{
    "uniprot_canonical_ac": "A0A1P8B2M8-1",
    "uniprot_ac": "A0A1P8B2M8",
    "uniprot_id": "A0A1P8B2M8_ARATH",
    "mass": {
        "chemical_mass": 34848.0,
        "monoisotopic_mass": 34848.0
    },
    "refseq": {
        "ac": "NP_001325263",
        "name": "uncharacterized protein",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001325263"
    },
    "gene_names": [
        {
            "name": "T5M2.8; T5M2_8",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001325263",
            "id": "NP_001325263"
        },
        {
            "name": "T5M2.8",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/A0A1P8B2M8",
            "id": "A0A1P8B2M8"
        },
        {
            "name": "T5M2_8",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/A0A1P8B2M8",
            "id": "A0A1P8B2M8"
        }
    ],
    "protein_names": [
        {
            "name": "Transmembrane protein",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprotkb/A0A1P8B2M8/entry#names_and_taxonomy",
            "id": "A0A1P8B2M8"
        },
        {
            "name": "uncharacterized protein",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001325263",
            "id": "NP_001325263"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Arabidopsis thaliana",
            "taxid": 3702,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A1P8B2M8",
                    "url": "https://www.uniprot.org/uniprot/A0A1P8B2M8"
                }
            ],
            "common_name": "Mouse-ear cress",
            "glygen_name": "Arabidopsis",
            "reference_species": "Arabidopsis thaliana [3702]"
        }
    ],
    "gene": [
        {
            "name": "",
            "url": "https://www.uniprot.org/uniprot/A0A1P8B2M8",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "A0A1P8B2M8",
            "url": "https://alphafold.ebi.ac.uk/entry/A0A1P8B2M8",
            "database": "AlphaFoldDB",
            "categories": []
        },
        {
            "id": "AT2G07674",
            "url": "https://bar.utoronto.ca/thalemine/portal.do?externalids=AT2G07674",
            "database": "Araport",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "815346",
            "url": "https://www.ncbi.nlm.nih.gov/gene/815346",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR052694",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR052694",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "ath:AT2G07674",
            "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT2G07674",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "A0A1P8B2M8",
            "url": "https://www.orthodb.org/?gene=A0A1P8B2M8",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR35289",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR35289",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR35289:SF1",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR35289:SF1",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_001325263",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001325263",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "AT2G07674",
            "url": "https://www.arabidopsis.org/servlets/TairObject?type=locus&name=AT2G07674",
            "database": "TAIR",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "A0A1P8B2M8",
            "url": "https://www.uniprot.org/uniprot/A0A1P8B2M8",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A1P8B2M8-1",
            "url": "https://www.uniprot.org/uniprot/A0A1P8B2M8-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q3EC50",
            "url": "https://www.uniprot.org/uniprot/Q3EC50",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q3EC50-1",
            "url": "https://www.uniprot.org/uniprot/Q3EC50-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MKNMVRLLLPLLGALAGSFCARFLGSEGSAIMTTTRVSFSSILVVSFLFCFHFHSFRLKGPQKKIIYLFLVFSMGFVGSLIRIEVIHLVGGLALPVLGPLVLNAIGGQALPSTGPSGSGSSSMWEEDSFELGVLEESDSPPAGGSRTEEGEPSVNQGSPLPSQTEEGEPSVNQVPQEAGPALPANPVPPGGEEAGPVVPYPYRRDEMIGGDSVEAIERRLLAKYPEGSPSAEIIEMARIEAEDLFEIKAQIIQRMALYDPTGDWMARGARALDNPRTTSGEESLERLYDIWKDLQETGPLSDEFSRLQEKVFLKKGGPGGDPIA",
        "length": 324,
        "header": "tr|A0A1P8B2M8-1|A0A1P8B2M8_ARATH Isoform 1 of Transmembrane protein  OS=Arabidopsis thaliana OX=3702 GN= PE=4 SV=1 CANONICAL=A0A1P8B2M8-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A1P8B2M8-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A1P8B2M8/entry#A0A1P8B2M8-1",
            "sequence": {
                "sequence": "MKNMVRLLLPLLGALAGSFCARFLGSEGSAIMTTTRVSFSSILVVSFLFCFHFHSFRLKGPQKKIIYLFLVFSMGFVGSLIRIEVIHLVGGLALPVLGPLVLNAIGGQALPSTGPSGSGSSSMWEEDSFELGVLEESDSPPAGGSRTEEGEPSVNQGSPLPSQTEEGEPSVNQVPQEAGPALPANPVPPGGEEAGPVVPYPYRRDEMIGGDSVEAIERRLLAKYPEGSPSAEIIEMARIEAEDLFEIKAQIIQRMALYDPTGDWMARGARALDNPRTTSGEESLERLYDIWKDLQETGPLSDEFSRLQEKVFLKKGGPGGDPIA",
                "length": 324,
                "header": "tr|A0A1P8B2M8-1|A0A1P8B2M8_ARATH Isoform 1 of Transmembrane protein  OS=Arabidopsis thaliana OX=3702 GN= PE=4 SV=1 CANONICAL=A0A1P8B2M8-1"
            },
            "locus": {
                "chromosome": "2",
                "start_pos": 3269903,
                "end_pos": 3268932,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "AT2G07674.2",
                        "url": "https://www.ensemblgenomes.org/id/AT2G07674.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "AT2G07674.2",
                        "url": "https://www.ensemblgenomes.org/id/AT2G07674.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q3EC50-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A1P8B2M8/entry#Q3EC50-1",
            "sequence": {
                "sequence": "MGFVGSLIRIEVIHLVGGLALPVLGPLVLNAIGGQALPSTGPSGSGSSSMWEEDSFELGVLEESDSPPAGGSRTEEGEPSVNQGSPLPSQTEEGEPSVNQVPQEAGPALPANPVPPGGEEAGPVVPYPYRRDEMIGGDSVEAIERRLLAKYPEGSPSAEIIEMARIEAEDLFEIKAQIIQRMALYDPTGDWMARGARALDNPRTTSGEESLERLYDIWKDLQETGPLSDEFSRLQEKVFLKKGGPGGDPIA",
                "length": 251,
                "header": "tr|Q3EC50-1|A0A1P8B2M8_ARATH Computationally mapped isoform of Transmembrane protein  OS=Arabidopsis thaliana OX=3702 GN= PE=4 SV=1 CANONICAL=A0A1P8B2M8-1"
            },
            "locus": {
                "chromosome": "2",
                "start_pos": 3269903,
                "end_pos": 3269151,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "AT2G07674.1",
                        "url": "https://www.ensemblgenomes.org/id/AT2G07674.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "AT2G07674.1",
                        "url": "https://www.ensemblgenomes.org/id/AT2G07674.1"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana.",
            "journal": "Nature",
            "date": "1999",
            "authors": "Lin X, Kaul S, Rounsley S, Shea T P, Benito M I, Town C D, Fujii C Y, Mason T, Bowman C L, Barnstead M, Feldblyum T V, Buell C R, Ketchum K A, Lee J, Ronning C M, Koo H L, Moffat K S, Cronin L A, Shen M, Pai G, Van Aken S, Umayam L, Tallon L J, Gill J E, Adams M D, Carrera A J, Creasy T H, Goodman H M, Somerville C R, Copenhaver G P, Preuss D, Nierman W C, White O, Eisen J A, Salzberg S L, Fraser C M, Venter J C",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q3EC50",
                    "url": "https://www.uniprot.org/uniprot/Q3EC50"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10617197",
                    "url": "https://glygen.org/publication/PubMed/10617197"
                }
            ]
        },
        {
            "title": "Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.",
            "journal": "Plant J.",
            "date": "2017",
            "authors": "Cheng Chia-Yi, Krishnakumar Vivek, Chan Agnes P, Thibaud-Nissen Fran\u00e7oise, Schobel Seth, Town Christopher D",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q3EC50",
                    "url": "https://www.uniprot.org/uniprot/Q3EC50"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27862469",
                    "url": "https://glygen.org/publication/PubMed/27862469"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "ath:AT2G07674",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT2G07674",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "membrane",
                        "id": "GO:0016020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1P8B2M8",
                                "url": "https://www.uniprot.org/uniprot/A0A1P8B2M8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "structures": [
        {
            "pdb_id": "AF-A0A1P8B2M8-F1",
            "pdb_chain": "global",
            "start_pos": 1,
            "end_pos": 324,
            "overlap": "1.0",
            "method": "AlphaFold",
            "type": "alphafold",
            "resolution": -1.0,
            "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1P8B2M8-F1.pdb"
        }
    ],
    "synthesized_glycans": [],
    "enzyme_annotation": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        }
    ],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": []
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}