{ "uniprot_canonical_ac": "A0A1D5PJB7-1", "uniprot_ac": "A0A1D5PJB7", "uniprot_id": "KPTN_CHICK", "mass": { "chemical_mass": 46980.0, "monoisotopic_mass": 46980.0 }, "refseq": { "ac": "XP_015127970", "name": "KICSTOR complex protein kaptin isoform X5", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_015127970" }, "gene_names": [ { "name": "KPTN", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7", "id": "A0A1D5PJB7" }, { "name": "KPTN", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_015127970", "id": "XP_015127970" } ], "protein_names": [ { "name": "KICSTOR complex protein kaptin", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PJB7/entry#names_and_taxonomy", "id": "A0A1D5PJB7" }, { "name": "Actin-associated protein 2E4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PJB7/entry#names_and_taxonomy", "id": "A0A1D5PJB7" }, { "name": "KICSTOR complex protein kaptin isoform X5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_015127970", "id": "XP_015127970" } ], "function": [ { "annotation": "##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Gallus gallus Annotation Release 106 Annotation Version :: 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_052569.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Apr 10, 2021 this sequence version replaced XP_015127970.2. COMPLETENESS: full length.", "evidence": [ { "database": "RefSeq", "id": "XP_015127970", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_015127970" } ] }, { "annotation": "As part of the KICSTOR complex may function in the amino acid-sensing branch of the TORC1 signaling pathway.", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PJB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7#function" }, { "database": "UniProtKB", "id": "Q9Y664", "url": "https://www.uniprot.org/uniprot/Q9Y664#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PJB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "KPTN", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7", "locus": { "chromosome": "38", "start_pos": 182692, "end_pos": 189614, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010010774", "url": "https://www.ensembl.org/id/ENSGALG00010010774" } ] } } ], "crossref": [ { "id": "A0A1D5PJB7", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5PJB7", "database": "AlphaFoldDB", "categories": [] }, { "id": "101752009", "url": "https://www.ncbi.nlm.nih.gov/gene/101752009", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR029982", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029982", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:101752009", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:101752009", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PTHR15435", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15435", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15435:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15435:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A1D5PJB7", "url": "http://purl.obolibrary.org/obo/PR_A0A1D5PJB7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "XP_015127970", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_015127970", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1D5PJB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5PJB7-1", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGPCPLVEDSCSRLPSQSNVYGLAALPGAGGLLAATLKGKVLHFRYQHLRHKLRPVARELQFTYIPVDAEIVSIGCFQKSAPKRGLVVGITFIKDSGDKPSPFLNIYCDYEPGCEFDLDSVAQSCLNLELRFTPLQLCHAEVHIGDRCDTVFLLSGTDPGIHLYRENEGLHQFEEQPLHELFPELQELPSSALWLDVCTVPSSRRRLTAVGCQSGYVRVAHVDQDTRAVLQSWSIQQDGPISTVLLFPLEEPDDDGDVAGGHRGADDVGPSAPGPEPTPHYSLLVASTIEMSVVYRDVLSRGLTEQLSLPGSDHHDAVLCAMLACTALDGGREVLLGTYGQELLCYAYRGRRCGFQLLWTRRFPGPVLALCGADLTGDGLREVAVGCLQGLHVLQHSLEPTAQRLKERLRREVARRAQQRGGEGTGTPK", "length": 430, "header": "sp|A0A1D5PJB7-1|KPTN_CHICK Isoform 1 of KICSTOR complex protein kaptin OS=Gallus gallus OX=9031 GN=KPTN PE=3 SV=1 CANONICAL=A0A1D5PJB7-1" }, "isoforms": [ { "isoform_ac": "A0A1D5PJB7-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PJB7/entry#A0A1D5PJB7-1", "sequence": { "sequence": "MAGPCPLVEDSCSRLPSQSNVYGLAALPGAGGLLAATLKGKVLHFRYQHLRHKLRPVARELQFTYIPVDAEIVSIGCFQKSAPKRGLVVGITFIKDSGDKPSPFLNIYCDYEPGCEFDLDSVAQSCLNLELRFTPLQLCHAEVHIGDRCDTVFLLSGTDPGIHLYRENEGLHQFEEQPLHELFPELQELPSSALWLDVCTVPSSRRRLTAVGCQSGYVRVAHVDQDTRAVLQSWSIQQDGPISTVLLFPLEEPDDDGDVAGGHRGADDVGPSAPGPEPTPHYSLLVASTIEMSVVYRDVLSRGLTEQLSLPGSDHHDAVLCAMLACTALDGGREVLLGTYGQELLCYAYRGRRCGFQLLWTRRFPGPVLALCGADLTGDGLREVAVGCLQGLHVLQHSLEPTAQRLKERLRREVARRAQQRGGEGTGTPK", "length": 430, "header": "sp|A0A1D5PJB7-1|KPTN_CHICK Isoform 1 of KICSTOR complex protein kaptin OS=Gallus gallus OX=9031 GN=KPTN PE=3 SV=1 CANONICAL=A0A1D5PJB7-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool": "isoglyp", "mining_tool": "", "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "start_pos": 279, "start_aa": "T", "end_pos": 279, "end_aa": "T", "residue": "Thr", "site_lbl": "Thr279", "evidence": [ { "id": "GLY_001161", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001161" } ], "filter_code": "00000000000000001000.00000000001000.1.01000" } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "2E4 (kaptin): a novel actin-associated protein from human blood platelets found in lamellipodia and the tips of the stereocilia of the inner ear.", "journal": "Eur. J. Cell Biol.", "date": "1999", "authors": "Bearer EL, Abraham MT", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PJB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7" } ], "reference": [ { "type": "PubMed", "id": "10099934", "url": "https://glygen.org/publication/PubMed/10099934" } ] }, { "title": "2E4/Kaptin (KPTN) - a candidate gene for the hearing loss loci, DFNA4.", "journal": "Ann. Hum. Genet.", "date": "2000", "authors": "Bearer EL, Chen AF, Chen AH, Li Z, Mark HF, Smith RJ, Jackson CL", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PJB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7" } ], "reference": [ { "type": "PubMed", "id": "11409409", "url": "https://glygen.org/publication/PubMed/11409409" } ] }, { "title": "Sequence and comparative analysis of the chicken genome provide unique perspectives on vertebrate evolution.", "journal": "Nature", "date": "2004", "authors": "", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PJB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7" } ], "reference": [ { "type": "PubMed", "id": "15592404", "url": "https://glygen.org/publication/PubMed/15592404" } ] } ], "pathway": [ { "id": "gga:101752009", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:101752009", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "KICSTOR complex", "id": "GO:0140007", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140007", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PJB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7" } ], "pmid": "" }, { "name": "actin cytoskeleton", "id": "GO:0015629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015629", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PJB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7" } ], "pmid": "" }, { "name": "lamellipodium", "id": "GO:0030027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030027", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PJB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7" } ], "pmid": "" }, { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PJB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7" } ], "pmid": "" }, { "name": "stereocilium", "id": "GO:0032420", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032420", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PJB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "actin filament organization", "id": "GO:0007015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007015", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PJB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7" } ], "pmid": "" }, { "name": "cellular response to glucose starvation", "id": "GO:0042149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042149", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PJB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7" } ], "pmid": "" }, { "name": "cellular response to amino acid starvation", "id": "GO:0034198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034198", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PJB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7" } ], "pmid": "" }, { "name": "negative regulation of TORC1 signaling", "id": "GO:1904262", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904262", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PJB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7" } ], "pmid": "" }, { "name": "protein localization to lysosome", "id": "GO:0061462", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061462", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PJB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "actin filament binding", "id": "GO:0051015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051015", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PJB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PJB7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5PJB7-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 430, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5PJB7-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 279 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }