{ "uniprot_canonical_ac": "A0A1D5P2I2-1", "uniprot_ac": "A0A1D5P2I2", "uniprot_id": "A0A1D5P2I2_CHICK", "mass": { "chemical_mass": 49241.0, "monoisotopic_mass": 49241.0 }, "refseq": { "ac": "XP_420568", "name": "glycerol-3-phosphate acyltransferase 3 isoform X2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_420568" }, "gene_names": [ { "name": "LOC422609", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1D5P2I2", "id": "A0A1D5P2I2" }, { "name": "LOC422609", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_420568", "id": "XP_420568" } ], "protein_names": [ { "name": "Phospholipid/glycerol acyltransferase domain-containing protein", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P2I2/entry#names_and_taxonomy", "id": "A0A1D5P2I2" }, { "name": "glycerol-3-phosphate acyltransferase 3 isoform X2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_420568", "id": "XP_420568" } ], "function": [ { "annotation": "##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Gallus gallus Annotation Release 106 Annotation Version :: 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_052535.1) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process On Nov 16, 2006 this sequence version replaced XP_420568.1. COMPLETENESS: full length.", "evidence": [ { "database": "RefSeq", "id": "XP_420568", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_420568" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P2I2", "url": "https://www.uniprot.org/uniprot/A0A1D5P2I2" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "LOC422609", "url": "https://www.uniprot.org/uniprot/A0A1D5P2I2", "locus": { "chromosome": "4", "start_pos": 46076342, "end_pos": 46058214, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010004963", "url": "https://www.ensembl.org/id/ENSGALG00010004963" } ] } } ], "crossref": [ { "id": "A0A1D5P2I2", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5P2I2", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000043256", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000043256", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd07991", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07991", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "422609", "url": "https://www.ncbi.nlm.nih.gov/gene/422609", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002123", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002123", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045252", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045252", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:422609", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:422609", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "KYYCKGI", "url": "https://omabrowser.org/oma/group/KYYCKGI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1D5P2I2", "url": "https://www.orthodb.org/?gene=A0A1D5P2I2", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23063", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23063", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23063:SF10", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23063:SF10", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01553", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01553", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_420568", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_420568", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1D5P2I2", "url": "https://www.uniprot.org/uniprot/A0A1D5P2I2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5P2I2-1", "url": "https://www.uniprot.org/uniprot/A0A1D5P2I2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0XNW5", "url": "https://www.uniprot.org/uniprot/A0A8V0XNW5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0XNW5-1", "url": "https://www.uniprot.org/uniprot/A0A8V0XNW5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEESRQGYSLAEGKTLLIWLTAFVVLVLLPSMFRVSLGISHVYVKIVIKTLEWATLQIEKGIKMQKALALENLIANGIIQREETSMEKEIAGQHRGYFNLADVMYFAKKGCEAVAEDEVTQRFTSEELLSWNLLSRTNANFHRVSWQLTTVWIIGILIRYCLLVPFRIFLAFFSILLLVSATTVVGQFPNGRVKHWLSNQVQLTCAALGVRCLSGLVQFHNRENRPQKGGICVANHTSPLDVLILASDGCYSLVGQVHGGLLGLIQKSCMQTSQHVLFERSEMKDRHLVRKRIREHIADKAKLPILIFPEGTCINNTSVMMFKKGSFEVGGTIHPVAIKYDPRFGDAFWNSTKYSMMTYSFNVLTSWAIVCNVWYLPPMVKEEEEDAVHFADRVKAVIAAQGGMSVLPWDGGLKRKQVKESFKEEQQKKYCQLVT", "length": 435, "header": "tr|A0A1D5P2I2-1|A0A1D5P2I2_CHICK Isoform 1 of Phospholipid/glycerol acyltransferase domain-containing protein OS=Gallus gallus OX=9031 GN=LOC422609 PE=3 SV=2 CANONICAL=A0A1D5P2I2-1" }, "isoforms": [ { "isoform_ac": "A0A1D5P2I2-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P2I2/entry#A0A1D5P2I2-1", "sequence": { "sequence": "MEESRQGYSLAEGKTLLIWLTAFVVLVLLPSMFRVSLGISHVYVKIVIKTLEWATLQIEKGIKMQKALALENLIANGIIQREETSMEKEIAGQHRGYFNLADVMYFAKKGCEAVAEDEVTQRFTSEELLSWNLLSRTNANFHRVSWQLTTVWIIGILIRYCLLVPFRIFLAFFSILLLVSATTVVGQFPNGRVKHWLSNQVQLTCAALGVRCLSGLVQFHNRENRPQKGGICVANHTSPLDVLILASDGCYSLVGQVHGGLLGLIQKSCMQTSQHVLFERSEMKDRHLVRKRIREHIADKAKLPILIFPEGTCINNTSVMMFKKGSFEVGGTIHPVAIKYDPRFGDAFWNSTKYSMMTYSFNVLTSWAIVCNVWYLPPMVKEEEEDAVHFADRVKAVIAAQGGMSVLPWDGGLKRKQVKESFKEEQQKKYCQLVT", "length": 435, "header": "tr|A0A1D5P2I2-1|A0A1D5P2I2_CHICK Isoform 1 of Phospholipid/glycerol acyltransferase domain-containing protein OS=Gallus gallus OX=9031 GN=LOC422609 PE=3 SV=2 CANONICAL=A0A1D5P2I2-1" }, "locus": { "chromosome": "4", "start_pos": 46075466, "end_pos": 46058377, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010011650.1", "url": "https://www.ensembl.org/id/ENSGALT00010011650.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010006516.1", "url": "https://www.ensembl.org/id/ENSGALP00010006516.1" } ] } }, { "isoform_ac": "A0A8V0XNW5-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P2I2/entry#A0A8V0XNW5-1", "sequence": { "sequence": "MEESRQGYSLAEGKTLLIWLTAFVVLVLLPSMFRVSLGISHVYVKIVIKTLEWATLQIEKGIKMQKALALENLIANGIIQREETSMEKEIAGQHRGYFNLADVMYFAKKGCEAVAEDEVTQRFTSEELLSWNLLSRTNANFHRVSWQLTTVWIIGILIRYCLLVPFRVKHWLSNQVQLTCAALGVRCLSGLVQFHNRENRPQKGGICVANHTSPLDVLILASDGCYSLVGQVHGGLLGLIQKSCMQTSQHVLFERSEMKDRHLVRKRIREHIADKAKLPILIFPEGTCINNTSVMMFKKGSFEVGGTIHPVAIKYDPRFGDAFWNSTKYSMMTYSFNVLTSWAIVCNVWYLPPMVKEEEEDAVHFADRVKAVIAAQGGMSVLPWDGGLKRKQVKESFKEEQQKKYCQLVT", "length": 410, "header": "tr|A0A8V0XNW5-1|A0A1D5P2I2_CHICK Computationally mapped isoform of Phospholipid/glycerol acyltransferase domain-containing protein OS=Gallus gallus OX=9031 GN=LOC422609 PE=3 SV=1 CANONICAL=A0A1D5P2I2-1" }, "locus": { "chromosome": "4", "start_pos": 46075466, "end_pos": 46058377, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010011641.1", "url": "https://www.ensembl.org/id/ENSGALT00010011641.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010006510.1", "url": "https://www.ensembl.org/id/ENSGALP00010006510.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "gga:422609", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:422609", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P2I2", "url": "https://www.uniprot.org/uniprot/A0A1D5P2I2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P2I2", "url": "https://www.uniprot.org/uniprot/A0A1D5P2I2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "O-acyltransferase activity", "id": "GO:0008374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008374", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P2I2", "url": "https://www.uniprot.org/uniprot/A0A1D5P2I2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 235, "end_pos": 237, "annotation": "n_glycosylation_sequon" }, { "start_pos": 315, "end_pos": 317, "annotation": "n_glycosylation_sequon" }, { "start_pos": 316, "end_pos": 318, "annotation": "n_glycosylation_sequon" }, { "start_pos": 350, "end_pos": 352, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5P2I2-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 435, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5P2I2-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 235, "end_pos": 237 }, { "start_pos": 315, "end_pos": 317 }, { "start_pos": 316, "end_pos": 318 }, { "start_pos": 350, "end_pos": 352 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }