{ "uniprot_canonical_ac": "A0A1D5PI06-1", "uniprot_ac": "A0A1D5PI06", "uniprot_id": "A0A1D5PI06_CHICK", "mass": { "chemical_mass": 26893.0, "monoisotopic_mass": 26893.0 }, "refseq": { "ac": "XP_424129", "name": "NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_424129" }, "gene_names": [ { "name": "NDUFV2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1D5PI06", "id": "A0A1D5PI06" }, { "name": "NDUFV2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_424129", "id": "XP_424129" } ], "protein_names": [ { "name": "NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PI06/entry#names_and_taxonomy", "id": "A0A1D5PI06" }, { "name": "NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial isoform X1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_424129", "id": "XP_424129" }, { "name": "NADH-ubiquinone oxidoreductase 24 kDa subunit", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PI06/entry#names_and_taxonomy", "id": "A0A1D5PI06" } ], "function": [ { "annotation": "##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Gallus gallus Annotation Release 106 Annotation Version :: 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_052533.1) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process On Jan 4, 2016 this sequence version replaced XP_424129.3. COMPLETENESS: full length.", "evidence": [ { "database": "RefSeq", "id": "XP_424129", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_424129" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PI06", "url": "https://www.uniprot.org/uniprot/A0A1D5PI06" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "NDUFV2", "url": "https://www.uniprot.org/uniprot/A0A1D5PI06", "locus": { "chromosome": "2", "start_pos": 98269744, "end_pos": 98284832, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010001849", "url": "https://www.ensembl.org/id/ENSGALG00010001849" } ] } } ], "crossref": [ { "id": "A0A1D5PI06", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5PI06", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000036625", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000036625", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03064", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03064", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "426488", "url": "https://www.ncbi.nlm.nih.gov/gene/426488", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002023", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002023", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036249", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036249", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041921", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041921", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042128", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042128", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:426488", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:426488", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "IMSIYPE", "url": "https://omabrowser.org/oma/group/IMSIYPE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR10371", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10371", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10371:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10371:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01257", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01257", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-611105", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-6799198", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-6799198", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_424129", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_424129", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "29091", "url": "https://www.rhea-db.org/rhea/29091", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A1D5PI06", "url": "https://www.uniprot.org/uniprot/A0A1D5PI06", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5PI06-1", "url": "https://www.uniprot.org/uniprot/A0A1D5PI06-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MFLRAALRAAASGSVRQIRYLHKTPACSSSGGALFVHRDSPENNPDTPFEFTPENKKRIEAIISNYPGGHKSAAVMAVLDLAQRQHGWLPISAMNKVAEILEMPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRDSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTPKDIEDIIDELKAGKVPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVRADL", "length": 245, "header": "tr|A0A1D5PI06-1|A0A1D5PI06_CHICK Isoform 1 of NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Gallus gallus OX=9031 GN=NDUFV2 PE=1 SV=1 CANONICAL=A0A1D5PI06-1" }, "isoforms": [ { "isoform_ac": "A0A1D5PI06-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PI06/entry#A0A1D5PI06-1", "sequence": { "sequence": "MFLRAALRAAASGSVRQIRYLHKTPACSSSGGALFVHRDSPENNPDTPFEFTPENKKRIEAIISNYPGGHKSAAVMAVLDLAQRQHGWLPISAMNKVAEILEMPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRDSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTPKDIEDIIDELKAGKVPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVRADL", "length": 245, "header": "tr|A0A1D5PI06-1|A0A1D5PI06_CHICK Isoform 1 of NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Gallus gallus OX=9031 GN=NDUFV2 PE=1 SV=1 CANONICAL=A0A1D5PI06-1" }, "locus": { "chromosome": "2", "start_pos": 98284764, "end_pos": 98271019, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010004200.1", "url": "https://www.ensembl.org/id/ENSGALT00010004200.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010002497.1", "url": "https://www.ensembl.org/id/ENSGALP00010002497.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "gga:426488", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:426488", "resource": "KEGG Pathway" }, { "id": "R-GGA-611105", "name": "Respiratory electron transport", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-611105", "resource": "Reactome", "description": "Respiratory electron transport" }, { "id": "R-GGA-6799198", "name": "Complex I biogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-6799198", "resource": "Reactome", "description": "Complex I biogenesis" } ], "orthologs": [ { "uniprot_canonical_ac": "O22769-1", "protein_name": "NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial", "gene_name": "", "tax_id": 3702, "organism": "Arabidopsis thaliana", "sequence": { "sequence": "MLARLAAKRLLEIRQVFRQPTSQVTRSLSTALNYHLDSPDNKPDLPWEFSEANQSKVKEILSYYPSNYKQSAVIPLLDLAQQQNGGWLPVSAMNAVAKVIEVAPIRVYEVATFYSMFNRAKVGKYHLLVCGTTPCMIRGSRDIESALLDHLGVKRGEVTKDGLFSVGEMECMGCCVNAPMITVADYSNGSEGYTYNYFEDVTPEKVVEIVEKLRKGEKPPHGTQNPKRIKCGPEGGNKTLLGEPKPPQFRDLDAC", "length": 255 }, "evidence": [ { "id": "A0A1D5PI06", "url": "https://omabrowser.org/oma/group/A0A1D5PI06/", "database": "OMA" } ], "glygen_name": "Arabidopsis", "common_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P04394-1", "protein_name": "NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial", "gene_name": "NDUFV2", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MFLSAALRARAAGLAAHWGKHIRNLHKTAVQNGAGGALFVHRDTPENNPETPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEILQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTPKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL", "length": 249 }, "evidence": [ { "id": "A0A1D5PI06", "url": "https://omabrowser.org/oma/group/A0A1D5PI06/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "P19234-1", "protein_name": "NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial", "gene_name": "Ndufv2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MFSLALRARASGLTAQWGRHARNLHKTAVQNGAGGALFVHRDTPENNPDTPFDFTPENYERIEAIVRNYPEGHRAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDDYYEDLTPKDIEEIIDELRAGKVPKPGPRSGRFCCEPAGGLTSLTEPPKGPGFGVQAGL", "length": 248 }, "evidence": [ { "id": "A0A1D5PI06", "url": "https://omabrowser.org/oma/group/A0A1D5PI06/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P19404-1", "protein_name": "NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial", "gene_name": "NDUFV2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MFFSAALRARAAGLTAHWGRHVRNLHKTVMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL", "length": 249 }, "evidence": [ { "id": "A0A1D5PI06", "url": "https://omabrowser.org/oma/group/A0A1D5PI06/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q9D6J6-1", "protein_name": "NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial", "gene_name": "Ndufv2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MFSLALRARATGLAAQWGRHARNLHKTAVHNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHQAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTSLTEPPKGPGFGVQAGL", "length": 248 }, "evidence": [ { "id": "A0A1D5PI06", "url": "https://omabrowser.org/oma/group/A0A1D5PI06/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VX36-1", "protein_name": "NADH dehydrogenase (Ubiquinone) 24 kDa subunit, isoform A", "gene_name": "ND-24", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MLTNCASKTLAAVRANIRAIATSSARASDNLFVHRDTPEDNPNIPFEFTAENKKRVEAILSIYPEGHKRGAMIPLLDLAQRQYGWLPISAMHKVAEILQLPNMRVYEVATFYTMFMRKPTGKYHIQVCTTTPCWLRGSDDILETCKKQLGIGVGDTTKDRKFTISEVECLGACVNAPMVAINDDYYEDLTSKDMQDILNDLKADKISPPGPRNGRFASEPKGEPTSLSEEPKGPGFGLQAGL", "length": 242 }, "evidence": [ { "id": "A0A1D5PI06", "url": "https://omabrowser.org/oma/group/A0A1D5PI06/", "database": "OMA" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "nervous system development", "id": "GO:0007399", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007399", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PI06", "url": "https://www.uniprot.org/uniprot/A0A1D5PI06" } ], "pmid": "" }, { "name": "cardiac muscle tissue development", "id": "GO:0048738", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048738", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PI06", "url": "https://www.uniprot.org/uniprot/A0A1D5PI06" } ], "pmid": "" }, { "name": "mitochondrial electron transport, NADH to ubiquinone", "id": "GO:0006120", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006120", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PI06", "url": "https://www.uniprot.org/uniprot/A0A1D5PI06" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PI06", "url": "https://www.uniprot.org/uniprot/A0A1D5PI06" } ], "pmid": "" }, { "name": "2 iron, 2 sulfur cluster binding", "id": "GO:0051537", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051537", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PI06", "url": "https://www.uniprot.org/uniprot/A0A1D5PI06" } ], "pmid": "" }, { "name": "NADH dehydrogenase (ubiquinone) activity", "id": "GO:0008137", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008137", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PI06", "url": "https://www.uniprot.org/uniprot/A0A1D5PI06" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "mitochondrial respiratory chain complex I", "id": "GO:0005747", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005747", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PI06", "url": "https://www.uniprot.org/uniprot/A0A1D5PI06" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "29091", "name": "", "equation": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P18936-1", "P18938-1", "P18940-1", "P18937-1", "P18939-1", "P18941-1", "P18942-1", "A0A8V0ZN13-1", "Q85A52-1", "Q85BF7-1" ], "evidence": [ { "id": "29091", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/29091" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A8V0ZN13", "gene_name": "NDUFV1", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "A0A8V0ZN13", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZN13" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "A0A8V0ZN13", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZN13" } ] } ] }, { "uniprot_ac": "P18936", "gene_name": "MT-ND1", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18936", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18936" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18936", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18936" } ] } ] }, { "uniprot_ac": "P18937", "gene_name": "MT-ND2", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18937", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18937" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18937", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18937" } ] } ] }, { "uniprot_ac": "P18938", "gene_name": "MT-ND3", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18938", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18938" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18938", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18938" } ] } ] }, { "uniprot_ac": "P18939", "gene_name": "MT-ND4", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18939", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18939" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18939", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18939" } ] } ] }, { "uniprot_ac": "P18940", "gene_name": "MT-ND5", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18940", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18940" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18940", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18940" } ] } ] }, { "uniprot_ac": "P18941", "gene_name": "MT-ND6", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18941", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18941" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18941", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18941" } ] } ] }, { "uniprot_ac": "P18942", "gene_name": "MT-ND4L", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18942" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18942" } ] } ] }, { "uniprot_ac": "Q85A52", "gene_name": "ND5", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q85A52", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q85A52" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q85A52", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q85A52" } ] } ] }, { "uniprot_ac": "Q85BF7", "gene_name": "ND2", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q85BF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q85BF7" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q85BF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q85BF7" } ] } ] } ], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5PI06-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 245, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5PI06-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }