{ "uniprot_canonical_ac": "A0A1D5P263-1", "uniprot_ac": "A0A1D5P263", "uniprot_id": "A0A1D5P263_CHICK", "mass": { "chemical_mass": 24623.0, "monoisotopic_mass": 24623.0 }, "refseq": { "ac": "XP_001233657", "name": "acyl-protein thioesterase 1 isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001233657" }, "gene_names": [ { "name": "LYPLA1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1D5P263", "id": "A0A1D5P263" }, { "name": "LYPLA1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001233657", "id": "XP_001233657" } ], "protein_names": [ { "name": "Acyl-protein thioesterase 1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P263/entry#names_and_taxonomy", "id": "A0A1D5P263" }, { "name": "3.1.2.22", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P263/entry#names_and_taxonomy", "id": "A0A1D5P263" }, { "name": "Lysophospholipase 1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P263/entry#names_and_taxonomy", "id": "A0A1D5P263" }, { "name": "Lysophospholipase I", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P263/entry#names_and_taxonomy", "id": "A0A1D5P263" }, { "name": "Palmitoyl-protein hydrolase", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P263/entry#names_and_taxonomy", "id": "A0A1D5P263" }, { "name": "acyl-protein thioesterase 1 isoform X1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001233657", "id": "XP_001233657" } ], "function": [ { "annotation": "##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Gallus gallus Annotation Release 106 Annotation Version :: 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_052533.1) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process On Dec 16, 2011 this sequence version replaced XP_001233657.1. COMPLETENESS: full length.", "evidence": [ { "database": "RefSeq", "id": "XP_001233657", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001233657" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P263", "url": "https://www.uniprot.org/uniprot/A0A1D5P263" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "LYPLA1", "url": "https://www.uniprot.org/uniprot/A0A1D5P263", "locus": { "chromosome": "2", "start_pos": 110068819, "end_pos": 110080414, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010004468", "url": "https://www.ensembl.org/id/ENSGALG00010004468" } ] } } ], "crossref": [ { "id": "A0A1D5P263", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5P263", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000040421", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000040421", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "770321", "url": "https://www.ncbi.nlm.nih.gov/gene/770321", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003140", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003140", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029058", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029058", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050565", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050565", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:770321", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:770321", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "RARYEWA", "url": "https://omabrowser.org/oma/group/RARYEWA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1D5P263", "url": "https://www.orthodb.org/?gene=A0A1D5P263", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10655", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10655", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10655:SF22", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10655:SF22", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02230", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02230", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-203615", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-9648002", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_001233657", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001233657", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "40435", "url": "https://www.rhea-db.org/rhea/40435", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "41720", "url": "https://www.rhea-db.org/rhea/41720", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A1D5P263", "url": "https://www.uniprot.org/uniprot/A0A1D5P263", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5P263-1", "url": "https://www.uniprot.org/uniprot/A0A1D5P263-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0XMP7", "url": "https://www.uniprot.org/uniprot/A0A8V0XMP7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0XMP7-1", "url": "https://www.uniprot.org/uniprot/A0A8V0XMP7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0XPG9", "url": "https://www.uniprot.org/uniprot/A0A8V0XPG9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0XPG9-1", "url": "https://www.uniprot.org/uniprot/A0A8V0XPG9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MCGNNMSAPLPAIVPAARKATAAVIFLHGLGDTGHGWSEALAGIKSPHVKYICPHAPFMPVTLNMNMAMPSWFDIIGLSPDSQEDEVGIKQAAENVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTHQKLAGVVALSCWLPLRTSFVQGAVGVNKEIPVLQCHGDCDPLVPLMFGSLTVEKLKSMINPANITFRTYSGMMHSSCIEEMMDIKQFIDKHLPPVD", "length": 229, "header": "tr|A0A1D5P263-1|A0A1D5P263_CHICK Isoform 1 of Acyl-protein thioesterase 1 OS=Gallus gallus OX=9031 GN=LYPLA1 PE=1 SV=1 CANONICAL=A0A1D5P263-1" }, "isoforms": [ { "isoform_ac": "A0A1D5P263-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P263/entry#A0A1D5P263-1", "sequence": { "sequence": "MCGNNMSAPLPAIVPAARKATAAVIFLHGLGDTGHGWSEALAGIKSPHVKYICPHAPFMPVTLNMNMAMPSWFDIIGLSPDSQEDEVGIKQAAENVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTHQKLAGVVALSCWLPLRTSFVQGAVGVNKEIPVLQCHGDCDPLVPLMFGSLTVEKLKSMINPANITFRTYSGMMHSSCIEEMMDIKQFIDKHLPPVD", "length": 229, "header": "tr|A0A1D5P263-1|A0A1D5P263_CHICK Isoform 1 of Acyl-protein thioesterase 1 OS=Gallus gallus OX=9031 GN=LYPLA1 PE=1 SV=1 CANONICAL=A0A1D5P263-1" }, "locus": { "chromosome": "2", "start_pos": 110080338, "end_pos": 110072662, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010010424.1", "url": "https://www.ensembl.org/id/ENSGALT00010010424.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010006078.1", "url": "https://www.ensembl.org/id/ENSGALP00010006078.1" } ] } }, { "isoform_ac": "A0A8V0XMP7-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P263/entry#A0A8V0XMP7-1", "sequence": { "sequence": "MCGNNMSAPLPAIVPAARKATAAVIFLHGLGDTGPFMPVTLNMNMAMPSWFDIIGLSPDSQEDEVGIKQAAENVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTHQKLAGVVALSCWLPLRTSFVQGAVGVNKEIPVLQCHGDCDPLVPLMFGSLTVEKLKSMINPANITFRTYSGMMHSSCIEEMMDIKQFIDKHLPPVD", "length": 207, "header": "tr|A0A8V0XMP7-1|A0A8V0XMP7_CHICK Computationally mapped isoform of Acyl-protein thioesterase 1 OS=Gallus gallus OX=9031 GN=LYPLA1 PE=1 SV=1 CANONICAL=A0A1D5P263-1" }, "locus": { "chromosome": "2", "start_pos": 110080338, "end_pos": 110072662, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010010427.1", "url": "https://www.ensembl.org/id/ENSGALT00010010427.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010006079.1", "url": "https://www.ensembl.org/id/ENSGALP00010006079.1" } ] } }, { "isoform_ac": "A0A8V0XPG9-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P263/entry#A0A8V0XPG9-1", "sequence": { "sequence": "MPPTGGGAGAAGGCSPVIFLHGLGDTGHGWSEALAGIKSPHVKYICPHAPFMPVTLNMNMAMPSWFDIIGLSPDSQEDEVGIKQAAENVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTHQKLAGVVALSCWLPLRTSFVQGAVGVNKEIPVLQCHGDCDPLVPLMFGSLTVEKLKSMINPANITFRTYSGMMHSSCIEEMMDIKQFIDKHLPPVD", "length": 222, "header": "tr|A0A8V0XPG9-1|A0A1D5P263_CHICK Computationally mapped isoform of Acyl-protein thioesterase 1 OS=Gallus gallus OX=9031 GN=LYPLA1 PE=1 SV=1 CANONICAL=A0A1D5P263-1" }, "locus": { "chromosome": "2", "start_pos": 110079967, "end_pos": 110072662, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010010423.1", "url": "https://www.ensembl.org/id/ENSGALT00010010423.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010006077.1", "url": "https://www.ensembl.org/id/ENSGALP00010006077.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "gga:770321", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:770321", "resource": "KEGG Pathway" }, { "id": "R-GGA-203615", "name": "eNOS activation", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-203615", "resource": "Reactome", "description": "eNOS activation" }, { "id": "R-GGA-9648002", "name": "RAS processing", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-9648002", "resource": "Reactome", "description": "RAS processing" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A3Q1M5Z8-1", "protein_name": "Acyl-protein thioesterase 1", "gene_name": "LYPLA1", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MPGVVSDRAPRPASPPPARSMRGPHAEVSSGSPRPQPTGRHSAGHCDARAAARRAAGTRGAGGRRGAGGRARAGARARGRARLAARTPLGPAGRPLRLPLPTRGRGSRCMCGNNMSAPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSAHIKYICPHAPVMPVTLNMNMAMPSWFDIIGLSPDSLEDETGIKQAAENVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQTLSAHYTAFTVDCRKWKKCGPIGGVNRDISILQCHGDLDPLVPLMFGSLTAEKLKTLVNPANVTFRTYAGMMHSSCQQEMMDIKQFIDKLLPPVD", "length": 358 }, "evidence": [ { "id": "A0A1D5P263", "url": "https://omabrowser.org/oma/group/A0A1D5P263/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "F1RSG9-1", "protein_name": "Acyl-protein thioesterase 1", "gene_name": "LYPLA1", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MCGNNMSAPLPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSAHIKYICPHAPVMPVTLNMNMAMPSWFNIIGLSPDSLEDETGIKQAAENVKSLIEQEVKNGIPSNRIILGGFSQGGALSLYTALTTHQKLAGVTALSCWLPLRSSFPECPISGVNRDIPILQCHGVLDPLVPLMFGSLTVERLKTLVNPANVTFKTYEGMMHSSCQQEMLDVKQFIEKLLPPID", "length": 230 }, "evidence": [ { "id": "A0A1D5P263", "url": "https://omabrowser.org/oma/group/A0A1D5P263/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "O75608-1", "protein_name": "Acyl-protein thioesterase 1", "gene_name": "LYPLA1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID", "length": 230 }, "evidence": [ { "id": "A0A1D5P263", "url": "https://omabrowser.org/oma/group/A0A1D5P263/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P97823-1", "protein_name": "Acyl-protein thioesterase 1", "gene_name": "Lypla1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID", "length": 230 }, "evidence": [ { "id": "A0A1D5P263", "url": "https://omabrowser.org/oma/group/A0A1D5P263/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q55FK4-1", "protein_name": "Acyl-protein thioesterase 1 homolog 2", "gene_name": "", "tax_id": 44689, "organism": "Dictyostelium discoideum", "sequence": { "sequence": "MSNLIEIKSKSTHTATVIFLHGLMDTGKGWETRMENIISMGGLDHIKFVLPTAPTIPISINFGNKGTAWCNVTAFYPGSEEDLIGLEKSMKLVEALIEEEIKNGIPAERIILSGFSQGGALTLYTGYQSKHKLAALITLSGFSPSLSLPSKIKPENKDIPLTMFHGTDDKVVNCKWGELSHKSYLKVGIKNSQFISITNLDHSSNEFELKQVHDLIEKYLPK", "length": 222 }, "evidence": [ { "id": "A0A1D5P263", "url": "https://omabrowser.org/oma/group/A0A1D5P263/", "database": "OMA" } ], "glygen_name": "Cellular slime mold", "common_name": "Social amoeba" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P263", "url": "https://www.uniprot.org/uniprot/A0A1D5P263" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P263", "url": "https://www.uniprot.org/uniprot/A0A1D5P263" } ], "pmid": "" }, { "name": "nuclear membrane", "id": "GO:0031965", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031965", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P263", "url": "https://www.uniprot.org/uniprot/A0A1D5P263" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P263", "url": "https://www.uniprot.org/uniprot/A0A1D5P263" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P263", "url": "https://www.uniprot.org/uniprot/A0A1D5P263" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P263", "url": "https://www.uniprot.org/uniprot/A0A1D5P263" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P263", "url": "https://www.uniprot.org/uniprot/A0A1D5P263" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "hydrolase activity", "id": "GO:0016787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016787", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P263", "url": "https://www.uniprot.org/uniprot/A0A1D5P263" } ], "pmid": "" }, { "name": "carboxylic ester hydrolase activity", "id": "GO:0052689", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052689", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P263", "url": "https://www.uniprot.org/uniprot/A0A1D5P263" } ], "pmid": "" }, { "name": "lysophospholipase activity", "id": "GO:0004622", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004622", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P263", "url": "https://www.uniprot.org/uniprot/A0A1D5P263" } ], "pmid": "" }, { "name": "palmitoyl-(protein) hydrolase activity", "id": "GO:0008474", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008474", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P263", "url": "https://www.uniprot.org/uniprot/A0A1D5P263" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "fatty acid transport", "id": "GO:0015908", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015908", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P263", "url": "https://www.uniprot.org/uniprot/A0A1D5P263" } ], "pmid": "" }, { "name": "negative regulation of Golgi to plasma membrane protein transport", "id": "GO:0042997", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042997", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P263", "url": "https://www.uniprot.org/uniprot/A0A1D5P263" } ], "pmid": "" }, { "name": "negative regulation of aggrephagy", "id": "GO:1905336", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905336", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P263", "url": "https://www.uniprot.org/uniprot/A0A1D5P263" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 196, "end_pos": 198, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "40435", "name": "", "equation": "1-hexadecanoyl-sn-glycero-3-phosphocholine + H2O = H(+) + hexadecanoate + sn-glycerol 3-phosphocholine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A1D5P263-1", "A0A8V0Z5J2-1", "A0A8V0ZSC5-1", "A0A8V0ZYA6-1" ], "evidence": [ { "id": "40435", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/40435" } ] }, { "id": "41720", "name": "", "equation": "a 1-(9Z-octadecenoyl)-2-acyl-sn-glycero-3-phosphocholine + H2O = (9Z)-octadecenoate + a 2-acyl-sn-glycero-3-phosphocholine + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A1D5P263-1" ], "evidence": [ { "id": "41720", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/41720" } ] }, { "id": "R-GGA-203613", "name": "depalmitoylation of eNOS", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A1D5P263-1" ], "evidence": [ { "id": "R-GGA-203613", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-203613" } ] }, { "id": "R-GGA-9647991", "name": "Palmostatin B binds RAS depalmitoylases", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A1D5P263-1", "Q5ZJ01-1", "Q5ZJX1-1" ], "evidence": [ { "id": "R-GGA-9647991", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-9647991" } ] }, { "id": "R-GGA-9647994", "name": "RAS proteins are depalmitoylated", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A1D5P263-1", "Q5F352-1", "A0A8V0YNE2-1", "Q5ZJ01-1", "Q5ZJX1-1", "P08642-1" ], "evidence": [ { "id": "R-GGA-9647994", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-9647994" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A1D5P263", "gene_name": "LYPLA1", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "A0A1D5P263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5P263" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "A0A1D5P263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5P263" } ] } ] }, { "uniprot_ac": "A0A8V0YNE2", "gene_name": "KRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "A0A8V0YNE2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0YNE2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "A0A8V0YNE2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0YNE2" } ] } ] }, { "uniprot_ac": "A0A8V0Z5J2", "gene_name": "PLB1", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "A0A8V0Z5J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0Z5J2" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "A0A8V0Z5J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0Z5J2" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "A0A8V0Z5J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0Z5J2" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "A0A8V0Z5J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0Z5J2" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "A0A8V0Z5J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0Z5J2" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "A0A8V0Z5J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0Z5J2" } ] } ] }, { "uniprot_ac": "A0A8V0ZSC5", "gene_name": "PLA2G15", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "A0A8V0ZSC5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZSC5" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "A0A8V0ZSC5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZSC5" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "A0A8V0ZSC5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZSC5" } ] }, { "ec_number": "3.1.1.32", "activity": "", "evidence": [ { "id": "A0A8V0ZSC5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZSC5" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "A0A8V0ZSC5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZSC5" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "A0A8V0ZSC5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZSC5" } ] } ] }, { "uniprot_ac": "A0A8V0ZYA6", "gene_name": "LIPC", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "A0A8V0ZYA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZYA6" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "A0A8V0ZYA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZYA6" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "A0A8V0ZYA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZYA6" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "A0A8V0ZYA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZYA6" } ] }, { "ec_number": "3.1.1.32", "activity": "", "evidence": [ { "id": "A0A8V0ZYA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZYA6" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "A0A8V0ZYA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZYA6" } ] } ] }, { "uniprot_ac": "P08642", "gene_name": "HRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P08642", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08642" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P08642", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08642" } ] } ] }, { "uniprot_ac": "Q5F352", "gene_name": "NRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q5F352", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5F352" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q5F352", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5F352" } ] } ] }, { "uniprot_ac": "Q5ZJ01", "gene_name": "ABHD17B", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q5ZJ01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5ZJ01" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q5ZJ01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5ZJ01" } ] } ] }, { "uniprot_ac": "Q5ZJX1", "gene_name": "ABHD17C", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q5ZJX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5ZJX1" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q5ZJX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5ZJX1" } ] } ] } ], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5P263-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 229, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5P263-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "3.1.2.22", "ec_name": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "3.1.2.22", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:3.1.2.22" }, { "id": "3.1.2.22", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.1.2.22" } ] } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 196, "end_pos": 198 }, { "start_pos": 5, "end_pos": 7 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }