{ "uniprot_canonical_ac": "A0A1D5NTS2-1", "uniprot_ac": "A0A1D5NTS2", "uniprot_id": "A0A1D5NTS2_CHICK", "mass": { "chemical_mass": 29723.0, "monoisotopic_mass": 29723.0 }, "refseq": { "ac": "NP_001264340", "name": "carbonic anhydrase 3A", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264340" }, "gene_names": [ { "name": "CA3A", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1D5NTS2", "id": "A0A1D5NTS2" }, { "name": "CA3A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264340", "id": "NP_001264340" }, { "name": "CA3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264340", "id": "NP_001264340" } ], "protein_names": [ { "name": "Carbonic anhydrase", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5NTS2/entry#names_and_taxonomy", "id": "A0A1D5NTS2" }, { "name": "4.2.1.1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5NTS2/entry#names_and_taxonomy", "id": "A0A1D5NTS2" }, { "name": "carbonic anhydrase 3A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264340", "id": "NP_001264340" }, { "name": "carbonic anhydrase III, muscle specific", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264340", "id": "NP_001264340" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: BU437187.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992415 [ECO:0000348] ##Evidence-Data-END## PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JAENSK010000044.1. On Apr 6, 2013 this sequence version replaced XP_418319.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.", "evidence": [ { "database": "RefSeq", "id": "NP_001264340", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264340" } ] }, { "annotation": "Reversible hydration of carbon dioxide.", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5NTS2", "url": "https://www.uniprot.org/uniprot/A0A1D5NTS2#function" }, { "database": "UniProtKB", "id": "RU367011", "url": "https://www.uniprot.org/uniprot/RU367011#function" }, { "database": "UniProtKB", "id": "ARBA00002904", "url": "https://www.uniprot.org/uniprot/ARBA00002904#function" }, { "database": "UniProtKB", "id": "A0A8V0YLI8", "url": "https://www.uniprot.org/uniprot/A0A8V0YLI8#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5NTS2", "url": "https://www.uniprot.org/uniprot/A0A1D5NTS2" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "CA3A", "url": "https://www.uniprot.org/uniprot/A0A1D5NTS2", "locus": { "chromosome": "2", "start_pos": 122376529, "end_pos": 122362448, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010013288", "url": "https://www.ensembl.org/id/ENSGALG00010013288" } ] } } ], "crossref": [ { "id": "A0A1D5NTS2", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5NTS2", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000033700", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000033700", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03119", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03119", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "420208", "url": "https://www.ncbi.nlm.nih.gov/gene/420208", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001148", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001148", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018338", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018338", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023561", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023561", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036398", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036398", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:420208", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:420208", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WHELYPN", "url": "https://omabrowser.org/oma/group/WHELYPN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1D5NTS2", "url": "https://www.orthodb.org/?gene=A0A1D5NTS2", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR18952", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18952", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR18952:SF127", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18952:SF127", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00194", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00194", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001264340", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264340", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "10748", "url": "https://www.rhea-db.org/rhea/10748", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A1D5NTS2", "url": "https://www.uniprot.org/uniprot/A0A1D5NTS2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5NTS2-1", "url": "https://www.uniprot.org/uniprot/A0A1D5NTS2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0YLI8", "url": "https://www.uniprot.org/uniprot/A0A8V0YLI8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0YLI8-1", "url": "https://www.uniprot.org/uniprot/A0A8V0YLI8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAQSVWGYDKENGPEHWHQNYPMAKGDKQSPIEINSKDVRHDTSLSPWHASYDPGAAKTILNNGRTCRVVFDDTFDRSVLRGGPLTGAYRLRQLHLHWGSADDHGSEHVIDGVKYAAELHLVHWNPKHGNFAGALKQPDGVAVVGVFLKVGKTPKPEMKRILEEIDNIKTKGKEAPFQHFDPSILFPKSRDYWTYHGSFTTPPCEECITWILLREPIEVSPDQMARLRSLSKNGENEPMCPLVDNWRPLQPVKGRIVRASFK", "length": 262, "header": "tr|A0A1D5NTS2-1|A0A1D5NTS2_CHICK Isoform 1 of Carbonic anhydrase OS=Gallus gallus OX=9031 GN=CA3A PE=3 SV=1 CANONICAL=A0A1D5NTS2-1" }, "isoforms": [ { "isoform_ac": "A0A1D5NTS2-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5NTS2/entry#A0A1D5NTS2-1", "sequence": { "sequence": "MAQSVWGYDKENGPEHWHQNYPMAKGDKQSPIEINSKDVRHDTSLSPWHASYDPGAAKTILNNGRTCRVVFDDTFDRSVLRGGPLTGAYRLRQLHLHWGSADDHGSEHVIDGVKYAAELHLVHWNPKHGNFAGALKQPDGVAVVGVFLKVGKTPKPEMKRILEEIDNIKTKGKEAPFQHFDPSILFPKSRDYWTYHGSFTTPPCEECITWILLREPIEVSPDQMARLRSLSKNGENEPMCPLVDNWRPLQPVKGRIVRASFK", "length": 262, "header": "tr|A0A1D5NTS2-1|A0A1D5NTS2_CHICK Isoform 1 of Carbonic anhydrase OS=Gallus gallus OX=9031 GN=CA3A PE=3 SV=1 CANONICAL=A0A1D5NTS2-1" }, "locus": { "chromosome": "2", "start_pos": 122374645, "end_pos": 122363109, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010031951.1", "url": "https://www.ensembl.org/id/ENSGALT00010031951.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010018743.1", "url": "https://www.ensembl.org/id/ENSGALP00010018743.1" } ] } }, { "isoform_ac": "A0A8V0YLI8-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5NTS2/entry#A0A8V0YLI8-1", "sequence": { "sequence": "MILHSKISFQTGPEHWHQNYPMAKGDKQSPIEINSKDVRHDTSLSPWHASYDPGAAKTILNNGRTCRVVFDDTFDRSVLRGGPLTGAYRLRQLHLHWGSADDHGSEHVIDGVKYAAELHLVHWNPKHGNFAGALKQPDGVAVVGVFLKVGKTPKPEMKRILEEIDNIKTKGKEAPFQHFDPSILFPKSRDYWTYHGSFTTPPCEECITWILLREPIEVSPDQMARLRSLSKNGENEPMCPLVDNWRPLQPVKGRIVRASFK", "length": 261, "header": "tr|A0A8V0YLI8-1|A0A1D5NTS2_CHICK Computationally mapped isoform of Carbonic anhydrase OS=Gallus gallus OX=9031 GN=CA3A PE=3 SV=1 CANONICAL=A0A1D5NTS2-1" }, "locus": { "chromosome": "2", "start_pos": 122374645, "end_pos": 122362633, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010031955.1", "url": "https://www.ensembl.org/id/ENSGALT00010031955.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010018747.1", "url": "https://www.ensembl.org/id/ENSGALP00010018747.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "gga:420208", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:420208", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P07451-1", "protein_name": "Carbonic anhydrase 3", "gene_name": "CA3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK", "length": 260 }, "evidence": [ { "id": "A0A1D5NTS2", "url": "https://omabrowser.org/oma/group/A0A1D5NTS2/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P14141-1", "protein_name": "Carbonic anhydrase 3", "gene_name": "Ca3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAKEWGYASHNGPEHWHELYPIAKGDNQSPIELHTKDIRHDPSLQPWSVSYDPGSAKTILNNGKTCRVVFDDTFDRSMLRGGPLSGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFGEALKQPDGIAVVGIFLKIGREKGEFQILLDALDKIKTKGKEAPFNHFDPSCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLFASAENEPPVPLVGNWRPPQPIKGRVVRASFK", "length": 260 }, "evidence": [ { "id": "A0A1D5NTS2", "url": "https://omabrowser.org/oma/group/A0A1D5NTS2/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P16015-1", "protein_name": "Carbonic anhydrase 3", "gene_name": "Ca3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAKEWGYASHNGPDHWHELYPIAKGDNQSPIELHTKDIKHDPSLQPWSASYDPGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLSGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFGEALKQPDGIAVVGIFLKIGREKGEFQILLDALDKIKTKGKEAPFTHFDPSCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLFSSAENEPPVPLVGNWRPPQPVKGRVVRASFK", "length": 260 }, "evidence": [ { "id": "A0A1D5NTS2", "url": "https://omabrowser.org/oma/group/A0A1D5NTS2/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q3SZX4-1", "protein_name": "Carbonic anhydrase 3", "gene_name": "CA3", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MAKEWGYADHNGPDHWHELFPNAKGENQSPIELNTKEISHDPSLKPWTASYDPGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLAAPYRLRQFHLHWGSSDDHGSEHSVDGVKYAAELHLVHWNSKYNSYATALKHADGIAVVGVFLKIGREKGEFQLLLDALDKIKTKGKEAPFNNFNPSCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPITVSSDQIAKLRTLYSSAENEPPVPLVRNWRPPQPIKGRIVKASFK", "length": 260 }, "evidence": [ { "id": "A0A1D5NTS2", "url": "https://omabrowser.org/oma/group/A0A1D5NTS2/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "Q5S1S4-1", "protein_name": "Carbonic anhydrase 3", "gene_name": "CA3", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MAKEWGYADHNGPDHWHELYPIAKGDNQSPIELHTKDIKHDPSLLPWTASYDPGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLTAAYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNSKYNSFATALKHPDGVAVVGIFLKIGREKGEFQLVLDALDKIKTKGKEAPFTNFNPSCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPITVSSDQMAKLRSLYSSAENEPPVPLVRNWRPPQPIKGRIVKASFK", "length": 260 }, "evidence": [ { "id": "A0A1D5NTS2", "url": "https://omabrowser.org/oma/group/A0A1D5NTS2/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5NTS2", "url": "https://www.uniprot.org/uniprot/A0A1D5NTS2" } ], "pmid": "" }, { "name": "carbonate dehydratase activity", "id": "GO:0004089", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004089", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5NTS2", "url": "https://www.uniprot.org/uniprot/A0A1D5NTS2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5NTS2", "url": "https://www.uniprot.org/uniprot/A0A1D5NTS2" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5NTS2", "url": "https://www.uniprot.org/uniprot/A0A1D5NTS2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "one-carbon metabolic process", "id": "GO:0006730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006730", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5NTS2", "url": "https://www.uniprot.org/uniprot/A0A1D5NTS2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "10748", "name": "", "equation": "H(+) + hydrogencarbonate = CO2 + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A1D5NTS2-1", "A0A1D5NX31-1", "A0A1D5P5F4-1", "A0A8V0XZG4-1", "P07630-1", "A0A8V0YA50-1", "A0A8V0YF14-1", "A0A8V0Z0V6-1", "A0A8V0ZXU7-1", "A0A8V1AKN8-1" ], "evidence": [ { "id": "10748", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/10748" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A1D5NTS2", "gene_name": "CA3A", "activity": [ { "ec_number": "4.2.1.1", "activity": "H(+) + hydrogencarbonate = CO2 + H2O.", "evidence": [ { "id": "A0A1D5NTS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5NTS2" } ] }, { "ec_number": "4.2.1.1", "activity": "", "evidence": [ { "id": "A0A1D5NTS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5NTS2" } ] } ] }, { "uniprot_ac": "A0A1D5NX31", "gene_name": "CA13", "activity": [ { "ec_number": "4.2.1.1", "activity": "H(+) + hydrogencarbonate = CO2 + H2O.", "evidence": [ { "id": "A0A1D5NX31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5NX31" } ] }, { "ec_number": "4.2.1.1", "activity": "", "evidence": [ { "id": "A0A1D5NX31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5NX31" } ] } ] }, { "uniprot_ac": "A0A1D5P5F4", "gene_name": "CA3B", "activity": [ { "ec_number": "4.2.1.1", "activity": "H(+) + hydrogencarbonate = CO2 + H2O.", "evidence": [ { "id": "A0A1D5P5F4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5P5F4" } ] }, { "ec_number": "4.2.1.1", "activity": "", "evidence": [ { "id": "A0A1D5P5F4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5P5F4" } ] } ] }, { "uniprot_ac": "A0A8V0XZG4", "gene_name": "CA7", "activity": [ { "ec_number": "4.2.1.1", "activity": "H(+) + hydrogencarbonate = CO2 + H2O.", "evidence": [ { "id": "A0A8V0XZG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0XZG4" } ] }, { "ec_number": "4.2.1.1", "activity": "", "evidence": [ { "id": "A0A8V0XZG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0XZG4" } ] } ] }, { "uniprot_ac": "A0A8V0YA50", "gene_name": "CA5A", "activity": [ { "ec_number": "4.2.1.1", "activity": "H(+) + hydrogencarbonate = CO2 + H2O.", "evidence": [ { "id": "A0A8V0YA50", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0YA50" } ] }, { "ec_number": "4.2.1.1", "activity": "", "evidence": [ { "id": "A0A8V0YA50", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0YA50" } ] } ] }, { "uniprot_ac": "A0A8V0YF14", "gene_name": "CA9", "activity": [ { "ec_number": "4.2.1.1", "activity": "H(+) + hydrogencarbonate = CO2 + H2O.", "evidence": [ { "id": "A0A8V0YF14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0YF14" } ] }, { "ec_number": "4.2.1.1", "activity": "", "evidence": [ { "id": "A0A8V0YF14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0YF14" } ] } ] }, { "uniprot_ac": "A0A8V0Z0V6", "gene_name": "CA6", "activity": [ { "ec_number": "4.2.1.1", "activity": "H(+) + hydrogencarbonate = CO2 + H2O.", "evidence": [ { "id": "A0A8V0Z0V6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0Z0V6" } ] }, { "ec_number": "4.2.1.1", "activity": "", "evidence": [ { "id": "A0A8V0Z0V6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0Z0V6" } ] } ] }, { "uniprot_ac": "A0A8V0ZXU7", "gene_name": "CA12", "activity": [ { "ec_number": "4.2.1.1", "activity": "H(+) + hydrogencarbonate = CO2 + H2O.", "evidence": [ { "id": "A0A8V0ZXU7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZXU7" } ] }, { "ec_number": "4.2.1.1", "activity": "", "evidence": [ { "id": "A0A8V0ZXU7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V0ZXU7" } ] } ] }, { "uniprot_ac": "A0A8V1AKN8", "gene_name": "CA4", "activity": [ { "ec_number": "4.2.1.1", "activity": "H(+) + hydrogencarbonate = CO2 + H2O.", "evidence": [ { "id": "A0A8V1AKN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V1AKN8" } ] }, { "ec_number": "4.2.1.1", "activity": "", "evidence": [ { "id": "A0A8V1AKN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8V1AKN8" } ] } ] }, { "uniprot_ac": "P07630", "gene_name": "CA2", "activity": [ { "ec_number": "4.2.1.1", "activity": "H(+) + hydrogencarbonate = CO2 + H2O.", "evidence": [ { "id": "P07630", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07630" } ] }, { "ec_number": "4.2.1.1", "activity": "", "evidence": [ { "id": "P07630", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07630" } ] }, { "ec_number": "4.2.1.69", "activity": "urea = cyanamide + H2O.", "evidence": [ { "id": "P07630", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07630" } ] } ] } ], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5NTS2-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 262, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5NTS2-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "4.2.1.1", "ec_name": "H(+) + hydrogencarbonate = CO2 + H2O.", "evidence": [ { "id": "4.2.1.1", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:4.2.1.1" }, { "id": "4.2.1.1", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=4.2.1.1" } ] } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }