{ "uniprot_canonical_ac": "A0A1D5PWI7-1", "uniprot_ac": "A0A1D5PWI7", "uniprot_id": "A0A1D5PWI7_CHICK", "mass": { "chemical_mass": 23863.0, "monoisotopic_mass": 23863.0 }, "refseq": { "ac": "XP_413991", "name": "DNA replication complex GINS protein PSF3 isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_413991" }, "gene_names": [ { "name": "GINS3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1D5PWI7", "id": "A0A1D5PWI7" }, { "name": "GINS3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_413991", "id": "XP_413991" } ], "protein_names": [ { "name": "DNA replication complex GINS protein PSF3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PWI7/entry#names_and_taxonomy", "id": "A0A1D5PWI7" }, { "name": "DNA replication complex GINS protein PSF3 isoform X1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_413991", "id": "XP_413991" } ], "function": [ { "annotation": "##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Gallus gallus Annotation Release 106 Annotation Version :: 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_052542.1) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process On Nov 16, 2006 this sequence version replaced XP_413991.1. COMPLETENESS: full length.", "evidence": [ { "database": "RefSeq", "id": "XP_413991", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_413991" } ] }, { "annotation": "The GINS complex plays an essential role in the initiation of DNA replication.", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PWI7", "url": "https://www.uniprot.org/uniprot/A0A1D5PWI7#function" }, { "database": "UniProtKB", "id": "RU367161", "url": "https://www.uniprot.org/uniprot/RU367161#function" }, { "database": "UniProtKB", "id": "A0A8V0ZTJ3", "url": "https://www.uniprot.org/uniprot/A0A8V0ZTJ3#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PWI7", "url": "https://www.uniprot.org/uniprot/A0A1D5PWI7" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "GINS3", "url": "https://www.uniprot.org/uniprot/A0A1D5PWI7", "locus": { "chromosome": "11", "start_pos": 362628, "end_pos": 368222, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010023135", "url": "https://www.ensembl.org/id/ENSGALG00010023135" } ] } } ], "crossref": [ { "id": "A0A1D5PWI7", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5PWI7", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000031209", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000031209", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd11713", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11713", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd21693", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd21693", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "415625", "url": "https://www.ncbi.nlm.nih.gov/gene/415625", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR010492", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010492", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR021151", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021151", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036224", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036224", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038437", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038437", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR22768", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22768", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22768:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22768:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF05916", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF05916", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_413991", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_413991", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1D5PWI7", "url": "https://www.uniprot.org/uniprot/A0A1D5PWI7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5PWI7-1", "url": "https://www.uniprot.org/uniprot/A0A1D5PWI7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0ZTJ3", "url": "https://www.uniprot.org/uniprot/A0A8V0ZTJ3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0ZTJ3-1", "url": "https://www.uniprot.org/uniprot/A0A8V0ZTJ3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAEAYFPVGPGLGPEENFLSLDDILMSQEKLPGRAESNLPRLAFALGQGSGAGSGDSIPEGSKLEIPMWLAKGLHDSKRRLISVELPKIYKEAWRTVFSADANVVDLHKMGPYYYGFGSQLLNFDNPENPEIAQCILQTFINRFRRIMDSSQNAYNEDTSSLVARLDELERALFQAGQKGLNDFQCWEKGQASQITVSSLVQNYGKRKFTEMDG", "length": 214, "header": "tr|A0A1D5PWI7-1|A0A1D5PWI7_CHICK Isoform 1 of DNA replication complex GINS protein PSF3 OS=Gallus gallus OX=9031 GN=GINS3 PE=3 SV=1 CANONICAL=A0A1D5PWI7-1" }, "isoforms": [ { "isoform_ac": "A0A1D5PWI7-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PWI7/entry#A0A1D5PWI7-1", "sequence": { "sequence": "MAEAYFPVGPGLGPEENFLSLDDILMSQEKLPGRAESNLPRLAFALGQGSGAGSGDSIPEGSKLEIPMWLAKGLHDSKRRLISVELPKIYKEAWRTVFSADANVVDLHKMGPYYYGFGSQLLNFDNPENPEIAQCILQTFINRFRRIMDSSQNAYNEDTSSLVARLDELERALFQAGQKGLNDFQCWEKGQASQITVSSLVQNYGKRKFTEMDG", "length": 214, "header": "tr|A0A1D5PWI7-1|A0A1D5PWI7_CHICK Isoform 1 of DNA replication complex GINS protein PSF3 OS=Gallus gallus OX=9031 GN=GINS3 PE=3 SV=1 CANONICAL=A0A1D5PWI7-1" }, "locus": { "chromosome": "11", "start_pos": 368200, "end_pos": 365057, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010056386.1", "url": "https://www.ensembl.org/id/ENSGALT00010056386.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010034143.1", "url": "https://www.ensembl.org/id/ENSGALP00010034143.1" } ] } }, { "isoform_ac": "A0A8V0ZTJ3-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PWI7/entry#A0A8V0ZTJ3-1", "sequence": { "sequence": "MAENFLSLDDILMSQEKLPGRAESNLPRLAFALGQGSGAGSGDSIPEGSKLEIPMWLAKGLHDSKRRLISVELPKIYKEAWRTVFSADANVVDLHKMGPYYYGFGSQLLNFDNPENPEIAQCILQTFINRFRRIMDSSQNAYNEDTSSLVARLDELERALFQAGQKGLNDFQCWEKGQASQITVSSLVQNYGKRKFTEMDG", "length": 201, "header": "tr|A0A8V0ZTJ3-1|A0A8V0ZTJ3_CHICK Computationally mapped isoform of DNA replication complex GINS protein PSF3 OS=Gallus gallus OX=9031 GN=GINS3 PE=3 SV=1 CANONICAL=A0A1D5PWI7-1" }, "locus": { "chromosome": "11", "start_pos": 368200, "end_pos": 365057, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010056381.1", "url": "https://www.ensembl.org/id/ENSGALT00010056381.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010034139.1", "url": "https://www.ensembl.org/id/ENSGALP00010034139.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "DNA replication", "id": "GO:0006260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006260", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PWI7", "url": "https://www.uniprot.org/uniprot/A0A1D5PWI7" } ], "pmid": "" }, { "name": "mitotic DNA replication initiation", "id": "GO:1902975", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902975", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PWI7", "url": "https://www.uniprot.org/uniprot/A0A1D5PWI7" } ], "pmid": "" }, { "name": "DNA unwinding involved in DNA replication", "id": "GO:0006268", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006268", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PWI7", "url": "https://www.uniprot.org/uniprot/A0A1D5PWI7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "GINS complex", "id": "GO:0000811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000811", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PWI7", "url": "https://www.uniprot.org/uniprot/A0A1D5PWI7" } ], "pmid": "" }, { "name": "CMG complex", "id": "GO:0071162", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071162", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PWI7", "url": "https://www.uniprot.org/uniprot/A0A1D5PWI7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5PWI7-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 214, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5PWI7-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }