{ "uniprot_canonical_ac": "A0A178VEK7-1", "uniprot_ac": "A0A178VEK7", "uniprot_id": "DUO1_ARATH", "mass": { "chemical_mass": 34065.0, "monoisotopic_mass": 34065.0 }, "refseq": { "ac": "NP_191605", "name": "myb-like HTH transcriptional regulator family protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_191605" }, "gene_names": [ { "name": "DUO1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A178VEK7", "id": "A0A178VEK7" }, { "name": "DUO POLLEN 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_191605", "id": "NP_191605" }, { "name": "DUO1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_191605", "id": "NP_191605" }, { "name": "MYB125", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A178VEK7", "id": "A0A178VEK7" }, { "name": "T8B10.120", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A178VEK7", "id": "A0A178VEK7" } ], "protein_names": [ { "name": "Transcription factor DUO1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A178VEK7/entry#names_and_taxonomy", "id": "A0A178VEK7" }, { "name": "AtMYB125", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A178VEK7/entry#names_and_taxonomy", "id": "A0A178VEK7" }, { "name": "Myb-related protein 125", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A178VEK7/entry#names_and_taxonomy", "id": "A0A178VEK7" }, { "name": "Protein DUO POLLEN 1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A178VEK7/entry#names_and_taxonomy", "id": "A0A178VEK7" }, { "name": "myb-like HTH transcriptional regulator family protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_191605", "id": "NP_191605" } ], "function": [ { "annotation": "Transcription activator that acts as a positive regulator of male germline development by promoting both gametic cell specification and cell cycle progression (PubMed:15618418, PubMed:15694308, PubMed:19300502, PubMed:21285328). Binds to canonical MYB sites 5'-AACCGTC-3', 5'-AAACCGC-3' and 5'-AACCGT-3' in promoters to trigger the expression of male germline-specific or enriched genes (e.g. MGH3, GEX2 and GCS1), including those required for fertilization (PubMed:19300502, PubMed:21285328). Required for sperm cell specification leading to pollen maturation by activating a germline-specific regulon (PubMed:15618418, PubMed:15694308, PubMed:19300502, PubMed:21285328). Involved in pollen mitosis entry at G2-M transition via the regulation of CYCB1-1, DAZ1 and DAZ2 expression (PubMed:15618418, PubMed:19300502, PubMed:24876252).", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7#function" }, { "database": "PubMed", "id": "15694308", "url": "https://glygen.org/publication/PubMed/15694308" }, { "database": "PubMed", "id": "19300502", "url": "https://glygen.org/publication/PubMed/19300502" }, { "database": "PubMed", "id": "15618418", "url": "https://glygen.org/publication/PubMed/15618418" }, { "database": "PubMed", "id": "24876252", "url": "https://glygen.org/publication/PubMed/24876252" }, { "database": "PubMed", "id": "21285328", "url": "https://glygen.org/publication/PubMed/21285328" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "gene": [ { "name": "DUO1", "url": "https://www.uniprot.org/uniprot/A0A178VEK7", "locus": { "chromosome": "3", "start_pos": 22342321, "end_pos": 22343576, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "AT3G60460", "url": "https://www.ensemblgenomes.org/id/AT3G60460" } ] } } ], "crossref": [ { "id": "A0A178VEK7", "url": "https://alphafold.ebi.ac.uk/entry/A0A178VEK7", "database": "AlphaFoldDB", "categories": [] }, { "id": "AT3G60460", "url": "https://bar.utoronto.ca/thalemine/portal.do?externalids=AT3G60460", "database": "Araport", "categories": [ "Protein", "Organism-specific" ] }, { "id": "cd00167", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00167", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "825217", "url": "https://www.ncbi.nlm.nih.gov/gene/825217", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001005", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001005", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017930", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017930", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR053106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR053106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ath:AT3G60460", "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT3G60460", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FEPNMLM", "url": "https://omabrowser.org/oma/group/FEPNMLM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A178VEK7", "url": "https://www.orthodb.org/?gene=A0A178VEK7", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR47996", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47996", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47996:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47996:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00249", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00249", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A178VEK7", "url": "http://purl.obolibrary.org/obo/PR_A0A178VEK7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_191605", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_191605", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "AT3G60460", "url": "https://www.arabidopsis.org/servlets/TairObject?type=locus&name=AT3G60460", "database": "TAIR", "categories": [ "Protein", "Organism-specific" ] }, { "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A178VEK7-1", "url": "https://www.uniprot.org/uniprot/A0A178VEK7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRKMEAKKEEIKKGPWKAEEDEVLINHVKRYGPRDWSSIRSKGLLQRTGKSCRLRWVNKLRPNLKNGCKFSADEERTVIELQSEFGNKWARIATYLPGRTDNDVKNFWSSRQKRLARILHNSSDASSSSFNPKSSSSHRLKGKNVKPIRQSSQGFGLVEEEVTVSSSCSQMVPYSSDQVGDEVLRLPDLGVKLEHQPFAFGTDLVLAEYSDSQNDANQQAISPFSPESRELLARLDDPFYYDILGPADSSEPLFALPQPFFEPSPVPRRCRHVSKDEEADVFLDDFPADMFDQVDPIPSP", "length": 300, "header": "sp|A0A178VEK7-1|DUO1_ARATH Isoform 1 of Transcription factor DUO1 OS=Arabidopsis thaliana OX=3702 GN=DUO1 PE=1 SV=1 CANONICAL=A0A178VEK7-1" }, "isoforms": [ { "isoform_ac": "A0A178VEK7-1", "url": "https://www.uniprot.org/uniprotkb/A0A178VEK7/entry#A0A178VEK7-1", "sequence": { "sequence": "MRKMEAKKEEIKKGPWKAEEDEVLINHVKRYGPRDWSSIRSKGLLQRTGKSCRLRWVNKLRPNLKNGCKFSADEERTVIELQSEFGNKWARIATYLPGRTDNDVKNFWSSRQKRLARILHNSSDASSSSFNPKSSSSHRLKGKNVKPIRQSSQGFGLVEEEVTVSSSCSQMVPYSSDQVGDEVLRLPDLGVKLEHQPFAFGTDLVLAEYSDSQNDANQQAISPFSPESRELLARLDDPFYYDILGPADSSEPLFALPQPFFEPSPVPRRCRHVSKDEEADVFLDDFPADMFDQVDPIPSP", "length": 300, "header": "sp|A0A178VEK7-1|DUO1_ARATH Isoform 1 of Transcription factor DUO1 OS=Arabidopsis thaliana OX=3702 GN=DUO1 PE=1 SV=1 CANONICAL=A0A178VEK7-1" }, "locus": { "chromosome": "3", "start_pos": 22343500, "end_pos": 22342432, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "AT3G60460.1", "url": "https://www.ensemblgenomes.org/id/AT3G60460.1" }, { "database": "Ensembl Peptide", "id": "AT3G60460.1", "url": "https://www.ensemblgenomes.org/id/AT3G60460.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana.", "journal": "Nature", "date": "2000", "authors": "Salanoubat M, Lemcke K, Rieger M, Ansorge W, Unseld M, Fartmann B, Valle G, Bl\u00f6cker H, Perez-Alonso M, Obermaier B, Delseny M, Boutry M, Grivell L A, Mache R, Puigdom\u00e8nech P, De Simone V, Choisne N, Artiguenave F, Robert C, Brottier P, Wincker P, Cattolico L, Weissenbach J, Saurin W, Qu\u00e9tier F, Sch\u00e4fer M, M\u00fcller-Auer S, Gabel C, Fuchs M, Benes V, Wurmbach E, Drzonek H, Erfle H, Jordan N, Bangert S, Wiedelmann R, Kranz H, Voss H, Holland R, Brandt P, Nyakatura G, Vezzi A, D'Angelo M, Pallavicini A, Toppo S, Simionati B, Conrad A, Hornischer K, Kauer G, L\u00f6hnert T H, Nordsiek G, Reichelt J, Scharfe M, Sch\u00f6n O, Bargues M, Terol J, Climent J, Navarro P, Collado C, Perez-Perez A, Ottenw\u00e4lder B, Duchemin D, Cooke R, Laudie M, Berger-Llauro C, Purnelle B, Masuy D, de Haan M, Maarse A C, Alcaraz J P, Cottet A, Casacuberta E, Monfort A, Argiriou A, flores M, Liguori R, Vitale D, Mannhaupt G, Haase D, Schoof H, Rudd S, Zaccaria P, Mewes H W, Mayer K F, Kaul S, Town C D, Koo H L, Tallon L J, Jenkins J, Rooney T, Rizzo M, Walts A, Utterback T, Fujii C Y, Shea T P, Creasy T H, Haas B, Maiti R, Wu D, Peterson J, Van Aken S, Pai G, Militscher J, Sellers P, Gill J E, Feldblyum T V, Preuss D, Lin X, Nierman W C, Salzberg S L, White O, Venter J C, Fraser C M, Kaneko T, Nakamura Y, Sato S, Kato T, Asamizu E, Sasamoto S, Kimura T, Idesawa K, Kawashima K, Kishida Y, Kiyokawa C, Kohara M, Matsumoto M, Matsuno A, Muraki A, Nakayama S, Nakazaki N, Shinpo S, Takeuchi C, Wada T, Watanabe A, Yamada M, Yasuda M, Tabata S, , ,", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "reference": [ { "type": "PubMed", "id": "11130713", "url": "https://glygen.org/publication/PubMed/11130713" } ] }, { "title": "Identification of conserved gene structures and carboxy-terminal motifs in the Myb gene family of Arabidopsis and Oryza sativa L. ssp. indica.", "journal": "Genome Biol.", "date": "2004", "authors": "Jiang Cizhong, Gu Xun, Peterson Thomas", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "reference": [ { "type": "PubMed", "id": "15239831", "url": "https://glygen.org/publication/PubMed/15239831" } ] }, { "title": "Male germ line development in Arabidopsis. duo pollen mutants reveal gametophytic regulators of generative cell cycle progression.", "journal": "Plant physiology", "date": "2005-01", "authors": "Durbarry Anjusha, Vizir Igor, Twell David", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "reference": [ { "type": "PubMed", "id": "15618418", "url": "https://glygen.org/publication/PubMed/15618418" } ] }, { "title": "A novel class of MYB factors controls sperm-cell formation in plants.", "journal": "Current biology : CB", "date": "2005-02-08", "authors": "Rotman Nicolas, Durbarry Anjusha, Wardle Anthony, Yang Wei Cai, Chaboud Annie, Faure Jean-Emmanuel, Berger Fr\u00e9d\u00e9ric, Twell David", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "reference": [ { "type": "PubMed", "id": "15694308", "url": "https://glygen.org/publication/PubMed/15694308" } ] }, { "title": "A plant germline-specific integrator of sperm specification and cell cycle progression.", "journal": "PLoS genetics", "date": "2009-03", "authors": "Brownfield Lynette, Hafidh Said, Borg Michael, Sidorova Anna, Mori Toshiyuki, Twell David", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "reference": [ { "type": "PubMed", "id": "19300502", "url": "https://glygen.org/publication/PubMed/19300502" } ] }, { "title": "The R2R3 MYB transcription factor DUO1 activates a male germline-specific regulon essential for sperm cell differentiation in Arabidopsis.", "journal": "The Plant cell", "date": "2011-02", "authors": "Borg Michael, Brownfield Lynette, Khatab Hoda, Sidorova Anna, Lingaya Melanie, Twell David", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "reference": [ { "type": "PubMed", "id": "21285328", "url": "https://glygen.org/publication/PubMed/21285328" } ] }, { "title": "The anaphase-promoting complex is a dual integrator that regulates both MicroRNA-mediated transcriptional regulation of cyclin B1 and degradation of Cyclin B1 during Arabidopsis male gametophyte development.", "journal": "Plant Cell", "date": "2011", "authors": "Zheng Binglian, Chen Xuemei, McCormick Sheila", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "reference": [ { "type": "PubMed", "id": "21441434", "url": "https://glygen.org/publication/PubMed/21441434" } ] }, { "title": "Gamete fusion is required to block multiple pollen tubes from entering an Arabidopsis ovule.", "journal": "Curr. Biol.", "date": "2012", "authors": "Beale Kristin M, Leydon Alexander R, Johnson Mark A", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "reference": [ { "type": "PubMed", "id": "22608506", "url": "https://glygen.org/publication/PubMed/22608506" } ] }, { "title": "An EAR-Dependent Regulatory Module Promotes Male Germ Cell Division and Sperm Fertility in Arabidopsis.", "journal": "The Plant cell", "date": "2014-05", "authors": "Borg Michael, Rutley Nicholas, Kagale Sateesh, Hamamura Yuki, Gherghinoiu Mihai, Kumar Sanjeev, Sari Ugur, Esparza-Franco Manuel A, Sakamoto Wataru, Rozwadowski Kevin, Higashiyama Tetsuya, Twell David", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "reference": [ { "type": "PubMed", "id": "24876252", "url": "https://glygen.org/publication/PubMed/24876252" } ] }, { "title": "An ARID domain-containing protein within nuclear bodies is required for sperm cell formation in Arabidopsis thaliana.", "journal": "PLoS Genet.", "date": "2014", "authors": "Zheng Binglian, He Hui, Zheng Yanhua, Wu Wenye, McCormick Sheila", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "reference": [ { "type": "PubMed", "id": "25057814", "url": "https://glygen.org/publication/PubMed/25057814" } ] }, { "title": "A conserved cis-regulatory module determines germline fate through activation of the transcription factor DUO1 promoter.", "journal": "Plant Physiol.", "date": "2017", "authors": "Peters Benjamin, Casey Jonathan, Aidley Jack, Zohrab Stuart, Borg Michael, Twell David, Brownfield Lynette", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "reference": [ { "type": "PubMed", "id": "27624837", "url": "https://glygen.org/publication/PubMed/27624837" } ] }, { "title": "Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.", "journal": "Plant J.", "date": "2017", "authors": "Cheng Chia-Yi, Krishnakumar Vivek, Chan Agnes P, Thibaud-Nissen Fran\u00e7oise, Schobel Seth, Town Christopher D", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "reference": [ { "type": "PubMed", "id": "27862469", "url": "https://glygen.org/publication/PubMed/27862469" } ] } ], "pathway": [ { "id": "ath:AT3G60460", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT3G60460", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "pmid": "" }, { "name": "sequence-specific DNA binding", "id": "GO:0043565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043565", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "pmid": "" }, { "name": "generative cell nucleus", "id": "GO:0048555", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048555", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "pmid": "" }, { "name": "cell cycle G2/M phase transition", "id": "GO:0044839", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044839", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "pmid": "" }, { "name": "generative cell mitosis", "id": "GO:0055047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055047", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "pmid": "" }, { "name": "pollen sperm cell differentiation", "id": "GO:0048235", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048235", "evidence": [ { "database": "UniProtKB", "id": "A0A178VEK7", "url": "https://www.uniprot.org/uniprot/A0A178VEK7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 121, "end_pos": 123, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A178VEK7-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 300, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A178VEK7-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 121, "end_pos": 123 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }