{ "uniprot_canonical_ac": "A0A1D5PSI2-1", "uniprot_ac": "A0A1D5PSI2", "uniprot_id": "A0A1D5PSI2_CHICK", "mass": { "chemical_mass": 58069.0, "monoisotopic_mass": 58069.0 }, "refseq": {}, "gene_names": [ { "name": "IMPDH2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2", "id": "A0A1D5PSI2" }, { "name": "IMPDH", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2", "id": "A0A1D5PSI2" }, { "name": "RCJMB04_1j11", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2", "id": "A0A1D5PSI2" } ], "protein_names": [ { "name": "Inosine-5'-monophosphate dehydrogenase", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PSI2/entry#names_and_taxonomy", "id": "A0A1D5PSI2" }, { "name": "1.1.1.205", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PSI2/entry#names_and_taxonomy", "id": "A0A1D5PSI2" }, { "name": "IMP dehydrogenase", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PSI2/entry#names_and_taxonomy", "id": "A0A1D5PSI2" }, { "name": "IMPDH", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PSI2/entry#names_and_taxonomy", "id": "A0A1D5PSI2" }, { "name": "IMPD", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PSI2/entry#names_and_taxonomy", "id": "A0A1D5PSI2" } ], "function": [ { "annotation": "Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth.", "evidence": [ { "database": "UniProtKB", "id": "Q5F4A4", "url": "https://www.uniprot.org/uniprot/Q5F4A4#function" }, { "database": "HAMAP", "id": "MF_03156", "url": "https://hamap.expasy.org/signature/MF_03156" }, { "database": "UniProtKB", "id": "A0A1D5PSI2", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PSI2", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "IMPDH2", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2", "locus": { "chromosome": "12", "start_pos": 11825667, "end_pos": 11814070, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010020638", "url": "https://www.ensembl.org/id/ENSGALG00010020638" } ] } } ], "crossref": [ { "id": "A0A1D5PSI2", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5PSI2", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000006910", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000006910", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00381", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00381", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd04601", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04601", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "416058", "url": "https://www.ncbi.nlm.nih.gov/gene/416058", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000644", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000644", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001093", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001093", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005990", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005990", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013785", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013785", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015875", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015875", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:416058", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:416058", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "GSHCTTR", "url": "https://omabrowser.org/oma/group/GSHCTTR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1D5PSI2", "url": "https://www.orthodb.org/?gene=A0A1D5PSI2", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11911", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11911", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11911:SF121", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11911:SF121", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00478", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00478", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00571", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00571", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-73817", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-73817", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-9748787", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "11708", "url": "https://www.rhea-db.org/rhea/11708", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A1D5PSI2", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5PSI2-1", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5F4A4", "url": "https://www.uniprot.org/uniprot/Q5F4A4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5F4A4-1", "url": "https://www.uniprot.org/uniprot/Q5F4A4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MADYLISGGTGYVPDDGLTAQQLFSCGDGLTYNDFLILPGYIDFTADQVDLTSALTKRITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPNDRVRDVFEAKARHGFCGIPITDNGKMGGKLVGIISSRDIDFLKESEHDLPLGEIMTKREDLVVAPSGVMLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDSKKQLLCGAAIGTHEDDKYRLDLLVQAGVDAVVLDSSQGNSIFQINMIKYIKEKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEAAPKIPPDLKSHSPKCPSTVTGTYMLACGRPQATAVYKVSEYARRFGVPVIADGGIQTVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKNLGSQNRYFSETDKIKVAQGVSGAVQDKGSIHKFIPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTTSAQVEGGVHGLHSYEKRLF", "length": 538, "header": "tr|A0A1D5PSI2-1|A0A1D5PSI2_CHICK Isoform 1 of Inosine-5'-monophosphate dehydrogenase OS=Gallus gallus OX=9031 GN=IMPDH2 PE=1 SV=1 CANONICAL=A0A1D5PSI2-1" }, "isoforms": [ { "isoform_ac": "A0A1D5PSI2-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PSI2/entry#A0A1D5PSI2-1", "sequence": { "sequence": "MADYLISGGTGYVPDDGLTAQQLFSCGDGLTYNDFLILPGYIDFTADQVDLTSALTKRITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPNDRVRDVFEAKARHGFCGIPITDNGKMGGKLVGIISSRDIDFLKESEHDLPLGEIMTKREDLVVAPSGVMLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDSKKQLLCGAAIGTHEDDKYRLDLLVQAGVDAVVLDSSQGNSIFQINMIKYIKEKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEAAPKIPPDLKSHSPKCPSTVTGTYMLACGRPQATAVYKVSEYARRFGVPVIADGGIQTVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKNLGSQNRYFSETDKIKVAQGVSGAVQDKGSIHKFIPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTTSAQVEGGVHGLHSYEKRLF", "length": 538, "header": "tr|A0A1D5PSI2-1|A0A1D5PSI2_CHICK Isoform 1 of Inosine-5'-monophosphate dehydrogenase OS=Gallus gallus OX=9031 GN=IMPDH2 PE=1 SV=1 CANONICAL=A0A1D5PSI2-1" }, "locus": { "chromosome": "12", "start_pos": 11825421, "end_pos": 11814207, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010049817.1", "url": "https://www.ensembl.org/id/ENSGALT00010049817.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010029434.1", "url": "https://www.ensembl.org/id/ENSGALP00010029434.1" } ] } }, { "isoform_ac": "Q5F4A4-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PSI2/entry#Q5F4A4-1", "sequence": { "sequence": "MADYLISGGTGYVPDDGLTAQQLFSCGDGLTYNDFLILPGYIDFTADQVDLTSALTKRITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPNDRVRDVFEAKARHGFCGIPITDNGKMGGKLVGIISSRDIDFLKESEHDLPLGEIMTKREDLVVAPSGVMLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDSKKQLLCGAAIGTHEDDKYRLDLLVQAGVDAVVLDSSQGNSIFQINMIKYIKEKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQTVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKNLGSQNRYFSETDKIKVAQGVSGAVQDKGSIHKFIPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTTSAQVEGGVHGLHSYEKRLF", "length": 514, "header": "tr|Q5F4A4-1|A0A1D5PSI2_CHICK Computationally mapped isoform of Inosine-5'-monophosphate dehydrogenase OS=Gallus gallus OX=9031 GN=IMPDH2 PE=1 SV=1 CANONICAL=A0A1D5PSI2-1" }, "locus": { "chromosome": "12", "start_pos": 11825421, "end_pos": 11814207, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010049824.1", "url": "https://www.ensembl.org/id/ENSGALT00010049824.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010029437.1", "url": "https://www.ensembl.org/id/ENSGALP00010029437.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Full-length cDNAs from chicken bursal lymphocytes to facilitate gene function analysis.", "journal": "Genome Biol.", "date": "2005", "authors": "Caldwell Randolph B, Kierzek Andrzej M, Arakawa Hiroshi, Bezzubov Yuri, Zaim Jolanta, Fiedler Petra, Kutter Stefan, Blagodatski Artem, Kostovska Diyana, Koter Marek, Plachy Jiri, Carninci Piero, Hayashizaki Yoshihide, Buerstedde Jean-Marie", "evidence": [ { "database": "UniProtKB", "id": "Q5F4A4", "url": "https://www.uniprot.org/uniprot/Q5F4A4" } ], "reference": [ { "type": "PubMed", "id": "15642098", "url": "https://glygen.org/publication/PubMed/15642098" } ] } ], "pathway": [ { "id": "gga:416058", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:416058", "resource": "KEGG Pathway" }, { "id": "R-GGA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-GGA-73817", "name": "Purine ribonucleoside monophosphate biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-73817", "resource": "Reactome", "description": "Purine ribonucleoside monophosphate biosynthesis" }, { "id": "R-GGA-9748787", "name": "Azathioprine ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-9748787", "resource": "Reactome", "description": "Azathioprine ADME" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A287BMK8-1", "protein_name": "Inosine-5'-monophosphate dehydrogenase", "gene_name": "IMPDH2", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKHPFFPLWGFSSSEEPETLCLKATEEDQKYEQGFITDPVVLSPKDRVRDVFEAKAQHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDRFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKEKYPSLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF", "length": 541 }, "evidence": [ { "id": "A0A1D5PSI2", "url": "https://omabrowser.org/oma/group/A0A1D5PSI2/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "E9PU28-1", "protein_name": "Inosine-5'-monophosphate dehydrogenase 2", "gene_name": "Impdh2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDRFLEEIMTKREDLVVAPAGVTLKEANEILQRSKKGKLPIVNESDELVAIIARTDLKKNRDYPLASKDTKKQLLCGAAIGTHEDDKYRLDLLALAGVDVVVLDSSQGNSIFQINMIKYIKEKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHGLHSYEKRLF", "length": 514 }, "evidence": [ { "id": "A0A1D5PSI2", "url": "https://omabrowser.org/oma/group/A0A1D5PSI2/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P12268-1", "protein_name": "Inosine-5'-monophosphate dehydrogenase 2", "gene_name": "IMPDH2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF", "length": 514 }, "evidence": [ { "id": "A0A1D5PSI2", "url": "https://omabrowser.org/oma/group/A0A1D5PSI2/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P24547-1", "protein_name": "Inosine-5'-monophosphate dehydrogenase 2", "gene_name": "Impdh2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDRFLEEIMTKREDLVVAPAGVTLKEANEILQRSKKGKLPIVNENDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLALAGVDVVVLDSSQGNSIFQINMIKYIKEKYPSLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF", "length": 514 }, "evidence": [ { "id": "A0A1D5PSI2", "url": "https://omabrowser.org/oma/group/A0A1D5PSI2/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P38697-1", "protein_name": "Inosine-5'-monophosphate dehydrogenase 2", "gene_name": "IMD2", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MAAIRDYKTALDFTKSLPRPDGLSVQELMDSKIRGGLTYNDFLILPGLVDFASSEVSLQTKLTRNITLNIPLVSSPMDTVTESEMATFMALLGGIGFIHHNCTPEDQADMVRRVKNYENGFINNPIVISPTTTVGEAKSMKEKYGFAGFPVTTDGKRNAKLVGVITSRDIQFVEDNSLLVQDVMTKNPVTGAQGITLSEGNEILKKIKKGRLLVVDEKGNLVSMLSRTDLMKNQNYPLASKSANTKQLLCGASIGTMDADKERLRLLVKAGLDVVILDSSQGNSIFELNMLKWVKESFPGLEVIAGNVVTREQAANLIAAGADGLRIGMGTGSICITQEVMACGRPQGTAVYNVCEFANQFGVPCMADGGVQNIGHITKALALGSSTVMMGGMLAGTTESPGEYFYQDGKRLKAYRGMGSIDAMQKTGTKGNASTSRYFSESDSVLVAQGVSGAVVDKGSIKKFIPYLYNGLQHSCQDIGCRSLTLLKNNVQRGKVRFEFRTASAQLEGGVHNLHSYEKRLHN", "length": 523 }, "evidence": [ { "id": "A0A1D5PSI2", "url": "https://omabrowser.org/oma/group/A0A1D5PSI2/", "database": "OMA" } ], "glygen_name": "Yeast", "common_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q3SWY3-1", "protein_name": "Inosine-5'-monophosphate dehydrogenase 2", "gene_name": "IMPDH2", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPRDRVRDVFEAKARHGFCGIPITDTGRMGSHLVGIISSRDIDFLKEEEHDRLLGEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNENDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLSQAGVDVVVLDSSQGNSIFQINMIKYIKEKYPSIQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF", "length": 514 }, "evidence": [ { "id": "A0A1D5PSI2", "url": "https://omabrowser.org/oma/group/A0A1D5PSI2/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "Q9SA34-1", "protein_name": "Inosine-5'-monophosphate dehydrogenase 2", "gene_name": "", "tax_id": 3702, "organism": "Arabidopsis thaliana", "sequence": { "sequence": "MSGFEDGFSAEKLFSQGYSYTYDDVIFLPHFIDFSTDAVSLSTRLSKRVPLSIPCVASPMDTVSESHMAAAMAALGGIGIVHYNCDIDTQASVIRHAKSLQVPIASDAVFKCPEHQIGSVDDFGPSSFVFVSQTGTLTPKLLGYVSKSEWSSMKDDQKEVKIYDYMKSCENKDYYVPWDIDLDKIEAVLEDKQKGFVVLEKEGETVNVVTKDDVERVKGYPKLGSGTVGADKKWMVGAAIGTRESDKERLEHLVKAGANVVVLDSSQGNSIYQLEMIKYVKNTYPELDVVGGNVVTMYQAENLIKAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSTLAAQHGVPVIADGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGAYEYRNGRRVKKYRGMGSLEAMTKGSDQRYLGDTAKLKIAQGVVGAVADKGSVLKFIPYTMHAVKQGFQDLGASSLQSAHELLRDNTLRLEARTGAAQIEGGIHGLVSYEKKSF", "length": 502 }, "evidence": [ { "id": "A0A1D5PSI2", "url": "https://omabrowser.org/oma/group/A0A1D5PSI2/", "database": "OMA" } ], "glygen_name": "Arabidopsis", "common_name": "Mouse-ear cress" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PSI2", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PSI2", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PSI2", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PSI2", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2" } ], "pmid": "" }, { "name": "nucleotide binding", "id": "GO:0000166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000166", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PSI2", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2" } ], "pmid": "" }, { "name": "IMP dehydrogenase activity", "id": "GO:0003938", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003938", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PSI2", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "GMP biosynthetic process", "id": "GO:0006177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006177", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PSI2", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2" } ], "pmid": "" }, { "name": "circadian rhythm", "id": "GO:0007623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007623", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PSI2", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2" } ], "pmid": "" }, { "name": "cellular response to interleukin-4", "id": "GO:0071353", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071353", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PSI2", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2" } ], "pmid": "" }, { "name": "lymphocyte proliferation", "id": "GO:0046651", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046651", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PSI2", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2" } ], "pmid": "" }, { "name": "GTP biosynthetic process", "id": "GO:0006183", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006183", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PSI2", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2" } ], "pmid": "" }, { "name": "'de novo' XMP biosynthetic process", "id": "GO:0097294", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097294", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PSI2", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 94, "end_pos": 96, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "11708", "name": "", "equation": "H2O + IMP + NAD(+) = H(+) + NADH + XMP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A1D5PSI2-1" ], "evidence": [ { "id": "11708", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/11708" } ] }, { "id": "R-GGA-6798748", "name": "Exocytosis of secretory granule lumen proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, secretory granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A8V0ZAB9-1", "A0A1D5PSI2-1", "A0A8V0ZTG8-1", "O57535-1", "P00548-1", "Q02960-1", "Q90835-1", "A0A8V0X182-1", "A0A8V0XCV1-1", "A0A8V0XXA9-1", "A0A1D5PIQ5-1", "Q02977-1", "Q5ZLN1-1", "A0A8V0YHC8-1", "A0A8V1AIR0-1" ], "evidence": [ { "id": "R-GGA-6798748", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-6798748" } ] }, { "id": "R-GGA-6800434", "name": "Exocytosis of ficolin-rich granule lumen proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, ficolin-1-rich granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A8V0ZAB9-1", "F1NI04-1", "A0A8V1A185-1", "A0A1D5PSE5-1", "A0A1D5PSI2-1", "A0A8V0ZTG8-1", "O57535-1", "P00548-1", "P08267-1", "Q02960-1", "Q90835-1", "A0A8V0X182-1", "A0A8V0XCV1-1", "A0A8V0XXA9-1", "R4GH41-1", "A0A1D5PIQ5-1", "Q05744-1", "Q5ZLN1-1", "A0A8V0YHC8-1", "A0A8V1AIR0-1" ], "evidence": [ { "id": "R-GGA-6800434", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-6800434" } ] }, { "id": "R-GGA-73794", "name": "IMP + H2O + NAD+ => XMP + NADH + H+ [IMPDH1,2]", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A1D5PSI2-1" ], "evidence": [ { "id": "R-GGA-73794", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-73794" } ] }, { "id": "R-GGA-9678749", "name": "IMPDH tetramers binds IMPDH inhibitors", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A1D5PSI2-1" ], "evidence": [ { "id": "R-GGA-9678749", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-9678749" } ] }, { "id": "R-GGA-9748945", "name": "IMPDH tetramers dehydrogenate 6TIMP to 6TXMP", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-9748992" ], "output_participant_list": [ "R-ALL-9748959" ], "enzyme_list": [ "A0A1D5PSI2-1" ], "evidence": [ { "id": "R-GGA-9748945", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-9748945" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-9748959", "participant_name": "6TXMP [cytosol]", "crossref": [ { "id": "180685", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-9748992", "participant_name": "6TIMP [cytosol]", "crossref": [ { "id": "180684", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A1D5PIQ5", "gene_name": "MAPK14", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A1D5PIQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5PIQ5" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "A0A1D5PIQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5PIQ5" } ] } ] }, { "uniprot_ac": "A0A1D5PSE5", "gene_name": "ACLY", "activity": [ { "ec_number": "2.3.3.8", "activity": "acetyl-CoA + ADP + oxaloacetate + phosphate = ATP + citrate + CoA.", "evidence": [ { "id": "A0A1D5PSE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5PSE5" } ] }, { "ec_number": "2.3.3.8", "activity": "", "evidence": [ { "id": "A0A1D5PSE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5PSE5" } ] } ] }, { "uniprot_ac": "A0A1D5PSI2", "gene_name": "IMPDH2", "activity": [ { "ec_number": "1.1.1.205", "activity": "H2O + IMP + NAD(+) = H(+) + NADH + XMP.", "evidence": [ { "id": "A0A1D5PSI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2" } ] }, { "ec_number": "1.1.1.205", "activity": "", "evidence": [ { "id": "A0A1D5PSI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5PSI2" } ] } ] }, { "uniprot_ac": "A0A8V0X182", "gene_name": "GYG1", "activity": [ { "ec_number": "2.4.1.186", "activity": "[1,4-alpha-D-glucosyl](n)-L-tyrosyl-[glycogenin] + UDP-alpha-D-glucose = [1,4-alpha-D-glucosyl](n+1)-L-tyrosyl-[glycogenin] + H(+) + UDP.", "evidence": [ { "id": "A0A8V0X182", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0X182" } ] }, { "ec_number": "2.4.1.186", "activity": "", "evidence": [ { "id": "A0A8V0X182", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0X182" } ] } ] }, { "uniprot_ac": "A0A8V0XCV1", "gene_name": "PRDX4", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "A0A8V0XCV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0XCV1" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "A0A8V0XCV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0XCV1" } ] } ] }, { "uniprot_ac": "A0A8V0XXA9", "gene_name": "GPI", "activity": [ { "ec_number": "5.3.1.9", "activity": "alpha-D-glucose 6-phosphate = beta-D-fructose 6-phosphate.", "evidence": [ { "id": "A0A8V0XXA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0XXA9" } ] }, { "ec_number": "5.3.1.9", "activity": "", "evidence": [ { "id": "A0A8V0XXA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0XXA9" } ] } ] }, { "uniprot_ac": "A0A8V0YHC8", "gene_name": "VCP", "activity": [ { "ec_number": "3.6.4.6", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "A0A8V0YHC8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0YHC8" } ] }, { "ec_number": "3.6.4.6", "activity": "", "evidence": [ { "id": "A0A8V0YHC8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0YHC8" } ] } ] }, { "uniprot_ac": "A0A8V0ZAB9", "gene_name": "AMPD3", "activity": [ { "ec_number": "3.5.4.6", "activity": "AMP + H(+) + H2O = IMP + NH4(+).", "evidence": [ { "id": "A0A8V0ZAB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZAB9" } ] }, { "ec_number": "3.5.4.6", "activity": "", "evidence": [ { "id": "A0A8V0ZAB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZAB9" } ] } ] }, { "uniprot_ac": "A0A8V0ZTG8", "gene_name": "PFKL", "activity": [ { "ec_number": "2.7.1.11", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 1,6-bisphosphate + H(+).", "evidence": [ { "id": "A0A8V0ZTG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZTG8" } ] }, { "ec_number": "2.7.1.11", "activity": "", "evidence": [ { "id": "A0A8V0ZTG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZTG8" } ] } ] }, { "uniprot_ac": "A0A8V1A185", "gene_name": "PGM1", "activity": [ { "ec_number": "5.4.2.2", "activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.", "evidence": [ { "id": "A0A8V1A185", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V1A185" } ] }, { "ec_number": "5.4.2.2", "activity": "", "evidence": [ { "id": "A0A8V1A185", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V1A185" } ] } ] }, { "uniprot_ac": "A0A8V1AIR0", "gene_name": "ALDOC", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "A0A8V1AIR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V1AIR0" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "A0A8V1AIR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V1AIR0" } ] } ] }, { "uniprot_ac": "F1NI04", "gene_name": "GNS", "activity": [ { "ec_number": "3.1.6.14", "activity": "Hydrolysis of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate.", "evidence": [ { "id": "F1NI04", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1NI04" } ] }, { "ec_number": "3.1.6.14", "activity": "", "evidence": [ { "id": "F1NI04", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1NI04" } ] } ] }, { "uniprot_ac": "O57535", "gene_name": "", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "O57535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O57535" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "O57535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O57535" } ] } ] }, { "uniprot_ac": "P00548", "gene_name": "PKM", "activity": [ { "ec_number": "2.7.1.40", "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.", "evidence": [ { "id": "P00548", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00548" } ] }, { "ec_number": "2.7.1.40", "activity": "", "evidence": [ { "id": "P00548", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00548" } ] } ] }, { "uniprot_ac": "P08267", "gene_name": "FTH", "activity": [ { "ec_number": "1.16.3.1", "activity": "4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O.", "evidence": [ { "id": "P08267", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08267" } ] }, { "ec_number": "1.16.3.1", "activity": "", "evidence": [ { "id": "P08267", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08267" } ] } ] }, { "uniprot_ac": "Q02960", "gene_name": "MIF", "activity": [ { "ec_number": "5.3.2.1", "activity": "3-phenylpyruvate = enol-phenylpyruvate.", "evidence": [ { "id": "Q02960", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02960" } ] }, { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "Q02960", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02960" } ] }, { "ec_number": "5.3.2.1", "activity": "", "evidence": [ { "id": "Q02960", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02960" } ] } ] }, { "uniprot_ac": "Q02977", "gene_name": "YRK", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q02977", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02977" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "Q02977", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02977" } ] } ] }, { "uniprot_ac": "Q05744", "gene_name": "CTSD", "activity": [ { "ec_number": "3.4.23.5", "activity": "Specificity similar to, but narrower than, that of pepsin A. Does not cleave the 4-Gln-|-His-5 bond in B chain of insulin.", "evidence": [ { "id": "Q05744", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05744" } ] }, { "ec_number": "3.4.23.5", "activity": "", "evidence": [ { "id": "Q05744", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05744" } ] } ] }, { "uniprot_ac": "Q5ZLN1", "gene_name": "PGAM1", "activity": [ { "ec_number": "5.4.2.11", "activity": "(2R)-2-phosphoglycerate = (2R)-3-phosphoglycerate.", "evidence": [ { "id": "Q5ZLN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5ZLN1" } ] }, { "ec_number": "5.4.2.4", "activity": "(2R)-3-phospho-glyceroyl phosphate = (2R)-2,3-bisphosphoglycerate + H(+).", "evidence": [ { "id": "Q5ZLN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5ZLN1" } ] }, { "ec_number": "5.4.2.11", "activity": "", "evidence": [ { "id": "Q5ZLN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5ZLN1" } ] }, { "ec_number": "5.4.2.4", "activity": "", "evidence": [ { "id": "Q5ZLN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5ZLN1" } ] } ] }, { "uniprot_ac": "Q90835", "gene_name": "EEF1A", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q90835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q90835" } ] } ] }, { "uniprot_ac": "R4GH41", "gene_name": "ASAH1", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "R4GH41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/R4GH41" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "R4GH41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/R4GH41" } ] } ] } ], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5PSI2-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 538, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5PSI2-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "1.1.1.205", "ec_name": "H2O + IMP + NAD(+) = H(+) + NADH + XMP.", "evidence": [ { "id": "1.1.1.205", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:1.1.1.205" }, { "id": "1.1.1.205", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.1.1.205" } ] } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 94, "end_pos": 96 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }