "https://alliancegenome.org/gene/MGI:1298228#orthology", "database": "AGR" } ], "glygen_name": "Yeast", "common_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q63244-1", "protein_name": "Forkhead box protein Q1", "gene_name": "Foxq1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKLEVFAPRAAHGDKMGSDLEGAGSSDVPSPLSAAGDDSLGSDGDCAANSPAAGSGAGDLEGGGGERNSSGGASTQDDPEVTDGSRTQASPVGPCAGSVGGGEGARSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRTTVSASGYGGGSPPGPAGTPQPAPTAGSSPIARSPARQEEGSSPASKFSSSFAIDSILSKPFRSRRDGTPALGVQLPWSAAPCPPLRAYPALLPASSGGALLPLCAYGAAEPTLLASRGAEVQPAAPLFVAPLSTAAPAKPFRGPETAGAAHLYCPLRLPTALQAAAACGPGPHLSYRVETLLA", "length": 399 }, "evidence": [ { "id": "HGNC:20951", "url": "https://alliancegenome.org/gene/HGNC:20951#orthology", "database": "AGR" }, { "id": "MGI:1298228", "url": "https://alliancegenome.org/gene/MGI:1298228#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9C009-1", "protein_name": "Forkhead box protein Q1", "gene_name": "FOXQ1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANSPAAGGGARDTQGDGEQSAGGGPGAEEAIPAAAAAAVVAEGAEAGAAGPGAGGAGSGEGARSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRAPVPAPGLRPEEAPGLPAAPPPAPAAPASPRMRSPARQEERASPAGKFSSSFAIDSILRKPFRSRRLRDTAPGTTLQWGAAPCPPLPAFPALLPAAPCRALLPLCAYGAGEPARLGAREAEVPPTAPPLLLAPLPAAAPAKPLRGPAAGGAHLYCPLRLPAALQAASVRRPGPHLPYPVETLLA", "length": 403 }, "evidence": [ { "id": "HGNC:20951", "url": "https://alliancegenome.org/gene/HGNC:20951#orthology", "database": "AGR" }, { "id": "MGI:1298228", "url": "https://alliancegenome.org/gene/MGI:1298228#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-070424-74", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-070424-74#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "pmid": "" }, { "name": "cell differentiation", "id": "GO:0030154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030154", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "pmid": "" }, { "name": "response to xenobiotic stimulus", "id": "GO:0009410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "pmid": "" }, { "name": "tissue development", "id": "GO:0009888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009888", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "pmid": "" }, { "name": "anatomical structure morphogenesis", "id": "GO:0009653", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009653", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IJS9", "url": "https://www.uniprot.org/uniprot/A0A0R4IJS9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 139, "end_pos": 141, "annotation": "n_glycosylation_sequon" }, { "start_pos": 205, "end_pos": 207, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 139, "end_pos": 141 }, { "start_pos": 205, "end_pos": 207 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }