{ "uniprot_canonical_ac": "A0A1D5P643-1", "uniprot_ac": "A0A1D5P643", "uniprot_id": "A0A1D5P643_CHICK", "mass": { "chemical_mass": 23420.0, "monoisotopic_mass": 23420.0 }, "refseq": { "ac": "XP_416259", "name": "josephin-1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_416259" }, "gene_names": [ { "name": "JOSD1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1D5P643", "id": "A0A1D5P643" }, { "name": "JOSD1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_416259", "id": "XP_416259" } ], "protein_names": [ { "name": "Josephin-1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P643/entry#names_and_taxonomy", "id": "A0A1D5P643" }, { "name": "3.4.19.12", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P643/entry#names_and_taxonomy", "id": "A0A1D5P643" }, { "name": "Josephin domain-containing protein 1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P643/entry#names_and_taxonomy", "id": "A0A1D5P643" }, { "name": "josephin-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_416259", "id": "XP_416259" } ], "function": [ { "annotation": "##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Gallus gallus Annotation Release 106 Annotation Version :: 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_052532.1) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process COMPLETENESS: full length.", "evidence": [ { "database": "RefSeq", "id": "XP_416259", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_416259" } ] }, { "annotation": "Deubiquitinates monoubiquitinated probes (in vitro). When ubiquitinated, cleaves 'Lys-63'-linked and 'Lys-48'-linked poly-ubiquitin chains (in vitro), hence may act as a deubiquitinating enzyme. May increase macropinocytosis and suppress clathrin- and caveolae-mediated endocytosis. May enhance membrane dynamics and cell motility independently of its catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P643", "url": "https://www.uniprot.org/uniprot/A0A1D5P643#function" }, { "database": "UniProtKB", "id": "ARBA00037708", "url": "https://www.uniprot.org/uniprot/ARBA00037708#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P643", "url": "https://www.uniprot.org/uniprot/A0A1D5P643" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "JOSD1", "url": "https://www.uniprot.org/uniprot/A0A1D5P643", "locus": { "chromosome": "1", "start_pos": 50884271, "end_pos": 50873875, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010012767", "url": "https://www.ensembl.org/id/ENSGALG00010012767" } ] } } ], "crossref": [ { "id": "A0A1D5P643", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5P643", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000041766", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000041766", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "418023", "url": "https://www.ncbi.nlm.nih.gov/gene/418023", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR006155", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006155", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040053", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040053", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:418023", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:418023", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "MSCMPWK", "url": "https://omabrowser.org/oma/group/MSCMPWK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1D5P643", "url": "https://www.orthodb.org/?gene=A0A1D5P643", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13291", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13291", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13291:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13291:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02099", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02099", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-5689877", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-5689877", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_416259", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_416259", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1D5P643", "url": "https://www.uniprot.org/uniprot/A0A1D5P643", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5P643-1", "url": "https://www.uniprot.org/uniprot/A0A1D5P643-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSCVPWKGDKAKSESPEPPQLLPPLHIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVNVIALSNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGTYYNLDSKLKMPEWIGGESELRKFLKHQLRGKNCELLLVVPEEVEAHQSWRADV", "length": 203, "header": "tr|A0A1D5P643-1|A0A1D5P643_CHICK Isoform 1 of Josephin-1 OS=Gallus gallus OX=9031 GN=JOSD1 PE=4 SV=1 CANONICAL=A0A1D5P643-1" }, "isoforms": [ { "isoform_ac": "A0A1D5P643-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P643/entry#A0A1D5P643-1", "sequence": { "sequence": "MSCVPWKGDKAKSESPEPPQLLPPLHIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVNVIALSNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGTYYNLDSKLKMPEWIGGESELRKFLKHQLRGKNCELLLVVPEEVEAHQSWRADV", "length": 203, "header": "tr|A0A1D5P643-1|A0A1D5P643_CHICK Isoform 1 of Josephin-1 OS=Gallus gallus OX=9031 GN=JOSD1 PE=4 SV=1 CANONICAL=A0A1D5P643-1" }, "locus": { "chromosome": "1", "start_pos": 50881857, "end_pos": 50874597, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010030581.1", "url": "https://www.ensembl.org/id/ENSGALT00010030581.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010017742.1", "url": "https://www.ensembl.org/id/ENSGALP00010017742.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "gga:418023", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:418023", "resource": "KEGG Pathway" }, { "id": "R-GGA-5689877", "name": "Josephin domain DUBs", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-5689877", "resource": "Reactome", "description": "Josephin domain DUBs" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A4X1VR79-1", "protein_name": "Josephin-1", "gene_name": "JOSD1", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGAIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRADV", "length": 202 }, "evidence": [ { "id": "A0A1D5P643", "url": "https://omabrowser.org/oma/group/A0A1D5P643/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "Q15040-1", "protein_name": "Josephin-1", "gene_name": "JOSD1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV", "length": 202 }, "evidence": [ { "id": "A0A1D5P643", "url": "https://omabrowser.org/oma/group/A0A1D5P643/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q5BJY4-1", "protein_name": "Josephin-1", "gene_name": "Josd1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSCMPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIFQRLSPNTVVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALANVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKYHLRGKNCELLLVVPEEVEAHQSWRADV", "length": 202 }, "evidence": [ { "id": "A0A1D5P643", "url": "https://omabrowser.org/oma/group/A0A1D5P643/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9DBJ6-1", "protein_name": "Josephin-1", "gene_name": "Josd1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSCVPWKGDKAKAESSDLPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKYHLRGKNCELLLVVPEEVEAHQSWRADV", "length": 202 }, "evidence": [ { "id": "A0A1D5P643", "url": "https://omabrowser.org/oma/group/A0A1D5P643/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P643", "url": "https://www.uniprot.org/uniprot/A0A1D5P643" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P643", "url": "https://www.uniprot.org/uniprot/A0A1D5P643" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P643", "url": "https://www.uniprot.org/uniprot/A0A1D5P643" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "cysteine-type deubiquitinase activity", "id": "GO:0004843", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004843", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P643", "url": "https://www.uniprot.org/uniprot/A0A1D5P643" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-GGA-5688797", "name": "ATXN3 family cleave Ub chains", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9W689-1", "A0A1D5P643-1" ], "evidence": [ { "id": "R-GGA-5688797", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-5688797" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A1D5P643", "gene_name": "JOSD1", "activity": [ { "ec_number": "3.4.19.12", "activity": "Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).", "evidence": [ { "id": "A0A1D5P643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5P643" } ] }, { "ec_number": "3.4.19.12", "activity": "", "evidence": [ { "id": "A0A1D5P643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5P643" } ] } ] }, { "uniprot_ac": "Q9W689", "gene_name": "ATXN3", "activity": [ { "ec_number": "3.4.19.12", "activity": "Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).", "evidence": [ { "id": "Q9W689", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W689" } ] }, { "ec_number": "3.4.19.12", "activity": "", "evidence": [ { "id": "Q9W689", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W689" } ] } ] } ], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5P643-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 203, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5P643-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "3.4.19.12", "ec_name": "Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).", "evidence": [ { "id": "3.4.19.12", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.4.19.12" } ] } ], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }