{ "uniprot_canonical_ac": "A0A1B0GWR9-1", "uniprot_ac": "A0A1B0GWR9", "uniprot_id": "A0A1B0GWR9_RAT", "mass": { "chemical_mass": 135299.0, "monoisotopic_mass": 135299.0 }, "refseq": {}, "gene_names": [ { "name": "Atp8b4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1B0GWR9", "id": "A0A1B0GWR9" } ], "protein_names": [ { "name": "Phospholipid-transporting ATPase", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GWR9/entry#names_and_taxonomy", "id": "A0A1B0GWR9" }, { "name": "7.6.2.1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GWR9/entry#names_and_taxonomy", "id": "A0A1B0GWR9" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GWR9", "url": "https://www.uniprot.org/uniprot/A0A1B0GWR9" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "gene": [ { "name": "Atp8b4", "url": "https://www.uniprot.org/uniprot/A0A1B0GWR9", "locus": { "chromosome": "3", "start_pos": 113556192, "end_pos": 113757225, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000031598", "url": "https://www.ensembl.org/id/ENSRNOG00000031598" } ] } } ], "crossref": [ { "id": "A0A1B0GWR9", "url": "https://alphafold.ebi.ac.uk/entry/A0A1B0GWR9", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSRNOG00000031598", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000031598", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd02073", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02073", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR001757", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001757", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006539", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006539", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008250", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008250", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018303", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018303", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023214", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023214", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023298", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023298", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023299", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023299", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032630", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032630", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032631", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032631", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036412", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036412", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044492", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044492", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PYGAFYS", "url": "https://omabrowser.org/oma/group/PYGAFYS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR24092", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24092", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24092:SF80", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24092:SF80", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13246", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13246", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF16209", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF16209", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF16212", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF16212", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-936837", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-936837", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_006224667", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006224667", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1306712", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1306712", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A1B0GWR9", "url": "https://www.uniprot.org/uniprot/A0A1B0GWR9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GWR9-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GWR9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZYK3", "url": "https://www.uniprot.org/uniprot/A0A8I5ZYK3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZYK3-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZYK3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q4KLY5", "url": "https://www.uniprot.org/uniprot/Q4KLY5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q4KLY5-1", "url": "https://www.uniprot.org/uniprot/Q4KLY5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMFCNEKKLLEVERVVKANDRDYNEKFQYADNRIHTSKYNILTFLPINLFEQFQRVANAYFLFLLILQLIPEISSLTWFTTIVPLVLVISMTAVKDATDDFFRHKSDNQVNNRQSEVLINSKLQNEKWMNVKVGDIIKLENNQFVAADLLLLSSSEPHGLCYVETAELDGETNLKVRQALPVTSELGADISSLAKFDGIVICEAPNNKLDRFSGVLSWKDSKHTLSNQKIILRGCVLRNTSWCFGMVLFAGPDTKLMQNSGKTKFKRTSIDRLMNTLVLWIFGFLVCLGIILAVGNSIWESEVGNQFRTSLFWREGEKSSLFSGFLTFWSYVIILNTLVPISLYVSVEVIRLGHSYFINWDRKMYYAAKAMPAEARTTTLNEELGQIEYIFSDKTGTLTQNIMTFKKCSINGRVYAGEVLDDLDQKKEITKKKEAVDFSGKSKSERTLHFFDHSLMESIELGDPKVHEFLRLLALCHTVMSEEDSAGQLVYQVQSPDEGALVTAARNFGFIFKSRTPETITIEELGTPVTYQLLAFLDFNNIRKRMSVIVRNPEGQIKLYSKGADTILFEKLHPSNEDLLSLTSDHLSEFAGEGLRTLAIAYRELDDKYFKMWQKMLEDANSAIAERDERISGLYEEIERDLMLLGATAVEDKLQEGVIETITSLSLANIKIWILTGDKQETAINIGYACNVLTDAMDAVFVITGNTAVEVREELRKAKENLLGQNTSFSNGHAVYENKQRLELDSGAGETVTGEYALVINGHSLAHALESDVEKDLLELACVCKTVVCCRVTPLQKAQVVELVKKHRNAVTLAIGDGANDVSMIKSAHIGIGISGQEGLQAVLASDYALAQFRYLQRLLLVHGRWSYYRMCKFLCYFFYKNFAFTLVHFWFAFYCGFSAQTVYDQWFITLFNIVYTSLPVLAMGVFDQDVSEQNSMDCPQLYEPGQLNLLFNKRRFFICVAHGIYTSLILFFIPYGAFYNVAAEDGQHIADYQSFAVTVATSLVIVVSVQIALDTSYWTVVNHVFIWGSVATYFSILLAMHSDGVFGIFPRQFPFVGNARRSLSQKFVWLVVLLTAVTSVMPVVVFRFLKMHLYPSLSDQIRRWQKAQRKERPLRSRRPQTRRSSSRRSGYAFAHQEGYGELITSGKNMRAKSPAPTSGLEKMLYSNTSWIGNLCKKTTDVVSGFSHDKTVKL", "length": 1194, "header": "tr|A0A1B0GWR9-1|A0A1B0GWR9_RAT Isoform 1 of Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8b4 PE=3 SV=2 CANONICAL=A0A1B0GWR9-1" }, "isoforms": [ { "isoform_ac": "A0A1B0GWR9-1", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GWR9/entry#A0A1B0GWR9-1", "sequence": { "sequence": "MMFCNEKKLLEVERVVKANDRDYNEKFQYADNRIHTSKYNILTFLPINLFEQFQRVANAYFLFLLILQLIPEISSLTWFTTIVPLVLVISMTAVKDATDDFFRHKSDNQVNNRQSEVLINSKLQNEKWMNVKVGDIIKLENNQFVAADLLLLSSSEPHGLCYVETAELDGETNLKVRQALPVTSELGADISSLAKFDGIVICEAPNNKLDRFSGVLSWKDSKHTLSNQKIILRGCVLRNTSWCFGMVLFAGPDTKLMQNSGKTKFKRTSIDRLMNTLVLWIFGFLVCLGIILAVGNSIWESEVGNQFRTSLFWREGEKSSLFSGFLTFWSYVIILNTLVPISLYVSVEVIRLGHSYFINWDRKMYYAAKAMPAEARTTTLNEELGQIEYIFSDKTGTLTQNIMTFKKCSINGRVYAGEVLDDLDQKKEITKKKEAVDFSGKSKSERTLHFFDHSLMESIELGDPKVHEFLRLLALCHTVMSEEDSAGQLVYQVQSPDEGALVTAARNFGFIFKSRTPETITIEELGTPVTYQLLAFLDFNNIRKRMSVIVRNPEGQIKLYSKGADTILFEKLHPSNEDLLSLTSDHLSEFAGEGLRTLAIAYRELDDKYFKMWQKMLEDANSAIAERDERISGLYEEIERDLMLLGATAVEDKLQEGVIETITSLSLANIKIWILTGDKQETAINIGYACNVLTDAMDAVFVITGNTAVEVREELRKAKENLLGQNTSFSNGHAVYENKQRLELDSGAGETVTGEYALVINGHSLAHALESDVEKDLLELACVCKTVVCCRVTPLQKAQVVELVKKHRNAVTLAIGDGANDVSMIKSAHIGIGISGQEGLQAVLASDYALAQFRYLQRLLLVHGRWSYYRMCKFLCYFFYKNFAFTLVHFWFAFYCGFSAQTVYDQWFITLFNIVYTSLPVLAMGVFDQDVSEQNSMDCPQLYEPGQLNLLFNKRRFFICVAHGIYTSLILFFIPYGAFYNVAAEDGQHIADYQSFAVTVATSLVIVVSVQIALDTSYWTVVNHVFIWGSVATYFSILLAMHSDGVFGIFPRQFPFVGNARRSLSQKFVWLVVLLTAVTSVMPVVVFRFLKMHLYPSLSDQIRRWQKAQRKERPLRSRRPQTRRSSSRRSGYAFAHQEGYGELITSGKNMRAKSPAPTSGLEKMLYSNTSWIGNLCKKTTDVVSGFSHDKTVKL", "length": 1194, "header": "tr|A0A1B0GWR9-1|A0A1B0GWR9_RAT Isoform 1 of Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8b4 PE=3 SV=2 CANONICAL=A0A1B0GWR9-1" }, "locus": { "chromosome": "3", "start_pos": 113746299, "end_pos": 113556793, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000092750.2", "url": "https://www.ensembl.org/id/ENSRNOT00000092750.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000075998.2", "url": "https://www.ensembl.org/id/ENSRNOP00000075998.2" } ] } }, { "isoform_ac": "A0A8I5ZYK3-1", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GWR9/entry#A0A8I5ZYK3-1", "sequence": { "sequence": "MPPTTLLQNEKWMNVKVGDIIKLENNQFVAADLLLLSSSEPHGLCYVETAELDGETNLKVRQALPVTSELGADISSLAKFDGIVICEAPNNKLDRFSGVLSWKDSKHTLSNQKIILRGCVLRNTSWCFGMVLFAGPDTKLMQNSGKTKFKRTSIDRLMNTLVLWIFGFLVCLGIILAVGNSIWESEVGNQFRTSLFWREGEKSSLFSGFLTFWSYVIILNTLVPISLYVSVEVIRLGHSYFINWDRKMYYAAKAMPAEARTTTLNEELGQIEYIFSDKTGTLTQNIMTFKKCSINGRVYAGEVLDDLDQKKEITKKKEAVDFSGKSKSERTLHFFDHSLMESIELGDPKVHEFLRLLALCHTVMSEEDSAGQLVYQVQSPDEGALVTAARNFGFIFKSRTPETITIEELGTPVTYQLLAFLDFNNIRKRMSVIVRNPEGQIKLYSKGADTILFEKLHPSNEDLLSLTSDHLSEFAGEGLRTLAIAYRELDDKYFKMWQKMLEDANSAIAERDERISGLYEEIERDLMLLGATAVEDKLQEGVIETITSLSLANIKIWILTGDKQETAINIGYACNVLTDAMDAVFVITGNTAVEVREELRKAKENLLGQNTSFSNGHAVYENKQRLELDSGAGETVTGEYALVINGHSLAHALESDVEKDLLELACVCKTVVCCRVTPLQKAQVVELVKKHRNAVTLAIGDGANDVSMIKSAHIGIGISGQEGLQAVLASDYALAQFRYLQRLLLVHGRWSYYRMCKFLCYFFYKNFAFTLVHFWFAFYCGFSAQTVYDQWFITLFNIVYTSLPVLAMGVFDQDVSEQNSMDCPQLYEPGQLNLLFNKRRFFICVAHGIYTSLILFFIPYGAFYNVAAEDGQHIADYQSFAVTVATSLVIVVSVQIALDTSYWTVVNHVFIWGSVATYFSILLAMHSDGVFGIFPRQFPFVGNARRSLSQKFVWLVVLLTAVTSVMPVVVFRFLKMHLYPSLSDQIRRWQKAQRKERPLRSRRPQTRRSSSRRSGYAFAHQEGYGELITSGKNMRAKSPAPTSGLEKMLYSNTSWIGNLCKKTTDVVSGFSHDKTVKL", "length": 1078, "header": "tr|A0A8I5ZYK3-1|A0A8I5ZYK3_RAT Computationally mapped isoform of Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8b4 PE=3 SV=1 CANONICAL=A0A1B0GWR9-1" }, "locus": { "chromosome": "3", "start_pos": 113695373, "end_pos": 113556793, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000104093.1", "url": "https://www.ensembl.org/id/ENSRNOT00000104093.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000084035.1", "url": "https://www.ensembl.org/id/ENSRNOP00000084035.1" } ] } }, { "isoform_ac": "Q4KLY5-1", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GWR9/entry#Q4KLY5-1", "sequence": { "sequence": "MDCPQLYEPGQLNLLFNKRRFFICVAHGIYTSLILFFIPYGAFYNVAAEDGQHIADYQSFAVTVATSLVIVVSVQIALDTSYWTVVNHVFIWGSVATYFSILLAMHSDGVFGIFPRQFPFVGNARRSLSQKFVWLVVLLTAVTSVMPVVVFRFLKMHLYPSLSDQIRRWQKAQRKERPLRSRRPQTRRSSSRRSGYAFAHQEGYGELITSGKNMRAKSPAPTSGLEKMLYSNTSWIGNLCKKTTDVVSGFSHDKTVKL", "length": 258, "header": "tr|Q4KLY5-1|A0A1B0GWR9_RAT Computationally mapped isoform of Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8b4 PE=3 SV=1 CANONICAL=A0A1B0GWR9-1" }, "locus": { "chromosome": "3", "start_pos": 113574726, "end_pos": 113556793, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000086357.3", "url": "https://www.ensembl.org/id/ENSRNOT00000086357.3" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000075586.3", "url": "https://www.ensembl.org/id/ENSRNOP00000075586.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool": "isoglyp", "mining_tool": "", "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "start_pos": 1158, "start_aa": "T", "end_pos": 1158, "end_aa": "T", "residue": "Thr", "site_lbl": "Thr1158", "evidence": [ { "id": "GLY_001157", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001157" } ], "filter_code": "00000000000000001000.00000000001000.1.01000" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool": "isoglyp", "mining_tool": "", "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "start_pos": 999, "start_aa": "T", "end_pos": 999, "end_aa": "T", "residue": "Thr", "site_lbl": "Thr999", "evidence": [ { "id": "GLY_001157", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001157" } ], "filter_code": "00000000000000001000.00000000001000.1.01000" } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [ { "id": "R-RNO-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-RNO-936837", "name": "Ion transport by P-type ATPases", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-936837", "resource": "Reactome", "description": "Ion transport by P-type ATPases" } ], "orthologs": [ { "uniprot_canonical_ac": "A2ANX3-1", "protein_name": "Phospholipid-transporting ATPase", "gene_name": "Atp8b4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MMFCNKKKLLEVERVVKANDRDYNEKFQYADNRIHTSKYNVLTFLPINLFEQLQRVANAYFLFLLILQLIPEISSLTWFTTIVPLVLVISMTAVKDATDDYFRHKSDNQVNNRQSKVLINSKLQNEKWMNVKVGDIIKLENNQFVAADLLLLSSSEPHGLCYVETAELDGETNLKVRQALPVTSELGADISSLAEFDGIVRCEAPNNKLDRFSGVLSWKDSKHALSNQKIILRGCVLRNTSWCFGMVLFAGPDTKLMQNSGKTKFKRTSIDRLMNTLVLWIFGFLVCLGIILAVGSSILESEVGDQFRTPPFWREGEKSFLFSGFLTFWSYVIILNTLVPISLYVSVEVIRLGHSYFINWDRKMYYASKAMPAEARTTTLNEELGQIEYIFSDKTGTLTQNIMTFKKCSINGRVYAGEVLDDPIQKKEITKEKEATDFSSKSKSEKTLHFFDQSLMESIELGDPKVHEFLRLLALCHTVMSEENSAGQLVYQVQSPDEGALVTAARNFGFIFKSRTPETITIEELGTPVTYQLLAFLDFNNIRKRMSVIVRNPEGRIKLYSKGADTILFEKLHPSNEDLQSLTSDHLSEFAGEGLRTLAIAYRELDDKYFKMWQKMLEDANSATLERDERISGLYEEIERDLMLLGATAVEDKLQEGVIETITSLSLANIKIWILTGDKQETAINIGYACNVLTDAMDALFVITGNTAGEVREELRKAKENLLGQSTSFSNGHAVYDNKQRLGLDAGAGEAVTGEYALVINGHSLAHALESDVENDLLELACVCKTVVCCRVTPLQKAQVVELVKKHRNAVTLAIGDGANDVSMIKSAHIGIGISGQEGLQAVLASDYALAQFRYLQRLLLVHGRWSYYRMCKFLCYFFYKNFAFTLVHFWFAFFCGFSAQTVYDQWFITLFNIVYTSLPVLAMGMFDQDINEQNSMDYPQLYEPGQLNLLFNKRRFFICVAHGIYTSLALFFIPYGAFYNVAAEDGQHIADLQSFAVTVATSLVIVVSIQIALDTSYWTVVNHVFIWGSVATYFSILLAMHSDGVFGIFPRHFPFVGNARHSLSQKFVWLVVLLTAVTSVMPVVVVRFLKMYLYPSLSDQIRRWQKAQRKKRPLRSRRPQTRRSSSRRSGYAFAHQEGYGELITSGKNMRAKSPAPASGLEKKLYNNTSWIENLCKKTTDAVSGFSHDKTVKL", "length": 1194 }, "evidence": [ { "id": "A0A1B0GWR9", "url": "https://omabrowser.org/oma/group/A0A1B0GWR9/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "F1MMX5-1", "protein_name": "Phospholipid-transporting ATPase", "gene_name": "ATP8B4", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MFCSKKKSLEVERIVKANDREYNEKFLYKDNRIHTSKYNILTFLPINLFEQFQRVANAYFLFLLILQLIPEISSLTWFTTIVPLVLVVTMTAVKDATDDYFRHKSDNQVNNRQSEVLIDSKLQNEKWMNVKVGDIIKLENNQFVAADLLLLSSSEPHGLCYIETAELDGETNLKVRHALSVTSELGADISRLAKFDGIVVCEAPNNKLDKFTGVLSWKGSKHSLNNEKIILRGCVLRNTSWCFGMVIFAGPDTKLMQNSGKTKFKRTSIDRLMNTLVLWIFGFLICLGTILAIGNSIWENQVGNQFRTFLFWNEGEKNSVFSGFLTFWSYIIILNTVVPISLYVSVEVIRLGHSYFINWDRKMYYSRKATPAEARTTTLNEELGQIEYVFSDKTGTLTQNIMTFKKCSINGRIYGEVHDDLGQKTDMTKKKETVGFSVSPQADRTFQFFDHHLMESIELGDPKVHEFLRLLALCHTVMSEENSAGQLIYQVQSPDEGALVTAAKNLGFIFKSRTPETITIEELGTLVTYQLLAFLDFNNFRKRMSVIVRNPEGQIKLYSKGADTILFERLHPSNEDLLTLTSDHLSEFAGEGLRTLAIAYRDLDDKYFREWHKMLEDANTSTDERDERIAGLYEEIEKDLMLLGATAVEDKLQDGVIETVTSLSLANIKIWVLTGDKQETAINIGYACNMLTDDMNDVFIIAGNTAAEVREELRKAKENLFGQNRIFSSGHVVFEKKQSLELDSVVEETVTGDYALIINGHSLAHALESDVKNDLLELACMCKTVICCRVTPLQKAQVVELVKKYRNAVTLAIGDGANDVSMIKSAHIGVGISGQEGLQAVLASDYSFAQFRYLQRLLLVHGRWSYVRMCKFLCYFFYKNFAFTLVHFWFGFFCGFSAQTVYDQWFITLFNIVYTSLPVLAMGIFDQDVSDQNSMDYPQLYRPGQLNLLFNKHEFFICMAHGIYTSLALFFIPYGAFHNMAGEDGQHTADYQSFAVTMATSLVIVVSVQIALDTSYWTVINHVFIWGSIATYFSILFTMHSNGIFGLFPNQFPFVGNARHSLTQKCTWLVILLTTVASVMPVVAFRFLKVDLFPTLSDQIRQWQKAQKKARPLRSRKPQTRRSSSRRSGYAFAHQEGYGELITSGKNMRAKNPPPTSGLEKTLYNSTSWIENLCKKTTDTVSSFSQDKTVKL", "length": 1192 }, "evidence": [ { "id": "A0A1B0GWR9", "url": "https://omabrowser.org/oma/group/A0A1B0GWR9/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "Q8TF62-1", "protein_name": "Probable phospholipid-transporting ATPase IM", "gene_name": "ATP8B4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MFCSEKKLREVERIVKANDREYNEKFQYADNRIHTSKYNILTFLPINLFEQFQRVANAYFLCLLILQLIPEISSLTWFTTIVPLVLVITMTAVKDATDDYFRHKSDNQVNNRQSEVLINSKLQNEKWMNVKVGDIIKLENNQFVAADLLLLSSSEPHGLCYVETAELDGETNLKVRHALSVTSELGADISRLAGFDGIVVCEVPNNKLDKFMGILSWKDSKHSLNNEKIILRGCILRNTSWCFGMVIFAGPDTKLMQNSGKTKFKRTSIDRLMNTLVLWIFGFLICLGIILAIGNSIWESQTGDQFRTFLFWNEGEKSSVFSGFLTFWSYIIILNTVVPISLYVSVEVIRLGHSYFINWDRKMYYSRKAIPAVARTTTLNEELGQIEYIFSDKTGTLTQNIMTFKRCSINGRIYGEVHDDLDQKTEITQEKEPVDFSVKSQADREFQFFDHHLMESIKMGDPKVHEFLRLLALCHTVMSEENSAGELIYQVQSPDEGALVTAARNFGFIFKSRTPETITIEELGTLVTYQLLAFLDFNNTRKRMSVIVRNPEGQIKLYSKGADTILFEKLHPSNEVLLSLTSDHLSEFAGEGLRTLAIAYRDLDDKYFKEWHKMLEDANAATEERDERIAGLYEEIERDLMLLGATAVEDKLQEGVIETVTSLSLANIKIWVLTGDKQETAINIGYACNMLTDDMNDVFVIAGNNAVEVREELRKAKQNLFGQNRNFSNGHVVCEKKQQLELDSIVEETITGDYALIINGHSLAHALESDVKNDLLELACMCKTVICCRVTPLQKAQVVELVKKYRNAVTLAIGDGANDVSMIKSAHIGVGISGQEGLQAVLASDYSFAQFRYLQRLLLVHGRWSYFRMCKFLCYFFYKNFAFTLVHFWFGFFCGFSAQTVYDQWFITLFNIVYTSLPVLAMGIFDQDVSDQNSVDCPQLYKPGQLNLLFNKRKFFICVLHGIYTSLVLFFIPYGAFYNVAGEDGQHIADYQSFAVTMATSLVIVVSVQIALDTSYWTFINHVFIWGSIAIYFSILFTMHSNGIFGIFPNQFPFVGNARHSLTQKCIWLVILLTTVASVMPVVAFRFLKVDLYPTLSDQIRRWQKAQKKARPPSSRRPRTRRSSSRRSGYAFAHQEGYGELITSGKNMRAKNPPPTSGLEKTHYNSTSWIENLCKKTTDTVSSFSQDKTVKL", "length": 1192 }, "evidence": [ { "id": "A0A1B0GWR9", "url": "https://omabrowser.org/oma/group/A0A1B0GWR9/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q9LVK9-1", "protein_name": "Probable phospholipid-transporting ATPase 7", "gene_name": "ALA7", "tax_id": 3702, "organism": "Arabidopsis thaliana", "sequence": { "sequence": "MGRRRIRSRIRKSHFYTFKCLRPKTLEDQGPHIINGPGYTRIVHCNQPHLHLAKVLRYTSNYVSTTRYNLITFLPKCLYEQFHRVANFYFLVAAILSVFPLSPFNKWSMIAPLIFVVGLSMGKEALEDWRRFMQDVKVNSRKATVHRGDGDFGRRKWKKLRVGDVVKVEKDQFFPADLLLLSSSYEDGICYVETMNLDGETNLKVKRCLDVTLPLERDDTFQSFSGTIKCEDPNPNLYTFVGNLEYDGQVYPLDPSQILLRDSKLRNTSYVYGVVVFTGHDTKVMQNSTKSPSKRSRIEKRMDYIIYTLFALLVLVSFISSLGFAVMTKMHMGDWWYLRPDKPERLTNPRNPFHAWVVHLITAVLLYGYLIPISLYVSIELVKVLQATFINQDLQMYDSESGTPAQARTSNLNEELGQVDTILSDKTGTLTCNQMDFLKCSIAGTSYGVRASEVELAAAKQMAIDLDEEQGEEVTHLPRTRGRMHGYAKMPSKTSSDIELETVITATDEGDQTQSTGIKGFSFEDQRLMGGNWLNEPNSDDILMFLRILAVCHTAIPEVDEDTGKCTYEAESPDEVAFLVAAGEFGFEFTKRTQSSVFISERHSGQPVEREYKVLNVLDFTSKRKRMSVIVRDEKGQILLLCKGADSIIFERLSKNGKNYLEATSKHLNGYGEAGLRTLALSYRKLDETEYSIWNSEFHKAKTSVGADRDEMLEKVSDMMEKELILVGATAVEDKLQKGVPQCIDKLAQAGLKIWVLTGDKMETAINIGYACSLLRQGMKQIYIALRNEEGSSQDPEAAARENILMQIINASQMIKLEKDPHAAFALIIDGKTLTYALEDDIKYQFLALAVDCASVICCRVSPKQKALVTRLAKEGTGKTTLAIGDGANDVGMIQEADIGVGISGVEGMQAVMASDFSIAQFRFLERLLVVHGHWCYKRIAQMICYFFYKNITFGLTLFYFEAFTGFSGQAIYNDSYLLLFNVILTSLPVIALGVFEQDVSSEVCLQFPALYQQGPKNLFFDWYRIIGWMANGVYASVVIFSLNIGIFHVQSFCSGGQTADMDAMGTAMFTCIIWAVNVQIALTMSHFTWIQHVLIWGSIVTWYIFLALFGMLPPKVSGNIFHMLSETLAPAPIFWLTSLLVIAATTLPYLAYISFQRSLNPLDHHIIQEIKHFRIDVQDECMWTRERSKAREKTKIGVTARVDAKIRQLRGRLQRKHSILSVMSGLSGVSASTDTTSTTQHS", "length": 1243 }, "evidence": [ { "id": "A0A1B0GWR9", "url": "https://omabrowser.org/oma/group/A0A1B0GWR9/", "database": "OMA" } ], "glygen_name": "Arabidopsis", "common_name": "Mouse-ear cress" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "magnesium ion binding", "id": "GO:0000287", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000287", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GWR9", "url": "https://www.uniprot.org/uniprot/A0A1B0GWR9" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GWR9", "url": "https://www.uniprot.org/uniprot/A0A1B0GWR9" } ], "pmid": "" }, { "name": "ATP hydrolysis activity", "id": "GO:0016887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016887", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GWR9", "url": "https://www.uniprot.org/uniprot/A0A1B0GWR9" } ], "pmid": "" }, { "name": "ATPase-coupled intramembrane lipid transporter activity", "id": "GO:0140326", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140326", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GWR9", "url": "https://www.uniprot.org/uniprot/A0A1B0GWR9" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GWR9", "url": "https://www.uniprot.org/uniprot/A0A1B0GWR9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GWR9", "url": "https://www.uniprot.org/uniprot/A0A1B0GWR9" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GWR9", "url": "https://www.uniprot.org/uniprot/A0A1B0GWR9" } ], "pmid": "" }, { "name": "phospholipid-translocating ATPase complex", "id": "GO:1990531", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990531", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GWR9", "url": "https://www.uniprot.org/uniprot/A0A1B0GWR9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "phospholipid transport", "id": "GO:0015914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015914", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GWR9", "url": "https://www.uniprot.org/uniprot/A0A1B0GWR9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1168, "end_pos": 1170, "annotation": "n_glycosylation_sequon" }, { "start_pos": 239, "end_pos": 241, "annotation": "n_glycosylation_sequon" }, { "start_pos": 726, "end_pos": 728, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-RNO-6798747", "name": "Exocytosis of tertiary granule membrane proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "plasma membrane, tertiary granule membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P62483-1", "P61107-1", "P70496-1", "Q2TL32-1", "A0A8I5ZTL7-1", "Q10743-1", "A0A1B0GWR9-1", "Q04970-1", "P29598-1", "P61227-1", "Q6P7A9-1", "A0A8I5ZV35-1" ], "evidence": [ { "id": "R-RNO-6798747", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798747" } ] }, { "id": "R-RNO-6799350", "name": "Exocytosis of specific granule membrane proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "plasma membrane, specific granule membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P62483-1", "P70496-1", "Q2TL32-1", "E9PTG8-1", "A0A8I5ZTL7-1", "Q10743-1", "Q5XIF5-1", "P23711-1", "A0A1B0GWR9-1", "D4AC45-1", "Q5XI42-1", "Q63072-1", "P97524-1", "P29598-1", "P61227-1", "P62836-1", "Q9ERM3-1", "A0A8I5ZV35-1", "A0A8I6GK94-1", "A0A8I5ZXX6-1" ], "evidence": [ { "id": "R-RNO-6799350", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6799350" } ] }, { "id": "R-RNO-939763", "name": "P-type ATPases type IV transport external-facing APLs to internal side of the plasma membrane", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A8I5ZV31-1", "A0A8I6GI47-1", "A0A8I6AJL0-1", "D3ZE62-1", "D4A4W5-1", "A0A8I5ZTL7-1", "D4AA47-1", "A0A1B0GWR9-1", "D3ZN41-1", "D4ABB8-1", "A0A0G2JWQ8-1", "A0A8I6GJC6-1", "A0A8I5ZQP3-1", "A0A8I5ZXX6-1" ], "evidence": [ { "id": "R-RNO-939763", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-939763" } ] }, { "id": "R-RNO-947591", "name": "P-type ATPases type IV transport internal-facing APLs to external side of the plasma membrane", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A8I5ZV31-1", "A0A8I6GI47-1", "A0A8I6AJL0-1", "D3ZE62-1", "D4A4W5-1", "A0A8I5ZTL7-1", "D4AA47-1", "A0A1B0GWR9-1", "D3ZN41-1", "D4ABB8-1", "A0A0G2JWQ8-1", "A0A8I6GJC6-1", "A0A8I5ZQP3-1", "A0A8I5ZXX6-1" ], "evidence": [ { "id": "R-RNO-947591", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-947591" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JWQ8", "gene_name": "Atp10a", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "A0A0G2JWQ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JWQ8" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "A0A0G2JWQ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JWQ8" } ] } ] }, { "uniprot_ac": "A0A1B0GWR9", "gene_name": "Atp8b4", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "A0A1B0GWR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1B0GWR9" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "A0A1B0GWR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1B0GWR9" } ] } ] }, { "uniprot_ac": "A0A8I5ZQP3", "gene_name": "Atp8a2", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "A0A8I5ZQP3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZQP3" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "A0A8I5ZQP3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZQP3" } ] } ] }, { "uniprot_ac": "A0A8I5ZTL7", "gene_name": "Atp11a", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "A0A8I5ZTL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZTL7" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "A0A8I5ZTL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZTL7" } ] } ] }, { "uniprot_ac": "A0A8I5ZV31", "gene_name": "Atp11c", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "A0A8I5ZV31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZV31" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "A0A8I5ZV31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZV31" } ] } ] }, { "uniprot_ac": "A0A8I5ZV35", "gene_name": "Ptprb", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "A0A8I5ZV35", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZV35" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "A0A8I5ZV35", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZV35" } ] } ] }, { "uniprot_ac": "A0A8I5ZXX6", "gene_name": "Atp8a1", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "A0A8I5ZXX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZXX6" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "A0A8I5ZXX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZXX6" } ] } ] }, { "uniprot_ac": "A0A8I6AJL0", "gene_name": "Atp11b", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "A0A8I6AJL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AJL0" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "A0A8I6AJL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AJL0" } ] } ] }, { "uniprot_ac": "A0A8I6GI47", "gene_name": "Atp9a", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "A0A8I6GI47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6GI47" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "A0A8I6GI47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6GI47" } ] } ] }, { "uniprot_ac": "A0A8I6GJC6", "gene_name": "Atp8b2", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "A0A8I6GJC6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6GJC6" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "A0A8I6GJC6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6GJC6" } ] } ] }, { "uniprot_ac": "A0A8I6GK94", "gene_name": "Ptprj", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "A0A8I6GK94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6GK94" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "A0A8I6GK94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6GK94" } ] } ] }, { "uniprot_ac": "D3ZE62", "gene_name": "Atp8b3", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "D3ZE62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZE62" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "D3ZE62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZE62" } ] } ] }, { "uniprot_ac": "D3ZN41", "gene_name": "Atp10d", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "D3ZN41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZN41" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "D3ZN41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZN41" } ] } ] }, { "uniprot_ac": "D4A4W5", "gene_name": "Atp10b", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "D4A4W5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A4W5" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "D4A4W5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A4W5" } ] } ] }, { "uniprot_ac": "D4AA47", "gene_name": "Atp8b1", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "D4AA47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AA47" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "D4AA47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AA47" } ] } ] }, { "uniprot_ac": "D4ABB8", "gene_name": "Atp9b", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "D4ABB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ABB8" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "D4ABB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ABB8" } ] } ] }, { "uniprot_ac": "D4AC45", "gene_name": "Agpat2", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "D4AC45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AC45" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "D4AC45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AC45" } ] } ] }, { "uniprot_ac": "E9PTG8", "gene_name": "Stk10", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "E9PTG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PTG8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "E9PTG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PTG8" } ] } ] }, { "uniprot_ac": "P23711", "gene_name": "Hmox2", "activity": [ { "ec_number": "1.14.14.18", "activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P23711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23711" } ] }, { "ec_number": "1.14.14.18", "activity": "", "evidence": [ { "id": "P23711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23711" } ] } ] }, { "uniprot_ac": "P29598", "gene_name": "Plau", "activity": [ { "ec_number": "3.4.21.73", "activity": "Specific cleavage of Arg-|-Val bond in plasminogen to form plasmin.", "evidence": [ { "id": "P29598", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29598" } ] }, { "ec_number": "3.4.21.73", "activity": "", "evidence": [ { "id": "P29598", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29598" } ] } ] }, { "uniprot_ac": "P61107", "gene_name": "Rab14", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61107", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61107" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61107", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61107" } ] } ] }, { "uniprot_ac": "P61227", "gene_name": "Rap2b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61227" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61227" } ] } ] }, { "uniprot_ac": "P62483", "gene_name": "Kcnab2", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "P62483", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62483" } ] } ] }, { "uniprot_ac": "P62836", "gene_name": "Rap1a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62836", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62836" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62836", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62836" } ] } ] }, { "uniprot_ac": "P70496", "gene_name": "Pld1", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "P70496", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70496" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "P70496", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70496" } ] } ] }, { "uniprot_ac": "P97524", "gene_name": "Slc27a2", "activity": [ { "ec_number": "6.2.1.3", "activity": "a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "P97524", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97524" } ] }, { "ec_number": "6.2.1.3", "activity": "", "evidence": [ { "id": "P97524", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97524" } ] }, { "ec_number": "6.2.1.-", "activity": "", "evidence": [ { "id": "P97524", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97524" } ] }, { "ec_number": "6.2.1.7", "activity": "(25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oate + ATP + CoA = (25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "P97524", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97524" } ] }, { "ec_number": "6.2.1.24", "activity": "3,7,11,15-tetramethylhexadecanoate + ATP + CoA = AMP + diphosphate + phytanoyl-CoA.", "evidence": [ { "id": "P97524", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97524" } ] }, { "ec_number": "6.2.1.15", "activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + ATP + CoA = (5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "P97524", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97524" } ] } ] }, { "uniprot_ac": "Q04970", "gene_name": "Nras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q04970", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04970" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q04970", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04970" } ] } ] }, { "uniprot_ac": "Q10743", "gene_name": "Adam10", "activity": [ { "ec_number": "3.4.24.81", "activity": "Endopeptidase of broad specificity.", "evidence": [ { "id": "Q10743", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q10743" } ] }, { "ec_number": "3.4.24.81", "activity": "", "evidence": [ { "id": "Q10743", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q10743" } ] } ] }, { "uniprot_ac": "Q2TL32", "gene_name": "Ubr4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q2TL32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TL32" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q2TL32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TL32" } ] } ] }, { "uniprot_ac": "Q5XI42", "gene_name": "Aldh3b1", "activity": [ { "ec_number": "1.2.1.5", "activity": "an aldehyde + H2O + NAD(+) = a carboxylate + 2 H(+) + NADH.", "evidence": [ { "id": "Q5XI42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI42" } ] }, { "ec_number": "1.2.1.28", "activity": "benzaldehyde + H2O + NAD(+) = benzoate + 2 H(+) + NADH.", "evidence": [ { "id": "Q5XI42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI42" } ] }, { "ec_number": "1.2.1.7", "activity": "benzaldehyde + H2O + NADP(+) = benzoate + 2 H(+) + NADPH.", "evidence": [ { "id": "Q5XI42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI42" } ] }, { "ec_number": "1.2.1.5", "activity": "", "evidence": [ { "id": "Q5XI42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI42" } ] }, { "ec_number": "1.2.1.7", "activity": "", "evidence": [ { "id": "Q5XI42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI42" } ] }, { "ec_number": "1.2.1.28", "activity": "", "evidence": [ { "id": "Q5XI42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI42" } ] } ] }, { "uniprot_ac": "Q5XIF5", "gene_name": "Degs1", "activity": [ { "ec_number": "1.14.19.17", "activity": "an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acylsphing-4-enine + 2 Fe(III)-[cytochrome b5] + 2 H2O.", "evidence": [ { "id": "Q5XIF5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIF5" } ] }, { "ec_number": "5.2.1.-", "activity": "", "evidence": [ { "id": "Q5XIF5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIF5" } ] }, { "ec_number": "1.14.19.17", "activity": "", "evidence": [ { "id": "Q5XIF5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIF5" } ] } ] }, { "uniprot_ac": "Q63072", "gene_name": "Bst1", "activity": [ { "ec_number": "3.2.2.6", "activity": "H2O + NAD(+) = ADP-D-ribose + H(+) + nicotinamide.", "evidence": [ { "id": "Q63072", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63072" } ] }, { "ec_number": "3.2.2.6", "activity": "", "evidence": [ { "id": "Q63072", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63072" } ] } ] }, { "uniprot_ac": "Q6P7A9", "gene_name": "Gaa", "activity": [ { "ec_number": "3.2.1.20", "activity": "Hydrolysis of terminal, non-reducing (1->4)-linked alpha-D-glucose residues with release of alpha-D-glucose.", "evidence": [ { "id": "Q6P7A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P7A9" } ] }, { "ec_number": "3.2.1.20", "activity": "", "evidence": [ { "id": "Q6P7A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P7A9" } ] } ] }, { "uniprot_ac": "Q9ERM3", "gene_name": "Dgat1", "activity": [ { "ec_number": "2.3.1.20", "activity": "a 1,2-diacyl-sn-glycerol + an acyl-CoA = a triacyl-sn-glycerol + CoA.", "evidence": [ { "id": "Q9ERM3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERM3" } ] }, { "ec_number": "2.3.1.76", "activity": "all-trans-retinol + an acyl-CoA = an all-trans-retinyl ester + CoA.", "evidence": [ { "id": "Q9ERM3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERM3" } ] }, { "ec_number": "2.3.1.20", "activity": "", "evidence": [ { "id": "Q9ERM3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERM3" } ] } ] } ], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1B0GWR9-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 1194, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1B0GWR9-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "7.6.2.1", "ec_name": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "7.6.2.1", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=7.6.2.1" } ] } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 999, 1158 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 1168, "end_pos": 1170 }, { "start_pos": 239, "end_pos": 241 }, { "start_pos": 726, "end_pos": 728 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }