{ "uniprot_canonical_ac": "A0A1D5P7P2-1", "uniprot_ac": "A0A1D5P7P2", "uniprot_id": "A0A1D5P7P2_CHICK", "mass": { "chemical_mass": 40762.0, "monoisotopic_mass": 40762.0 }, "refseq": {}, "gene_names": [ { "name": "CMKLR1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2", "id": "A0A1D5P7P2" } ], "protein_names": [ { "name": "Chemerin-like receptor 1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P7P2/entry#names_and_taxonomy", "id": "A0A1D5P7P2" }, { "name": "Chemokine-like receptor 1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P7P2/entry#names_and_taxonomy", "id": "A0A1D5P7P2" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P7P2", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "CMKLR1", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2", "locus": { "chromosome": "15", "start_pos": 6489651, "end_pos": 6511998, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010022421", "url": "https://www.ensembl.org/id/ENSGALG00010022421" } ] } } ], "crossref": [ { "id": "ENSGALG00000035182", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000035182", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd15116", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15116", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000826", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000826", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002258", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002258", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR24225", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24225", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24225:SF49", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24225:SF49", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00001", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00001", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-373076", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-373076", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "A0A1D5P7P2", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5P7P2-1", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALSNLSEYSDDSDTYDYLDYTYEEPGSVWTGPSYDPKDVARILSVVIYSVSCVLGILGNGLVIAIITLKMKKSVNAIWFLNLAVADFLFNIFLPINIAYTAMRYNWIFGTVMCKLNSFLLILNMYTSVLLLTTISFDRYVSVVFPVWSQNHRSTNLACMVCLIIWMVGIIMSCPSLVFRDTAQARNSIICFSNFSLSRNRSYQALALVRHRTVNITRLFAGFLLPITIITFCYVSIALNLRRNRLAKSKKPFKIIVTIIVTFFLCWSPYHLLNILETEPDLTPRSVFEIGVPITTALAASNSCMNPVLYVFMGQDFKKFKVTILSRLVNALSEETGHSSIVHRSFSKMSSMTEKETTVL", "length": 360, "header": "tr|A0A1D5P7P2-1|A0A1D5P7P2_CHICK Isoform 1 of Chemerin-like receptor 1 OS=Gallus gallus OX=9031 GN=CMKLR1 PE=1 SV=1 CANONICAL=A0A1D5P7P2-1" }, "isoforms": [ { "isoform_ac": "A0A1D5P7P2-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P7P2/entry#A0A1D5P7P2-1", "sequence": { "sequence": "MALSNLSEYSDDSDTYDYLDYTYEEPGSVWTGPSYDPKDVARILSVVIYSVSCVLGILGNGLVIAIITLKMKKSVNAIWFLNLAVADFLFNIFLPINIAYTAMRYNWIFGTVMCKLNSFLLILNMYTSVLLLTTISFDRYVSVVFPVWSQNHRSTNLACMVCLIIWMVGIIMSCPSLVFRDTAQARNSIICFSNFSLSRNRSYQALALVRHRTVNITRLFAGFLLPITIITFCYVSIALNLRRNRLAKSKKPFKIIVTIIVTFFLCWSPYHLLNILETEPDLTPRSVFEIGVPITTALAASNSCMNPVLYVFMGQDFKKFKVTILSRLVNALSEETGHSSIVHRSFSKMSSMTEKETTVL", "length": 360, "header": "tr|A0A1D5P7P2-1|A0A1D5P7P2_CHICK Isoform 1 of Chemerin-like receptor 1 OS=Gallus gallus OX=9031 GN=CMKLR1 PE=1 SV=1 CANONICAL=A0A1D5P7P2-1" }, "locus": { "chromosome": "15", "start_pos": 6499002, "end_pos": 6497923, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010054491.1", "url": "https://www.ensembl.org/id/ENSGALT00010054491.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010032914.1", "url": "https://www.ensembl.org/id/ENSGALP00010032914.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "R-GGA-373076", "name": "Class A/1 (Rhodopsin-like receptors)", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-373076", "resource": "Reactome", "description": "Class A/1 (Rhodopsin-like receptors)" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "complement receptor activity", "id": "GO:0004875", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004875", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P7P2", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2" } ], "pmid": "" }, { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P7P2", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2" } ], "pmid": "" }, { "name": "adipokinetic hormone receptor activity", "id": "GO:0097003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097003", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P7P2", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2" } ], "pmid": "" }, { "name": "adipokinetic hormone binding", "id": "GO:0097004", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097004", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P7P2", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "complement receptor mediated signaling pathway", "id": "GO:0002430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002430", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P7P2", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2" } ], "pmid": "" }, { "name": "chemotaxis", "id": "GO:0006935", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006935", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P7P2", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P7P2", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2" } ], "pmid": "" }, { "name": "positive regulation of cytosolic calcium ion concentration", "id": "GO:0007204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007204", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P7P2", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2" } ], "pmid": "" }, { "name": "positive regulation of fat cell differentiation", "id": "GO:0045600", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045600", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P7P2", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2" } ], "pmid": "" }, { "name": "phospholipase C-activating G protein-coupled receptor signaling pathway", "id": "GO:0007200", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007200", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P7P2", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2" } ], "pmid": "" }, { "name": "negative regulation of interleukin-12 production", "id": "GO:0032695", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032695", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P7P2", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2" } ], "pmid": "" }, { "name": "regulation of calcium-mediated signaling", "id": "GO:0050848", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050848", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P7P2", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2" } ], "pmid": "" }, { "name": "positive regulation of macrophage chemotaxis", "id": "GO:0010759", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010759", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P7P2", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2" } ], "pmid": "" }, { "name": "positive regulation of cold-induced thermogenesis", "id": "GO:0120162", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120162", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P7P2", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P7P2", "url": "https://www.uniprot.org/uniprot/A0A1D5P7P2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 194, "end_pos": 196, "annotation": "n_glycosylation_sequon" }, { "start_pos": 200, "end_pos": 202, "annotation": "n_glycosylation_sequon" }, { "start_pos": 215, "end_pos": 217, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 194, "end_pos": 196 }, { "start_pos": 200, "end_pos": 202 }, { "start_pos": 215, "end_pos": 217 }, { "start_pos": 5, "end_pos": 7 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }