{ "uniprot_canonical_ac": "F1SLM8-1", "uniprot_ac": "F1SLM8", "uniprot_id": "MCIN_PIG", "mass": { "chemical_mass": 42231.0, "monoisotopic_mass": 42231.0 }, "refseq": {}, "gene_names": [ { "name": "MCIDAS", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/F1SLM8", "id": "F1SLM8" }, { "name": "IDAS", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/F1SLM8", "id": "F1SLM8" }, { "name": "MCIN", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/F1SLM8", "id": "F1SLM8" }, { "name": "MCI", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/F1SLM8", "id": "F1SLM8" } ], "protein_names": [ { "name": "Multicilin", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/F1SLM8/entry#names_and_taxonomy", "id": "F1SLM8" }, { "name": "McIdas protein", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/F1SLM8/entry#names_and_taxonomy", "id": "F1SLM8" }, { "name": "Multiciliate differentiation and DNA synthesis-associated cell cycle protein", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/F1SLM8/entry#names_and_taxonomy", "id": "F1SLM8" }, { "name": "Protein Idas", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/F1SLM8/entry#names_and_taxonomy", "id": "F1SLM8" } ], "function": [ { "annotation": "Transcription regulator specifically required for multiciliate cell differentiation. Acts in a multiprotein complex containing E2F4 and E2F5 that binds and activates genes required for centriole biogenesis. Required for the deuterosome-mediated acentriolar pathway. Plays a role in mitotic cell cycle progression by promoting cell cycle exit. Modulates GMNN activity by reducing its affinity for CDT1.", "evidence": [ { "database": "UniProtKB", "id": "F1SLM8", "url": "https://www.uniprot.org/uniprot/F1SLM8#function" }, { "database": "UniProtKB", "id": "D6RGH6", "url": "https://www.uniprot.org/uniprot/D6RGH6#function" }, { "database": "UniProtKB", "id": "Q08B36", "url": "https://www.uniprot.org/uniprot/Q08B36#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Sus scrofa", "taxid": 9823, "evidence": [ { "database": "UniProtKB", "id": "F1SLM8", "url": "https://www.uniprot.org/uniprot/F1SLM8" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" } ], "gene": [ { "name": "MCIDAS", "url": "https://www.uniprot.org/uniprot/F1SLM8", "locus": { "chromosome": "16", "start_pos": 34376959, "end_pos": 34384453, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSSSCG00000036183", "url": "https://www.ensembl.org/id/ENSSSCG00000036183" } ] } } ], "crossref": [ { "id": "F1SLM8", "url": "https://alphafold.ebi.ac.uk/entry/F1SLM8", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSSSCG00000036183", "url": "https://bgee.org/?page=gene&gene_id=ENSSSCG00000036183", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd22590", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd22590", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR022786", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022786", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "MMSPTLA", "url": "https://omabrowser.org/oma/group/MMSPTLA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "F1SLM8", "url": "https://www.orthodb.org/?gene=F1SLM8", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13372", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13372", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13372:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13372:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07412", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07412", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "F1SLM8", "url": "https://www.uniprot.org/uniprot/F1SLM8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1SLM8-1", "url": "https://www.uniprot.org/uniprot/F1SLM8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MQAACGGAAAGRRVFDSLCPNRMLDPQGRPFGKPGKLDRKFAPPRKFFPDRSISSRVSVYEDPPDPEPAALPALTTIDLQDLRDLADCSSLLGSHAPPSGDSAASQNHSLQTAADFDLQDFRDTVDDLIADSSSLMSPPLAGGNFPFSPSDVLPFGSCLSPPLDSPALQSPPLRPPEVPPPEQYWKELANQNQRALGDALVENNQLHVTLTQKQEEIASLKERNVQLKELASRTRHLASVLDKLMITRSQDCGAAAEPFLLKATAKRSLEELFSAAGQDCAEVDAILREISERCDEALQSRDPKRLRLQPEPPSMDGRPGNLHGAFRGLRTDCSRSSLNLSHSELEEGGSFSTPIRSHSTIRTLAFPQGNAFTIRTANGGYKFRWVPS", "length": 388, "header": "sp|F1SLM8-1|MCIN_PIG Isoform 1 of Multicilin OS=Sus scrofa OX=9823 GN=MCIDAS PE=3 SV=1 CANONICAL=F1SLM8-1" }, "isoforms": [ { "isoform_ac": "F1SLM8-1", "url": "https://www.uniprot.org/uniprotkb/F1SLM8/entry#F1SLM8-1", "sequence": { "sequence": "MQAACGGAAAGRRVFDSLCPNRMLDPQGRPFGKPGKLDRKFAPPRKFFPDRSISSRVSVYEDPPDPEPAALPALTTIDLQDLRDLADCSSLLGSHAPPSGDSAASQNHSLQTAADFDLQDFRDTVDDLIADSSSLMSPPLAGGNFPFSPSDVLPFGSCLSPPLDSPALQSPPLRPPEVPPPEQYWKELANQNQRALGDALVENNQLHVTLTQKQEEIASLKERNVQLKELASRTRHLASVLDKLMITRSQDCGAAAEPFLLKATAKRSLEELFSAAGQDCAEVDAILREISERCDEALQSRDPKRLRLQPEPPSMDGRPGNLHGAFRGLRTDCSRSSLNLSHSELEEGGSFSTPIRSHSTIRTLAFPQGNAFTIRTANGGYKFRWVPS", "length": 388, "header": "sp|F1SLM8-1|MCIN_PIG Isoform 1 of Multicilin OS=Sus scrofa OX=9823 GN=MCIDAS PE=3 SV=1 CANONICAL=F1SLM8-1" }, "locus": { "chromosome": "16", "start_pos": 34384438, "end_pos": 34377963, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSSSCT00000052937.3", "url": "https://www.ensembl.org/id/ENSSSCT00000052937.3" }, { "database": "Ensembl Peptide", "id": "ENSSSCP00000033119.1", "url": "https://www.ensembl.org/id/ENSSSCP00000033119.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool": "", "prediction_tool_list": [ { "label": "" } ], "site_category": "automatic_literature_mining", "site_category_dict": { "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 224, "start_aa": "Asn", "end_pos": 224, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn224", "evidence": [ { "id": "38602241", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38602241" }, { "id": "GLY_001398", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001398" } ], "mining_tool": "GlycoSiteMiner", "mining_tool_list": [ { "label": "GlycoSiteMiner", "url": "https://github.com/glygener/glycositeminer" } ], "filter_code": "00100000000000000000.00010000000000.01.01000" } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported" ], "publication": [], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "D3ZDX9-1", "protein_name": "Multicilin", "gene_name": "Mcidas", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MHACEGSAAGRRAFDSICPNRMLDLSRRSLGKPGKPERKFVPPWKSFPGCGGGSPVSVYEDPLDAEPAPLPALTTIDLQDLADCTSLLGTEAPPSGDSPASQNPSLQTEADFNLQNFRDAVDDLIADSSSLTSPPLTDGDFPFSPCDVPSFGSCLSPSLDPPALGSPHLPPPPTEQYWKEVADQNQRALGTALIENNQLHVTLTQKQEEIASLRERNVQLKELACRTRHLASVLDKLMITQSPAEPFQLKATTKRSLEELFSATGQAGQGCAEVDAILRDISQRCEEALQNRDPKRPRLQQEPDSKDCSTRNLHGVFRGLRTDCGASSVNLSHSELEEGGSFSTPIRSHSTIRTLAFPQGKAFTIRTVTGGYKFRWVPS", "length": 379 }, "evidence": [ { "id": "F1SLM8", "url": "https://omabrowser.org/oma/group/F1SLM8/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "D6RGH6-1", "protein_name": "Multicilin", "gene_name": "MCIDAS", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MQACGGGAAGRRAFDSICPNRMLALPGRALLCKPGKPERKFAPPRKFFPGCTGGSPVSVYEDPPDAEPTALPALTTIDLQDLADCSSLLGSDAPPGGDLAASQNHSHQTEADFNLQDFRDTVDDLISDSSSMMSPTLASGDFPFSPCDISPFGPCLSPPLDPRALQSPPLRPPDVPPPEQYWKEVADQNQRALGDALVENNQLHVTLTQKQEEIASLKERNVQLKELASRTRHLASVLDKLMITQSRDCGAAAEPFLLKAKAKRSLEELVSAAGQDCAEVDAILREISERCDEALQSRDPKRPRLLPEPANTDTRPGNLHGAFRGLRTDCSRSALNLSHSELEEGGSFSTRIRSHSTIRTLAFPQGNAFTIRTANGGYKFRWVPS", "length": 385 }, "evidence": [ { "id": "F1SLM8", "url": "https://omabrowser.org/oma/group/F1SLM8/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "G3N1S4-1", "protein_name": "Multicilin", "gene_name": "MCIDAS", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MQECGATAAGRRAFDSICPNRMLDPRGRPISKPGKPERKFAPPRKFFPGSSGCNRVSVYEDPPDAETPALPALTTIDLQDLADCSSFLGSDPPPGGDSAASQSHSLQTAADFDLQDFRDTVDNLIADSSSLMSPSLAGGDLPFSPSDVLPFGPCLSPPLSPPEVPPPEQYWKEVADQNQRALGDALIENNQLHATLTQKQEEIASLKERNLQLKELASRTRHLASVLDKLMITHSRDPGAAAEPFLLKATAKRSLEELFSAAGQDCAEVDAVLREISERCDEALQSRDPKRLRLQPEPQSLDRRPGNLHGAFPGLRTDCSLSTLNLSHSELEEGGSFSTPIRSHSTIRTLAFPQGNAFTIRTANGGYKFRWIPS", "length": 374 }, "evidence": [ { "id": "F1SLM8", "url": "https://omabrowser.org/oma/group/F1SLM8/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "Q3UZ45-1", "protein_name": "Multicilin", "gene_name": "Mcidas", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MQACEGSAAGRRAFDSICPNRMLDLSRRTLGKPGKPERKFVPSWKSFSGCGGGSPVAVYEDPPDAEPAPLPALTTIDLQDLADCTSLLGTEASPSGDSSASQNPSLQTEEDFNLQNFRDAMDDLIADSSSLMSPPLTNSDFPFSPCDVSSFGSCLSPSLDPPALGSPDLPPPPTEQYWKEVADQNQRALGTALIENNQLHVTLTQKQEEIASLRERNVQLKELASRTRHLASVLDKLMITQSPAEPFQIKATTKRSLEELFCAAGQAGQGCAEVDAILRDISQRCEEALHNRDPKRPRLQPEPDSKDCSSRNLHGAFRGLRTDCSASSVNLSHSELEEGGSFSTPIRSHSTIRTLAFPQGKAFTIRTVTGGYKFRWVPS", "length": 379 }, "evidence": [ { "id": "F1SLM8", "url": "https://omabrowser.org/oma/group/F1SLM8/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "regulation of DNA-templated DNA replication initiation", "id": "GO:0030174", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030174", "evidence": [ { "database": "UniProtKB", "id": "F1SLM8", "url": "https://www.uniprot.org/uniprot/F1SLM8" } ], "pmid": "" }, { "name": "multi-ciliated epithelial cell differentiation", "id": "GO:1903251", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903251", "evidence": [ { "database": "UniProtKB", "id": "F1SLM8", "url": "https://www.uniprot.org/uniprot/F1SLM8" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "F1SLM8", "url": "https://www.uniprot.org/uniprot/F1SLM8" } ], "pmid": "" }, { "name": "regulation of mitotic cell cycle", "id": "GO:0007346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007346", "evidence": [ { "database": "UniProtKB", "id": "F1SLM8", "url": "https://www.uniprot.org/uniprot/F1SLM8" } ], "pmid": "" }, { "name": "cilium assembly", "id": "GO:0060271", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060271", "evidence": [ { "database": "UniProtKB", "id": "F1SLM8", "url": "https://www.uniprot.org/uniprot/F1SLM8" } ], "pmid": "" }, { "name": "motile cilium assembly", "id": "GO:0044458", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044458", "evidence": [ { "database": "UniProtKB", "id": "F1SLM8", "url": "https://www.uniprot.org/uniprot/F1SLM8" } ], "pmid": "" }, { "name": "negative regulation of cell cycle", "id": "GO:0045786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045786", "evidence": [ { "database": "UniProtKB", "id": "F1SLM8", "url": "https://www.uniprot.org/uniprot/F1SLM8" } ], "pmid": "" }, { "name": "regulation of cilium assembly", "id": "GO:1902017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902017", "evidence": [ { "database": "UniProtKB", "id": "F1SLM8", "url": "https://www.uniprot.org/uniprot/F1SLM8" } ], "pmid": "" }, { "name": "centriole assembly", "id": "GO:0098534", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098534", "evidence": [ { "database": "UniProtKB", "id": "F1SLM8", "url": "https://www.uniprot.org/uniprot/F1SLM8" } ], "pmid": "" }, { "name": "negative regulation of DNA replication", "id": "GO:0008156", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008156", "evidence": [ { "database": "UniProtKB", "id": "F1SLM8", "url": "https://www.uniprot.org/uniprot/F1SLM8" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "F1SLM8", "url": "https://www.uniprot.org/uniprot/F1SLM8" } ], "pmid": "" }, { "name": "nuclear body", "id": "GO:0016604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016604", "evidence": [ { "database": "UniProtKB", "id": "F1SLM8", "url": "https://www.uniprot.org/uniprot/F1SLM8" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "F1SLM8", "url": "https://www.uniprot.org/uniprot/F1SLM8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 107, "end_pos": 109, "annotation": "n_glycosylation_sequon" }, { "start_pos": 339, "end_pos": 341, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-F1SLM8-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 388, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-F1SLM8-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 224 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 107, "end_pos": 109 }, { "start_pos": 339, "end_pos": 341 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }