{ "uniprot_canonical_ac": "A0A1D5PSK7-1", "uniprot_ac": "A0A1D5PSK7", "uniprot_id": "A0A1D5PSK7_CHICK", "mass": { "chemical_mass": 12360.0, "monoisotopic_mass": 12360.0 }, "refseq": { "ac": "NP_001264902", "name": "scale keratin-like", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264902" }, "gene_names": [ { "name": "LOC426912", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1D5PSK7", "id": "A0A1D5PSK7" }, { "name": "LOC100857297", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A1D5PSK7", "id": "A0A1D5PSK7" }, { "name": "LOC100859616", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264902", "id": "NP_001264902" } ], "protein_names": [ { "name": "Keratin", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PSK7/entry#names_and_taxonomy", "id": "A0A1D5PSK7" }, { "name": "scale keratin-like", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264902", "id": "NP_001264902" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: BX277226.4, BX277225.3 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN02738215, SAMN02738216 [ECO:0000348] ##Evidence-Data-END## PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JAENSK010000349.1. On Dec 1, 2021 this sequence version replaced NP_001264902.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.", "evidence": [ { "database": "RefSeq", "id": "NP_001264902", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264902" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PSK7", "url": "https://www.uniprot.org/uniprot/A0A1D5PSK7" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "LOC426912", "url": "https://www.uniprot.org/uniprot/A0A1D5PSK7", "locus": { "chromosome": "25", "start_pos": 1436873, "end_pos": 1436125, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010028522", "url": "https://www.ensembl.org/id/ENSGALG00010028522" } ] } } ], "crossref": [ { "id": "100857297", "url": "https://www.ncbi.nlm.nih.gov/gene/100857297", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "100859616", "url": "https://www.ncbi.nlm.nih.gov/gene/100859616", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003461", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003461", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:100859616", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:100859616", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "ALGECWH", "url": "https://omabrowser.org/oma/group/ALGECWH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1D5PSK7", "url": "https://www.orthodb.org/?gene=A0A1D5PSK7", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR31203", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31203", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR31203:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31203:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02422", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02422", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001264902", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264902", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1D5PSK7", "url": "https://www.uniprot.org/uniprot/A0A1D5PSK7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5PSK7-1", "url": "https://www.uniprot.org/uniprot/A0A1D5PSK7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSCYDLCPPKTSVAVPQPIAESCNELCARQCPDSTAFIQPPPVVVTFPGPILSSFPQQAVVGSSGAPAFGGSLGLGGLYGAGATQGSGGLCTFGRPYVSPACSPCPLPRYSRKFWNTCGPC", "length": 121, "header": "tr|A0A1D5PSK7-1|A0A1D5PSK7_CHICK Isoform 1 of Keratin OS=Gallus gallus OX=9031 GN=LOC426912 PE=3 SV=1 CANONICAL=A0A1D5PSK7-1" }, "isoforms": [ { "isoform_ac": "A0A1D5PSK7-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PSK7/entry#A0A1D5PSK7-1", "sequence": { "sequence": "MSCYDLCPPKTSVAVPQPIAESCNELCARQCPDSTAFIQPPPVVVTFPGPILSSFPQQAVVGSSGAPAFGGSLGLGGLYGAGATQGSGGLCTFGRPYVSPACSPCPLPRYSRKFWNTCGPC", "length": 121, "header": "tr|A0A1D5PSK7-1|A0A1D5PSK7_CHICK Isoform 1 of Keratin OS=Gallus gallus OX=9031 GN=LOC426912 PE=3 SV=1 CANONICAL=A0A1D5PSK7-1" }, "locus": { "chromosome": "25", "start_pos": 1444539, "end_pos": 1444177, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010069633.1", "url": "https://www.ensembl.org/id/ENSGALT00010069633.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010042894.1", "url": "https://www.ensembl.org/id/ENSGALP00010042894.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "gga:100859616", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:100859616", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "structural constituent of cytoskeleton", "id": "GO:0005200", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005200", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PSK7", "url": "https://www.uniprot.org/uniprot/A0A1D5PSK7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "intermediate filament", "id": "GO:0005882", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005882", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PSK7", "url": "https://www.uniprot.org/uniprot/A0A1D5PSK7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }