{ "uniprot_canonical_ac": "A0A1D5PE06-1", "uniprot_ac": "A0A1D5PE06", "uniprot_id": "A0A1D5PE06_CHICK", "mass": { "chemical_mass": 24671.0, "monoisotopic_mass": 24671.0 }, "refseq": {}, "gene_names": [ { "name": "HOXB7", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1D5PE06", "id": "A0A1D5PE06" } ], "protein_names": [ { "name": "Homeobox B7", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PE06/entry#names_and_taxonomy", "id": "A0A1D5PE06" } ], "function": [ { "annotation": "Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PE06", "url": "https://www.uniprot.org/uniprot/A0A1D5PE06#function" }, { "database": "UniProtKB", "id": "ARBA00003263", "url": "https://www.uniprot.org/uniprot/ARBA00003263#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PE06", "url": "https://www.uniprot.org/uniprot/A0A1D5PE06" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "HOXB7", "url": "https://www.uniprot.org/uniprot/A0A1D5PE06", "locus": { "chromosome": "27", "start_pos": 3410997, "end_pos": 3405939, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010023381", "url": "https://www.ensembl.org/id/ENSGALG00010023381" } ] } } ], "crossref": [ { "id": "A0A1D5PE06", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5PE06", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000032740", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000032740", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00086", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00086", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR001356", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001356", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001827", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001827", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017970", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017970", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017995", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017995", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020479", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020479", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050948", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050948", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:425962", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:425962", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "QNCNKTD", "url": "https://omabrowser.org/oma/group/QNCNKTD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1D5PE06", "url": "https://www.orthodb.org/?gene=A0A1D5PE06", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46166", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46166", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46166:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46166:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00046", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00046", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_015154928", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_015154928", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1D5PE06", "url": "https://www.uniprot.org/uniprot/A0A1D5PE06", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5PE06-1", "url": "https://www.uniprot.org/uniprot/A0A1D5PE06-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSLYYANALFSKYQAASSVFPSGVFPEQTSCAFASNTQRAGYGAGSTPPFASSMPGLYSSGSAVHPQPPGMYSSGYGLEPGSFNMHCSPFEQNLSMMCPGDASKQNCNKTDQRDSDLQSDSNFRIYPWMRSTGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTACSGSSSQEKADVEDDEEE", "length": 217, "header": "tr|A0A1D5PE06-1|A0A1D5PE06_CHICK Isoform 1 of Homeobox B7 OS=Gallus gallus OX=9031 GN=HOXB7 PE=3 SV=1 CANONICAL=A0A1D5PE06-1" }, "isoforms": [ { "isoform_ac": "A0A1D5PE06-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PE06/entry#A0A1D5PE06-1", "sequence": { "sequence": "MSSLYYANALFSKYQAASSVFPSGVFPEQTSCAFASNTQRAGYGAGSTPPFASSMPGLYSSGSAVHPQPPGMYSSGYGLEPGSFNMHCSPFEQNLSMMCPGDASKQNCNKTDQRDSDLQSDSNFRIYPWMRSTGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTACSGSSSQEKADVEDDEEE", "length": 217, "header": "tr|A0A1D5PE06-1|A0A1D5PE06_CHICK Isoform 1 of Homeobox B7 OS=Gallus gallus OX=9031 GN=HOXB7 PE=3 SV=1 CANONICAL=A0A1D5PE06-1" }, "locus": { "chromosome": "27", "start_pos": 3410291, "end_pos": 3407029, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010056984.1", "url": "https://www.ensembl.org/id/ENSGALT00010056984.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010034652.1", "url": "https://www.ensembl.org/id/ENSGALP00010034652.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "gga:425962", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:425962", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "F1N1K1-1", "protein_name": "Homeobox protein Hox-B7", "gene_name": "HOXB7", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MSSLYYANALFSKYPAASSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTSGPGAASQDKAEMEEDEEE", "length": 217 }, "evidence": [ { "id": "A0A1D5PE06", "url": "https://omabrowser.org/oma/group/A0A1D5PE06/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "F1RWG2-1", "protein_name": "Homeobox protein Hox-B7", "gene_name": "HOXB7", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MSSLYYANALFSKYPAASSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSTAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTAGPRATSQDKAEAEEDEEE", "length": 217 }, "evidence": [ { "id": "A0A1D5PE06", "url": "https://omabrowser.org/oma/group/A0A1D5PE06/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "P09024-1", "protein_name": "Homeobox protein Hox-B7", "gene_name": "Hoxb7", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSSLYYANALFSKYPAASSVFAPGAFPEQTSCAFASNPQRPGYGAGPGAPFSASVQGLYSGGGAMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDPAKAAGAKEQRDSDLAAESNFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTSGPGTTGQDKAEAEEEEEE", "length": 217 }, "evidence": [ { "id": "A0A1D5PE06", "url": "https://omabrowser.org/oma/group/A0A1D5PE06/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P09629-1", "protein_name": "Homeobox protein Hox-B7", "gene_name": "HOXB7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSSLYYANTLFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE", "length": 217 }, "evidence": [ { "id": "A0A1D5PE06", "url": "https://omabrowser.org/oma/group/A0A1D5PE06/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P18864-1", "protein_name": "Homeobox protein Hox-B7", "gene_name": "Hoxb7", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSSLYYANALFSKYPAASSVFAPGAFPEQTSCAFASNPQRPGYGAGPGAPFSASVQGLYSGGGGMAGQSAAGVYEAGYGLEPSSFNMHCAPFEQNLSGVCPGDPAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTERKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTSGPGTTGQDKAEADEEEEEEE", "length": 219 }, "evidence": [ { "id": "A0A1D5PE06", "url": "https://omabrowser.org/oma/group/A0A1D5PE06/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PE06", "url": "https://www.uniprot.org/uniprot/A0A1D5PE06" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PE06", "url": "https://www.uniprot.org/uniprot/A0A1D5PE06" } ], "pmid": "" }, { "name": "nuclear body", "id": "GO:0016604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016604", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PE06", "url": "https://www.uniprot.org/uniprot/A0A1D5PE06" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PE06", "url": "https://www.uniprot.org/uniprot/A0A1D5PE06" } ], "pmid": "" }, { "name": "anterior/posterior pattern specification", "id": "GO:0009952", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009952", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PE06", "url": "https://www.uniprot.org/uniprot/A0A1D5PE06" } ], "pmid": "" }, { "name": "positive regulation of branching involved in ureteric bud morphogenesis", "id": "GO:0090190", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090190", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PE06", "url": "https://www.uniprot.org/uniprot/A0A1D5PE06" } ], "pmid": "" }, { "name": "embryonic skeletal system morphogenesis", "id": "GO:0048704", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048704", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PE06", "url": "https://www.uniprot.org/uniprot/A0A1D5PE06" } ], "pmid": "" }, { "name": "myeloid cell differentiation", "id": "GO:0030099", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030099", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PE06", "url": "https://www.uniprot.org/uniprot/A0A1D5PE06" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PE06", "url": "https://www.uniprot.org/uniprot/A0A1D5PE06" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PE06", "url": "https://www.uniprot.org/uniprot/A0A1D5PE06" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PE06", "url": "https://www.uniprot.org/uniprot/A0A1D5PE06" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 109, "end_pos": 111, "annotation": "n_glycosylation_sequon" }, { "start_pos": 196, "end_pos": 198, "annotation": "n_glycosylation_sequon" }, { "start_pos": 94, "end_pos": 96, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5PE06-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 217, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5PE06-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 109, "end_pos": 111 }, { "start_pos": 196, "end_pos": 198 }, { "start_pos": 94, "end_pos": 96 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }