{ "uniprot_canonical_ac": "A0A1L1RT72-1", "uniprot_ac": "A0A1L1RT72", "uniprot_id": "A0A1L1RT72_CHICK", "mass": { "chemical_mass": 26717.0, "monoisotopic_mass": 26717.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "UDP-N-acetylglucosamine transferase subunit ALG13", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1L1RT72/entry#names_and_taxonomy", "id": "A0A1L1RT72" }, { "name": "2.4.1.141", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1L1RT72/entry#names_and_taxonomy", "id": "A0A1L1RT72" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1L1RT72", "url": "https://www.uniprot.org/uniprot/A0A1L1RT72" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/A0A1L1RT72", "locus": {} } ], "crossref": [ { "id": "A0A1L1RT72", "url": "https://alphafold.ebi.ac.uk/entry/A0A1L1RT72", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000030718", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000030718", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR007235", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007235", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039042", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039042", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR12867", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12867", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12867:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12867:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04101", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF04101", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-446193", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-446193", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "A0A1L1RT72", "url": "https://www.uniprot.org/uniprot/A0A1L1RT72", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1L1RT72-1", "url": "https://www.uniprot.org/uniprot/A0A1L1RT72-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0YS04", "url": "https://www.uniprot.org/uniprot/A0A8V0YS04", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0YS04-1", "url": "https://www.uniprot.org/uniprot/A0A8V0YS04-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0YTQ5", "url": "https://www.uniprot.org/uniprot/A0A8V0YTQ5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0YTQ5-1", "url": "https://www.uniprot.org/uniprot/A0A8V0YTQ5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKTVFVTVGTTSFDELIAAVSSPAAEQVRRRNARFGGRQEEGPSPPLAAGLPCLSSAPARWLRGRLWGAARSCTEGGKREPFCGEWEAVEGEPAVLSSGLSPASVPPPQVLRSRGCRQLVLQIGRGALQPAPQYGPAFVRDVFRFKESLAEDLRRADLVISHAGAGSCLETLEEGKPLLVVINEKLMDNHQLELARQLHKDGHVLYCNCSTLVETLQSMDLSTLKPFPPGQPEKFALFLDKVVGFE", "length": 246, "header": "tr|A0A1L1RT72-1|A0A1L1RT72_CHICK Isoform 1 of UDP-N-acetylglucosamine transferase subunit ALG13 OS=Gallus gallus OX=9031 GN= PE=1 SV=2 CANONICAL=A0A1L1RT72-1" }, "isoforms": [ { "isoform_ac": "A0A1L1RT72-1", "url": "https://www.uniprot.org/uniprotkb/A0A1L1RT72/entry#A0A1L1RT72-1", "sequence": { "sequence": "MKTVFVTVGTTSFDELIAAVSSPAAEQVRRRNARFGGRQEEGPSPPLAAGLPCLSSAPARWLRGRLWGAARSCTEGGKREPFCGEWEAVEGEPAVLSSGLSPASVPPPQVLRSRGCRQLVLQIGRGALQPAPQYGPAFVRDVFRFKESLAEDLRRADLVISHAGAGSCLETLEEGKPLLVVINEKLMDNHQLELARQLHKDGHVLYCNCSTLVETLQSMDLSTLKPFPPGQPEKFALFLDKVVGFE", "length": 246, "header": "tr|A0A1L1RT72-1|A0A1L1RT72_CHICK Isoform 1 of UDP-N-acetylglucosamine transferase subunit ALG13 OS=Gallus gallus OX=9031 GN= PE=1 SV=2 CANONICAL=A0A1L1RT72-1" }, "locus": { "chromosome": "4", "start_pos": 13140106, "end_pos": 13137012, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010036902.1", "url": "https://www.ensembl.org/id/ENSGALT00010036902.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010021489.1", "url": "https://www.ensembl.org/id/ENSGALP00010021489.1" } ] } }, { "isoform_ac": "A0A8V0YS04-1", "url": "https://www.uniprot.org/uniprotkb/A0A1L1RT72/entry#A0A8V0YS04-1", "sequence": { "sequence": "MKTVFVTVGTTSFDELIAAVSSPAAEQVLRSRGCRQLVLQIGRGALQPAPQYGPAFVRDVFRFKESLAEDLRRADLVISHAGAGSCLETLEEGKPLLVVINEKLMDNHQLELARQLHKDGHVLYCNCRYGAAVAVTLDAVLRSITVITVLRM", "length": 152, "header": "tr|A0A8V0YS04-1|A0A8V0YS04_CHICK Computationally mapped isoform of UDP-N-acetylglucosamine transferase subunit ALG13 OS=Gallus gallus OX=9031 GN= PE=1 SV=1 CANONICAL=A0A1L1RT72-1" }, "locus": { "chromosome": "4", "start_pos": 13140106, "end_pos": 13139196, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010036904.1", "url": "https://www.ensembl.org/id/ENSGALT00010036904.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010021490.1", "url": "https://www.ensembl.org/id/ENSGALP00010021490.1" } ] } }, { "isoform_ac": "A0A8V0YTQ5-1", "url": "https://www.uniprot.org/uniprotkb/A0A1L1RT72/entry#A0A8V0YTQ5-1", "sequence": { "sequence": "RWLRGRLWGAARSCTEGGKREPFCGEWEAVEGEPAVLSSGLSPASVPPPQIGRGALQPAPQYGPAFVRDVFRFKESLAEDLRRADLVISHAGAGSCLETLEEGKPLLVVINEKLMDNHQLELARQLHKDGHVLYCNCSTLVETLQSMDLSTLKPFPPGQPEKFALFLDKVVGFE", "length": 174, "header": "tr|A0A8V0YTQ5-1|A0A8V0YTQ5_CHICK Computationally mapped isoform of UDP-N-acetylglucosamine transferase subunit ALG13 OS=Gallus gallus OX=9031 GN= PE=1 SV=1 CANONICAL=A0A1L1RT72-1" }, "locus": { "chromosome": "4", "start_pos": 13139929, "end_pos": 13137012, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010036898.1", "url": "https://www.ensembl.org/id/ENSGALT00010036898.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010021486.1", "url": "https://www.ensembl.org/id/ENSGALP00010021486.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool": "isoglyp", "mining_tool": "", "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "start_pos": 7, "start_aa": "T", "end_pos": 7, "end_aa": "T", "residue": "Thr", "site_lbl": "Thr7", "evidence": [ { "id": "GLY_001161", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001161" } ], "filter_code": "00000000000000001000.00000000001000.1.01000" } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [ { "id": "R-GGA-446193", "name": "Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-446193", "resource": "Reactome", "description": "Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "dolichol-linked oligosaccharide biosynthetic process", "id": "GO:0006488", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006488", "evidence": [ { "database": "UniProtKB", "id": "A0A1L1RT72", "url": "https://www.uniprot.org/uniprot/A0A1L1RT72" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "hexosyltransferase activity", "id": "GO:0016758", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016758", "evidence": [ { "database": "UniProtKB", "id": "A0A1L1RT72", "url": "https://www.uniprot.org/uniprot/A0A1L1RT72" } ], "pmid": "" }, { "name": "N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase activity", "id": "GO:0004577", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004577", "evidence": [ { "database": "UniProtKB", "id": "A0A1L1RT72", "url": "https://www.uniprot.org/uniprot/A0A1L1RT72" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 208, "end_pos": 210, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-GGA-446207", "name": "ALG13:ALG14 transfers GlcNAc from UDP-GlcNAc to GlcNAcDOLP", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-449293" ], "enzyme_list": [ "A0A1L1RT72-1" ], "evidence": [ { "id": "R-GGA-446207", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-446207" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-449293", "participant_name": "N,N'-DCDOLDP [cytoplasmic side of endoplasmic reticulum membrane]", "crossref": [ { "id": "18341", "database": "ChEBI", "url": "" }, { "id": "C04537", "database": "COMPOUND", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A1L1RT72", "gene_name": "", "activity": [ { "ec_number": "2.4.1.141", "activity": "N-acetyl-alpha-D-glucosaminyl-diphosphodolichol + UDP-N-acetyl-alpha-D-glucosamine = H(+) + N,N'-diacetylchitobiosyl diphosphodolichol + UDP.", "evidence": [ { "id": "A0A1L1RT72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1L1RT72" } ] }, { "ec_number": "2.4.1.141", "activity": "", "evidence": [ { "id": "A0A1L1RT72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1L1RT72" } ] } ] } ], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1L1RT72-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 246, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1L1RT72-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "2.4.1.141", "ec_name": "N-acetyl-alpha-D-glucosaminyl-diphosphodolichol + UDP-N-acetyl-alpha-D-glucosamine = H(+) + N,N'-diacetylchitobiosyl diphosphodolichol + UDP.", "evidence": [ { "id": "2.4.1.141", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:2.4.1.141" }, { "id": "2.4.1.141", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.4.1.141" } ] } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 7 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 208, "end_pos": 210 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }