{ "uniprot_canonical_ac": "A0A1D5PHF8-1", "uniprot_ac": "A0A1D5PHF8", "uniprot_id": "A0A1D5PHF8_CHICK", "mass": { "chemical_mass": 18843.0, "monoisotopic_mass": 18843.0 }, "refseq": { "ac": "NP_001264586", "name": "calcium channel flower homolog", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264586" }, "gene_names": [ { "name": "CACFD1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1D5PHF8", "id": "A0A1D5PHF8" }, { "name": "C17H9ORF7; C9orf7; D9S2135; FLOWER", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264586", "id": "NP_001264586" }, { "name": "CACFD1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264586", "id": "NP_001264586" } ], "protein_names": [ { "name": "Calcium channel flower domain containing 1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PHF8/entry#names_and_taxonomy", "id": "A0A1D5PHF8" }, { "name": "calcium channel flower domain-containing protein 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264586", "id": "NP_001264586" }, { "name": "calcium channel flower homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264586", "id": "NP_001264586" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: SRR13267655.161702.1, HAEL01009463.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992323 [ECO:0000348] ##Evidence-Data-END## PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JAENSK010000308.1. On Apr 13, 2013 this sequence version replaced XP_415434.3.", "evidence": [ { "database": "RefSeq", "id": "NP_001264586", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264586" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PHF8", "url": "https://www.uniprot.org/uniprot/A0A1D5PHF8" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "CACFD1", "url": "https://www.uniprot.org/uniprot/A0A1D5PHF8", "locus": { "chromosome": "17", "start_pos": 7543149, "end_pos": 7533627, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010028870", "url": "https://www.ensembl.org/id/ENSGALG00010028870" } ] } } ], "crossref": [ { "id": "A0A1D5PHF8", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5PHF8", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000034132", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000034132", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "417151", "url": "https://www.ncbi.nlm.nih.gov/gene/417151", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR019365", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019365", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:417151", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:417151", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WYRWICK", "url": "https://omabrowser.org/oma/group/WYRWICK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1D5PHF8", "url": "https://www.orthodb.org/?gene=A0A1D5PHF8", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13314", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13314", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13314:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13314:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF10233", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF10233", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001264586", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264586", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1D5PHF8", "url": "https://www.uniprot.org/uniprot/A0A1D5PHF8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5PHF8-1", "url": "https://www.uniprot.org/uniprot/A0A1D5PHF8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSQDEQFQAAAPESASSSADDGMTWWYRWLCRIAGVIGGVSCAVAGLWNCVTINPLNIAAGVWMMLNAFVLFLCEAPFCCQFIEFANAVSARADKLRAWQKAAFYCGMAVFPVMLSLTLTTLFGNAIAFATGVLYGLSALGKKGDAISYARIHQQQKQMDEEKLTGCLEGQAL", "length": 174, "header": "tr|A0A1D5PHF8-1|A0A1D5PHF8_CHICK Isoform 1 of Calcium channel flower domain containing 1 OS=Gallus gallus OX=9031 GN=CACFD1 PE=3 SV=1 CANONICAL=A0A1D5PHF8-1" }, "isoforms": [ { "isoform_ac": "A0A1D5PHF8-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PHF8/entry#A0A1D5PHF8-1", "sequence": { "sequence": "MSSQDEQFQAAAPESASSSADDGMTWWYRWLCRIAGVIGGVSCAVAGLWNCVTINPLNIAAGVWMMLNAFVLFLCEAPFCCQFIEFANAVSARADKLRAWQKAAFYCGMAVFPVMLSLTLTTLFGNAIAFATGVLYGLSALGKKGDAISYARIHQQQKQMDEEKLTGCLEGQAL", "length": 174, "header": "tr|A0A1D5PHF8-1|A0A1D5PHF8_CHICK Isoform 1 of Calcium channel flower domain containing 1 OS=Gallus gallus OX=9031 GN=CACFD1 PE=3 SV=1 CANONICAL=A0A1D5PHF8-1" }, "locus": { "chromosome": "17", "start_pos": 7538940, "end_pos": 7533895, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010069832.1", "url": "https://www.ensembl.org/id/ENSGALT00010069832.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010042958.1", "url": "https://www.ensembl.org/id/ENSGALP00010042958.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "gga:417151", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:417151", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8BG21-1", "protein_name": "Calcium channel flower homolog", "gene_name": "Cacfd1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSGSGAAGAAAGPAPPAQEEGMTWWYRWLCRLAGVLGAVSCAISGLFNCVTIHPLNIAAGVWMIMNAFILLLCEAPFCCQFVEFANTVAEKVDRLRSWQKAVFYCGMAIVPIVMSLTLTTLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETFEGEL", "length": 171 }, "evidence": [ { "id": "A0A1D5PHF8", "url": "https://omabrowser.org/oma/group/A0A1D5PHF8/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q95T12-1", "protein_name": "Calcium channel flower", "gene_name": "fwe", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSFAEKITGLLARPNQQDPIGPEQPWYLKYGSRLLGIVAAFFAILFGLWNVFSIITLSVSCLVAGILQMVAGFVVMLLEAPCCFVCFGQVNEIAEKVESKPLYFRAGLYIAMAIPPIILCFGLASLFGSGLIFGTGVVYGMMALGKKASAEDMRAAAQQTFGGNTPAQTNDRAGIVNNAQPFSFTGAVGTDSNV", "length": 194 }, "evidence": [ { "id": "A0A1D5PHF8", "url": "https://omabrowser.org/oma/group/A0A1D5PHF8/", "database": "OMA" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PHF8", "url": "https://www.uniprot.org/uniprot/A0A1D5PHF8" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "vesicle-mediated transport", "id": "GO:0016192", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016192", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PHF8", "url": "https://www.uniprot.org/uniprot/A0A1D5PHF8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5PHF8-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 174, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5PHF8-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }