{
    "uniprot_canonical_ac": "A0A1P8AME8-1",
    "uniprot_ac": "A0A1P8AME8",
    "uniprot_id": "A0A1P8AME8_ARATH",
    "mass": {
        "chemical_mass": 33891.0,
        "monoisotopic_mass": 33891.0
    },
    "refseq": {
        "ac": "NP_001320281",
        "name": "Chitinase family protein",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001320281"
    },
    "gene_names": [
        {
            "name": "F25P12.88; F25P12_88",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001320281",
            "id": "NP_001320281"
        },
        {
            "name": "F25P12.88",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/A0A1P8AME8",
            "id": "A0A1P8AME8"
        },
        {
            "name": "F25P12_88",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/A0A1P8AME8",
            "id": "A0A1P8AME8"
        }
    ],
    "protein_names": [
        {
            "name": "Chitinase family protein",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001320281",
            "id": "NP_001320281"
        },
        {
            "name": "Chitinase family protein",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprotkb/A0A1P8AME8/entry#names_and_taxonomy",
            "id": "A0A1P8AME8"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Arabidopsis thaliana",
            "taxid": 3702,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A1P8AME8",
                    "url": "https://www.uniprot.org/uniprot/A0A1P8AME8"
                }
            ],
            "common_name": "Mouse-ear cress",
            "glygen_name": "Arabidopsis",
            "reference_species": "Arabidopsis thaliana [3702]"
        }
    ],
    "gene": [
        {
            "name": "",
            "url": "https://www.uniprot.org/uniprot/A0A1P8AME8",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "A0A1P8AME8",
            "url": "https://alphafold.ebi.ac.uk/entry/A0A1P8AME8",
            "database": "AlphaFoldDB",
            "categories": []
        },
        {
            "id": "AT1G56680",
            "url": "https://bar.utoronto.ca/thalemine/portal.do?externalids=AT1G56680",
            "database": "Araport",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "CBM18",
            "url": "http://www.cazy.org/CBM18.html",
            "database": "CAZy",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "GH19",
            "url": "http://www.cazy.org/GH19.html",
            "database": "CAZy",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "cd00035",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00035",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "cd00325",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00325",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "842124",
            "url": "https://www.ncbi.nlm.nih.gov/gene/842124",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR000726",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000726",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR001002",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001002",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR016283",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR016283",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR023346",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR023346",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036861",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036861",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "ath:AT1G56680",
            "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT1G56680",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "A0A1P8AME8",
            "url": "https://www.orthodb.org/?gene=A0A1P8AME8",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR22595",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22595",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR22595:SF152",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22595:SF152",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00182",
            "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00182",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_001320281",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001320281",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "AT1G56680",
            "url": "https://www.arabidopsis.org/servlets/TairObject?type=locus&name=AT1G56680",
            "database": "TAIR",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "A0A1P8AME8",
            "url": "https://www.uniprot.org/uniprot/A0A1P8AME8",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A1P8AME8-1",
            "url": "https://www.uniprot.org/uniprot/A0A1P8AME8-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9FXB8",
            "url": "https://www.uniprot.org/uniprot/Q9FXB8",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9FXB8-1",
            "url": "https://www.uniprot.org/uniprot/Q9FXB8-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MFHYKYVHKPSSSLHPLPSNIENMATQNKIQKNSLIIFLFTLVVIAQTATSQNCLTIGCPGINECCSHTGYCGTNVEHCGFWCLSGPCQLSKSSSSYRLNDGPRGKIESIVTPALFHRLMRKVGSNCTGKGFYTREAFITAVKSFEGYKGTVAKREIAAILAQFSYESGNFCYKEEVTSETYCSSSKTYPCQSGKKYYGRGLLQSIKWNEFYGEAGKYLGLPLLKDPDMVARSPEVAFKFAMWFWKTEVGPSLRLGFGATTMRINGIECGGMSWNAEAMQNRINQYLEICKWFGVNPGKDLYC",
        "length": 303,
        "header": "tr|A0A1P8AME8-1|A0A1P8AME8_ARATH Isoform 1 of Chitinase family protein  OS=Arabidopsis thaliana OX=3702 GN= PE=1 SV=1 CANONICAL=A0A1P8AME8-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A1P8AME8-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A1P8AME8/entry#A0A1P8AME8-1",
            "sequence": {
                "sequence": "MFHYKYVHKPSSSLHPLPSNIENMATQNKIQKNSLIIFLFTLVVIAQTATSQNCLTIGCPGINECCSHTGYCGTNVEHCGFWCLSGPCQLSKSSSSYRLNDGPRGKIESIVTPALFHRLMRKVGSNCTGKGFYTREAFITAVKSFEGYKGTVAKREIAAILAQFSYESGNFCYKEEVTSETYCSSSKTYPCQSGKKYYGRGLLQSIKWNEFYGEAGKYLGLPLLKDPDMVARSPEVAFKFAMWFWKTEVGPSLRLGFGATTMRINGIECGGMSWNAEAMQNRINQYLEICKWFGVNPGKDLYC",
                "length": 303,
                "header": "tr|A0A1P8AME8-1|A0A1P8AME8_ARATH Isoform 1 of Chitinase family protein  OS=Arabidopsis thaliana OX=3702 GN= PE=1 SV=1 CANONICAL=A0A1P8AME8-1"
            },
            "locus": {
                "chromosome": "1",
                "start_pos": 21251486,
                "end_pos": 21250431,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "AT1G56680.2",
                        "url": "https://www.ensemblgenomes.org/id/AT1G56680.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "AT1G56680.2",
                        "url": "https://www.ensemblgenomes.org/id/AT1G56680.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q9FXB8-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A1P8AME8/entry#Q9FXB8-1",
            "sequence": {
                "sequence": "MATQNKIQKNSLIIFLFTLVVIAQTATSQNCLTIGCPGINECCSHTGYCGTNVEHCGFWCLSGPCQLSKSSSSYRLNDGPRGKIESIVTPALFHRLMRKVGSNCTGKGFYTREAFITAVKSFEGYKGTVAKREIAAILAQFSYESGNFCYKEEVTSETYCSSSKTYPCQSGKKYYGRGLLQSIKWNEFYGEAGKYLGLPLLKDPDMVARSPEVAFKFAMWFWKTEVGPSLRLGFGATTMRINGIECGGMSWNAEAMQNRINQYLEICKWFGVNPGKDLYC",
                "length": 280,
                "header": "tr|Q9FXB8-1|Q9FXB8_ARATH Computationally mapped isoform of Putative chitinase  OS=Arabidopsis thaliana OX=3702 GN= PE=1 SV=1 CANONICAL=A0A1P8AME8-1"
            },
            "locus": {
                "chromosome": "1",
                "start_pos": 21251417,
                "end_pos": 21250431,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "AT1G56680.1",
                        "url": "https://www.ensemblgenomes.org/id/AT1G56680.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "AT1G56680.1",
                        "url": "https://www.ensemblgenomes.org/id/AT1G56680.1"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.",
            "journal": "Nature",
            "date": "2000",
            "authors": "Theologis A, Ecker J R, Palm C J, Federspiel N A, Kaul S, White O, Alonso J, Altafi H, Araujo R, Bowman C L, Brooks S Y, Buehler E, Chan A, Chao Q, Chen H, Cheuk R F, Chin C W, Chung M K, Conn L, Conway A B, Conway A R, Creasy T H, Dewar K, Dunn P, Etgu P, Feldblyum T V, Feng J, Fong B, Fujii C Y, Gill J E, Goldsmith A D, Haas B, Hansen N F, Hughes B, Huizar L, Hunter J L, Jenkins J, Johnson-Hopson C, Khan S, Khaykin E, Kim C J, Koo H L, Kremenetskaia I, Kurtz D B, Kwan A, Lam B, Langin-Hooper S, Lee A, Lee J M, Lenz C A, Li J H, Li Y, Lin X, Liu S X, Liu Z A, Luros J S, Maiti R, Marziali A, Militscher J, Miranda M, Nguyen M, Nierman W C, Osborne B I, Pai G, Peterson J, Pham P K, Rizzo M, Rooney T, Rowley D, Sakano H, Salzberg S L, Schwartz J R, Shinn P, Southwick A M, Sun H, Tallon L J, Tambunga G, Toriumi M J, Town C D, Utterback T, Van Aken S, Vaysberg M, Vysotskaia V S, Walker M, Wu D, Yu G, Fraser C M, Venter J C, Davis R W",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A1P8AME8",
                    "url": "https://www.uniprot.org/uniprot/A0A1P8AME8"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11130712",
                    "url": "https://glygen.org/publication/PubMed/11130712"
                }
            ]
        },
        {
            "title": "Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.",
            "journal": "Plant J.",
            "date": "2017",
            "authors": "Cheng Chia-Yi, Krishnakumar Vivek, Chan Agnes P, Thibaud-Nissen Fran\u00e7oise, Schobel Seth, Town Christopher D",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A1P8AME8",
                    "url": "https://www.uniprot.org/uniprot/A0A1P8AME8"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27862469",
                    "url": "https://glygen.org/publication/PubMed/27862469"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "ath:AT1G56680",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT1G56680",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 3,
                "go_terms": [
                    {
                        "name": "carbohydrate metabolic process",
                        "id": "GO:0005975",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005975",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1P8AME8",
                                "url": "https://www.uniprot.org/uniprot/A0A1P8AME8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "chitin catabolic process",
                        "id": "GO:0006032",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006032",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1P8AME8",
                                "url": "https://www.uniprot.org/uniprot/A0A1P8AME8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell wall macromolecule catabolic process",
                        "id": "GO:0016998",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016998",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1P8AME8",
                                "url": "https://www.uniprot.org/uniprot/A0A1P8AME8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 2,
                "go_terms": [
                    {
                        "name": "chitinase activity",
                        "id": "GO:0004568",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004568",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1P8AME8",
                                "url": "https://www.uniprot.org/uniprot/A0A1P8AME8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "chitin binding",
                        "id": "GO:0008061",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008061",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1P8AME8",
                                "url": "https://www.uniprot.org/uniprot/A0A1P8AME8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 126,
            "end_pos": 128,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "structures": [
        {
            "pdb_id": "AF-A0A1P8AME8-F1",
            "pdb_chain": "global",
            "start_pos": 1,
            "end_pos": 303,
            "overlap": "1.0",
            "method": "AlphaFold",
            "type": "alphafold",
            "resolution": -1.0,
            "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1P8AME8-F1.pdb"
        }
    ],
    "synthesized_glycans": [],
    "enzyme_annotation": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        }
    ],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": [
            {
                "start_pos": 126,
                "end_pos": 128
            }
        ]
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}