{ "uniprot_canonical_ac": "A0A0R4II42-1", "uniprot_ac": "A0A0R4II42", "uniprot_id": "A0A0R4II42_DANRE", "mass": { "chemical_mass": 16222.0, "monoisotopic_mass": 16222.0 }, "refseq": {}, "gene_names": [ { "name": "uqcc4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0R4II42", "id": "A0A0R4II42" }, { "name": "si:ch211-231f6.6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0R4II42", "id": "A0A0R4II42" } ], "protein_names": [ { "name": "Protein CCSMST1 isoform X1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II42/entry#names_and_taxonomy", "id": "A0A0R4II42" }, { "name": "Si:ch211-231f6.6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II42/entry#names_and_taxonomy", "id": "A0A0R4II42" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4II42", "url": "https://www.uniprot.org/uniprot/A0A0R4II42" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "uqcc4", "url": "https://www.uniprot.org/uniprot/A0A0R4II42", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-141216-156", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-141216-156", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000100025", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000100025", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "101882877", "url": "https://www.ncbi.nlm.nih.gov/gene/101882877", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR023248", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023248", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029160", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029160", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "GHQRPWW", "url": "https://omabrowser.org/oma/group/GHQRPWW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4II42", "url": "https://www.orthodb.org/?gene=A0A0R4II42", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR35268", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR35268", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR35268:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR35268:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15013", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF15013", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_005162943", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005162943", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4II42", "url": "https://www.uniprot.org/uniprot/A0A0R4II42", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4II42-1", "url": "https://www.uniprot.org/uniprot/A0A0R4II42-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8M9PMH3", "url": "https://www.uniprot.org/uniprot/A0A8M9PMH3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8M9PMH3-1", "url": "https://www.uniprot.org/uniprot/A0A8M9PMH3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-141216-156", "url": "https://zfin.org/ZDB-GENE-141216-156", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MSKVYTRLSRFSFAYNAFTSRRHAKLRPCATRMLSITSALHAKSRKPPEHEDEVVDKPIKFSTSPASHRTWNVDRSMGSNFQRPWWKVLPISLLGVGILLWCVFRKETEVDQTLEKNLYDHISGLLSEEEEEEVKNKPSS", "length": 140, "header": "tr|A0A0R4II42-1|A0A0R4II42_DANRE Isoform 1 of Protein CCSMST1 isoform X1 OS=Danio rerio OX=7955 GN=uqcc4 PE=3 SV=1 CANONICAL=A0A0R4II42-1" }, "isoforms": [ { "isoform_ac": "A0A0R4II42-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II42/entry#A0A0R4II42-1", "sequence": { "sequence": "MSKVYTRLSRFSFAYNAFTSRRHAKLRPCATRMLSITSALHAKSRKPPEHEDEVVDKPIKFSTSPASHRTWNVDRSMGSNFQRPWWKVLPISLLGVGILLWCVFRKETEVDQTLEKNLYDHISGLLSEEEEEEVKNKPSS", "length": 140, "header": "tr|A0A0R4II42-1|A0A0R4II42_DANRE Isoform 1 of Protein CCSMST1 isoform X1 OS=Danio rerio OX=7955 GN=uqcc4 PE=3 SV=1 CANONICAL=A0A0R4II42-1" }, "locus": {} }, { "isoform_ac": "A0A8M9PMH3-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II42/entry#A0A8M9PMH3-1", "sequence": { "sequence": "MLSITSALHAKSRKPPEHEDEVVDKPIKFSTSPASHRTWNVDRSMGSNFQRPWWKVLPISLLGVGILLWCVFRKETEVDQTLEKNLYDHISGLLSEEEEEEVKNKPSS", "length": 108, "header": "tr|A0A8M9PMH3-1|A0A0R4II42_DANRE Computationally mapped isoform of Protein CCSMST1 isoform X1 OS=Danio rerio OX=7955 GN=uqcc4 PE=3 SV=1 CANONICAL=A0A0R4II42-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A1Z7B8-1", "protein_name": "GEO08456p1", "gene_name": "Dmel\\CG30373", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MLRLLTKTRVLRQLMPATGATPPASRFYAKNQGAASQKSDDDMVSDEPIKFFGSQAATWRAKDTRSGGSDETLWYQPYVISASLAIFLLYFCALREESDIDLRLEGNLYEHVSGLEEVQLTVNYRYNKEHGLDTKEQERRLRELGVDLGQLDAKLAAQ", "length": 158 }, "evidence": [ { "id": "HGNC:27558", "url": "https://alliancegenome.org/gene/HGNC:27558#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-141216-156", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-141216-156#orthology", "database": "AGR" }, { "id": "MGI:2670966", "url": "https://alliancegenome.org/gene/MGI:2670966#orthology", "database": "AGR" }, { "id": "FB:FBgn0050373", "url": "https://alliancegenome.org/gene/FB:FBgn0050373#orthology", "database": "AGR" }, { "id": "RGD:1565784", "url": "https://alliancegenome.org/gene/RGD:1565784#orthology", "database": "AGR" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "D4ACY1-1", "protein_name": "Ubiquinol-cytochrome c reductase complex assembly factor 4", "gene_name": "Uqcc4", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MNSVLCSRAAGAVRALRLVGWTSRSLHPPPRDRSPVQSADREEEEEDPNLPIQFSGSKATPVRWTVEHSLGKQQQRPWWKVLPFTLPLVVLIIWCYRREESSTDQWLRQILEEEDEEEPEGPLEELEAPAIYGART", "length": 136 }, "evidence": [ { "id": "HGNC:27558", "url": "https://alliancegenome.org/gene/HGNC:27558#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-141216-156", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-141216-156#orthology", "database": "AGR" }, { "id": "MGI:2670966", "url": "https://alliancegenome.org/gene/MGI:2670966#orthology", "database": "AGR" }, { "id": "FB:FBgn0050373", "url": "https://alliancegenome.org/gene/FB:FBgn0050373#orthology", "database": "AGR" }, { "id": "RGD:1565784", "url": "https://alliancegenome.org/gene/RGD:1565784#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q4G0I0-1", "protein_name": "Ubiquinol-cytochrome c reductase complex assembly factor 4", "gene_name": "UQCC4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNRVLCAPAAGAVRALRLIGWASRSLHPLPGSRDRAHPAAEEEDDPDRPIEFSSSKANPHRWSVGHTMGKGHQRPWWKVLPLSCFLVALIIWCYLREESEADQWLRQVWGEVPEPSDRSEEPETPAAYRART", "length": 132 }, "evidence": [ { "id": "HGNC:27558", "url": "https://alliancegenome.org/gene/HGNC:27558#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-141216-156", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-141216-156#orthology", "database": "AGR" }, { "id": "MGI:2670966", "url": "https://alliancegenome.org/gene/MGI:2670966#orthology", "database": "AGR" }, { "id": "FB:FBgn0050373", "url": "https://alliancegenome.org/gene/FB:FBgn0050373#orthology", "database": "AGR" }, { "id": "RGD:1565784", "url": "https://alliancegenome.org/gene/RGD:1565784#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q6RUT7-1", "protein_name": "Ubiquinol-cytochrome c reductase complex assembly factor 4", "gene_name": "Uqcc4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNSVLCSRAAGAVRALRLVGWASRSLHPPPRGRSPAQPADREEEDDDPNLPIQFSGSKATPIRWTVEHSLGKPQQRPWWKVLPLTLTLVALVVWCYQREESGMDLWLRQVLEEEDEEEPEGPPEELEAPALYGART", "length": 136 }, "evidence": [ { "id": "HGNC:27558", "url": "https://alliancegenome.org/gene/HGNC:27558#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-141216-156", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-141216-156#orthology", "database": "AGR" }, { "id": "MGI:2670966", "url": "https://alliancegenome.org/gene/MGI:2670966#orthology", "database": "AGR" }, { "id": "FB:FBgn0050373", "url": "https://alliancegenome.org/gene/FB:FBgn0050373#orthology", "database": "AGR" }, { "id": "RGD:1565784", "url": "https://alliancegenome.org/gene/RGD:1565784#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4II42", "url": "https://www.uniprot.org/uniprot/A0A0R4II42" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }