{ "uniprot_canonical_ac": "A0A1D5PCM9-1", "uniprot_ac": "A0A1D5PCM9", "uniprot_id": "A0A1D5PCM9_CHICK", "mass": { "chemical_mass": 12562.0, "monoisotopic_mass": 12562.0 }, "refseq": { "ac": "NP_001264410", "name": "protein SNORC precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264410" }, "gene_names": [ { "name": "SNORC", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1D5PCM9", "id": "A0A1D5PCM9" }, { "name": "C9H2ORF82", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264410", "id": "NP_001264410" }, { "name": "SNORC", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264410", "id": "NP_001264410" } ], "protein_names": [ { "name": "Secondary ossification center associated regulator of chondrocyte maturation", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PCM9/entry#names_and_taxonomy", "id": "A0A1D5PCM9" }, { "name": "protein SNORC precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264410", "id": "NP_001264410" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: BU432995.1, SRR12888516.165688.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992453 [ECO:0000348] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BU426473.1, BU432995.1 and CR353687.1. On Apr 11, 2013 this sequence version replaced XP_001231548.1.", "evidence": [ { "database": "RefSeq", "id": "NP_001264410", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264410" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PCM9", "url": "https://www.uniprot.org/uniprot/A0A1D5PCM9" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "SNORC", "url": "https://www.uniprot.org/uniprot/A0A1D5PCM9", "locus": { "chromosome": "9", "start_pos": 688258, "end_pos": 681766, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010022826", "url": "https://www.ensembl.org/id/ENSGALG00010022826" } ] } } ], "crossref": [ { "id": "A0A1D5PCM9", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5PCM9", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000040264", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000040264", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "768774", "url": "https://www.ncbi.nlm.nih.gov/gene/768774", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR031500", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031500", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:768774", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:768774", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "LWNDPPE", "url": "https://omabrowser.org/oma/group/LWNDPPE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR28453", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28453", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28453:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28453:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15756", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF15756", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001264410", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264410", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1D5PCM9", "url": "https://www.uniprot.org/uniprot/A0A1D5PCM9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5PCM9-1", "url": "https://www.uniprot.org/uniprot/A0A1D5PCM9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPCHRALRPLLLTLCFLLPAALAAEYPRGPLPTLWNEPAELPSGSGPFDAATTTARLSDGTAFAPYTSELEPEDTTHLHRLDAGDGSLGPGAIGAIVIASLLGTSVLVALVVITLRKFSAS", "length": 121, "header": "tr|A0A1D5PCM9-1|A0A1D5PCM9_CHICK Isoform 1 of Secondary ossification center associated regulator of chondrocyte maturation OS=Gallus gallus OX=9031 GN=SNORC PE=4 SV=1 CANONICAL=A0A1D5PCM9-1" }, "isoforms": [ { "isoform_ac": "A0A1D5PCM9-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PCM9/entry#A0A1D5PCM9-1", "sequence": { "sequence": "MPCHRALRPLLLTLCFLLPAALAAEYPRGPLPTLWNEPAELPSGSGPFDAATTTARLSDGTAFAPYTSELEPEDTTHLHRLDAGDGSLGPGAIGAIVIASLLGTSVLVALVVITLRKFSAS", "length": 121, "header": "tr|A0A1D5PCM9-1|A0A1D5PCM9_CHICK Isoform 1 of Secondary ossification center associated regulator of chondrocyte maturation OS=Gallus gallus OX=9031 GN=SNORC PE=4 SV=1 CANONICAL=A0A1D5PCM9-1" }, "locus": { "chromosome": "9", "start_pos": 688235, "end_pos": 681965, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010055516.1", "url": "https://www.ensembl.org/id/ENSGALT00010055516.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010033632.1", "url": "https://www.ensembl.org/id/ENSGALP00010033632.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "gga:768774", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:768774", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "E1BLR5-1", "protein_name": "Secondary ossification center associated regulator of chondrocyte maturation", "gene_name": "SNORC", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MPRSLCPEVEQLSPRCLPPAGHARPPARMASCLALRMVLLLLCGVLAPAVLTAEGPQEPAPTLWNEPAELPSGEDPVESTSPAWEPAVSGPPAPTATPSPEDSTAQERLDQGGGSLGPGAIAAIVIAALLATCVVLALVVVALRKFSAS", "length": 149 }, "evidence": [ { "id": "A0A1D5PCM9", "url": "https://omabrowser.org/oma/group/A0A1D5PCM9/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "F1SM49-1", "protein_name": "Secondary ossification center associated regulator of chondrocyte maturation", "gene_name": "SNORC", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MAFRLALRVALLLLSGVLAPAVLTAEGPQEPEPTLWNEPAELPSGEGPAESTSPAREPAATAPPAPTAAPSPEDSTARERLDQGGGSLGPGAIAAIVIAALLATCVVLALVVVALRKFSAS", "length": 121 }, "evidence": [ { "id": "A0A1D5PCM9", "url": "https://omabrowser.org/oma/group/A0A1D5PCM9/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "Q6UX34-1", "protein_name": "Protein SNORC", "gene_name": "SNORC", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MASCLALRMALLLVSGVLAPAVLTDDVPQEPVPTLWNEPAELPSGEGPVESTSPGREPVDTGPPAPTVAPGPEDSTAQERLDQGGGSLGPGAIAAIVIAALLATCVVLALVVVALRKFSAS", "length": 121 }, "evidence": [ { "id": "A0A1D5PCM9", "url": "https://omabrowser.org/oma/group/A0A1D5PCM9/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q9CXL7-1", "protein_name": "Protein SNORC", "gene_name": "Snorc", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MASCLALRVALLLISGVLAPAVLTAEGPQEPDPTLWNEPIELPSGEGPLESTSHNQEFAVSGPPFPTSAPAPEDSTPPARVDQDGGSLGPGAIAAIVIAALLATCVVLALVVVALRKFSAS", "length": 121 }, "evidence": [ { "id": "A0A1D5PCM9", "url": "https://omabrowser.org/oma/group/A0A1D5PCM9/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cell periphery", "id": "GO:0071944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071944", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PCM9", "url": "https://www.uniprot.org/uniprot/A0A1D5PCM9" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PCM9", "url": "https://www.uniprot.org/uniprot/A0A1D5PCM9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "cartilage development", "id": "GO:0051216", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051216", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PCM9", "url": "https://www.uniprot.org/uniprot/A0A1D5PCM9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5PCM9-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 121, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5PCM9-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }