{ "uniprot_canonical_ac": "A0A1L1RJC1-1", "uniprot_ac": "A0A1L1RJC1", "uniprot_id": "A0A1L1RJC1_CHICK", "mass": { "chemical_mass": 13605.0, "monoisotopic_mass": 13605.0 }, "refseq": { "ac": "XP_004940135", "name": "ly6/PLAUR domain-containing protein 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_004940135" }, "gene_names": [ { "name": "LOC101747868", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1L1RJC1", "id": "A0A1L1RJC1" }, { "name": "LOC101747868", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_004940135", "id": "XP_004940135" } ], "protein_names": [ { "name": "Uncharacterized protein", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1L1RJC1/entry#names_and_taxonomy", "id": "A0A1L1RJC1" }, { "name": "ly6/PLAUR domain-containing protein 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_004940135", "id": "XP_004940135" } ], "function": [ { "annotation": "##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Gallus gallus Annotation Release 106 Annotation Version :: 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_052533.1) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process COMPLETENESS: full length.", "evidence": [ { "database": "RefSeq", "id": "XP_004940135", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_004940135" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1L1RJC1", "url": "https://www.uniprot.org/uniprot/A0A1L1RJC1" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "LOC101747868", "url": "https://www.uniprot.org/uniprot/A0A1L1RJC1", "locus": { "chromosome": "2", "start_pos": 147217761, "end_pos": 147211335, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010007958", "url": "https://www.ensembl.org/id/ENSGALG00010007958" } ] } } ], "crossref": [ { "id": "A0A1L1RJC1", "url": "https://alphafold.ebi.ac.uk/entry/A0A1L1RJC1", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000046632", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000046632", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00117", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00117", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "101747868", "url": "https://www.ncbi.nlm.nih.gov/gene/101747868", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR016054", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016054", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018363", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018363", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045860", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045860", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR051110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR051110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:101747868", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:101747868", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "GEAFRCY", "url": "https://omabrowser.org/oma/group/GEAFRCY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1L1RJC1", "url": "https://www.orthodb.org/?gene=A0A1L1RJC1", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR16983", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16983", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR16983:SF16", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16983:SF16", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00021", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00021", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-163125", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-163125", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-8963889", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_004940135", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_004940135", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1L1RJC1", "url": "https://www.uniprot.org/uniprot/A0A1L1RJC1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1L1RJC1-1", "url": "https://www.uniprot.org/uniprot/A0A1L1RJC1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKMPLVGLLLGLACIELAQSLQCYTCKEPTDISKCRTPTECPPKAKVCTTTLHSVDLGYPFFGNVTVTRSCEEECITYDGIGSNRPTSCCYTDLCSDDTKSSKGERSSSAALGVMAMVFGTLLQGVL", "length": 127, "header": "tr|A0A1L1RJC1-1|A0A1L1RJC1_CHICK Isoform 1 of Uncharacterized protein OS=Gallus gallus OX=9031 GN=LOC101747868 PE=4 SV=1 CANONICAL=A0A1L1RJC1-1" }, "isoforms": [ { "isoform_ac": "A0A1L1RJC1-1", "url": "https://www.uniprot.org/uniprotkb/A0A1L1RJC1/entry#A0A1L1RJC1-1", "sequence": { "sequence": "MKMPLVGLLLGLACIELAQSLQCYTCKEPTDISKCRTPTECPPKAKVCTTTLHSVDLGYPFFGNVTVTRSCEEECITYDGIGSNRPTSCCYTDLCSDDTKSSKGERSSSAALGVMAMVFGTLLQGVL", "length": 127, "header": "tr|A0A1L1RJC1-1|A0A1L1RJC1_CHICK Isoform 1 of Uncharacterized protein OS=Gallus gallus OX=9031 GN=LOC101747868 PE=4 SV=1 CANONICAL=A0A1L1RJC1-1" }, "locus": { "chromosome": "2", "start_pos": 147216408, "end_pos": 147211711, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010018971.1", "url": "https://www.ensembl.org/id/ENSGALT00010018971.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010010520.1", "url": "https://www.ensembl.org/id/ENSGALP00010010520.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "gga:101747868", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:101747868", "resource": "KEGG Pathway" }, { "id": "R-GGA-163125", "name": "Post-translational modification: synthesis of GPI-anchored proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-163125", "resource": "Reactome", "description": "Post-translational modification: synthesis of GPI-anchored proteins" }, { "id": "R-GGA-8963889", "name": "Assembly of active LPL and LIPC lipase complexes", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-8963889", "resource": "Reactome", "description": "Assembly of active LPL and LIPC lipase complexes" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A1L1RJC1", "url": "https://www.uniprot.org/uniprot/A0A1L1RJC1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "cell differentiation", "id": "GO:0030154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030154", "evidence": [ { "database": "UniProtKB", "id": "A0A1L1RJC1", "url": "https://www.uniprot.org/uniprot/A0A1L1RJC1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 64, "end_pos": 66, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1L1RJC1-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 127, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1L1RJC1-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 64, "end_pos": 66 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }