{
    "uniprot_canonical_ac": "A0A178UVL2-1",
    "uniprot_ac": "A0A178UVL2",
    "uniprot_id": "A0A178UVL2_ARATH",
    "mass": {
        "chemical_mass": 8246.0,
        "monoisotopic_mass": 8246.0
    },
    "refseq": {
        "ac": "NP_001329393",
        "name": "Copper transport protein family",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001329393"
    },
    "gene_names": [
        {
            "name": "T32N4.11",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/A0A178UVL2",
            "id": "A0A178UVL2"
        },
        {
            "name": "C17L7.9",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001329393",
            "id": "NP_001329393"
        },
        {
            "name": "C17L7.9",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/A0A178UVL2",
            "id": "A0A178UVL2"
        }
    ],
    "protein_names": [
        {
            "name": "CCSA",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprotkb/A0A178UVL2/entry#names_and_taxonomy",
            "id": "A0A178UVL2"
        },
        {
            "name": "Copper transport protein family",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001329393",
            "id": "NP_001329393"
        },
        {
            "name": "Copper transport protein family",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprotkb/A0A178UVL2/entry#names_and_taxonomy",
            "id": "A0A178UVL2"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Arabidopsis thaliana",
            "taxid": 3702,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A178UVL2",
                    "url": "https://www.uniprot.org/uniprot/A0A178UVL2"
                }
            ],
            "common_name": "Mouse-ear cress",
            "glygen_name": "Arabidopsis",
            "reference_species": "Arabidopsis thaliana [3702]"
        }
    ],
    "gene": [
        {
            "name": "",
            "url": "https://www.uniprot.org/uniprot/A0A178UVL2",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "A0A178UVL2",
            "url": "https://alphafold.ebi.ac.uk/entry/A0A178UVL2",
            "database": "AlphaFoldDB",
            "categories": []
        },
        {
            "id": "AT4G05030",
            "url": "https://bar.utoronto.ca/thalemine/portal.do?externalids=AT4G05030",
            "database": "Araport",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "825845",
            "url": "https://www.ncbi.nlm.nih.gov/gene/825845",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR044296",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR044296",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "ath:AT4G05030",
            "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT4G05030",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "MRCEKCR",
            "url": "https://omabrowser.org/oma/group/MRCEKCR/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "Q9S9T4",
            "url": "https://www.orthodb.org/?gene=Q9S9T4",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR46371",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46371",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR46371:SF6",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46371:SF6",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_001329393",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001329393",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "AT4G05030",
            "url": "https://www.arabidopsis.org/servlets/TairObject?type=locus&name=AT4G05030",
            "database": "TAIR",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "A0A178UVL2",
            "url": "https://www.uniprot.org/uniprot/A0A178UVL2",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A178UVL2-1",
            "url": "https://www.uniprot.org/uniprot/A0A178UVL2-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9S9T4",
            "url": "https://www.uniprot.org/uniprot/Q9S9T4",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9S9T4-1",
            "url": "https://www.uniprot.org/uniprot/Q9S9T4-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MAKKILMSVSMRCDKCRSEALKIGAKTTGVTFVGIEGEEKDKVVVIGEGVDAACLVVRLRKKVGFADIISVTDVDDT",
        "length": 77,
        "header": "tr|A0A178UVL2-1|A0A178UVL2_ARATH Isoform 1 of CCSA  OS=Arabidopsis thaliana OX=3702 GN= PE=2 SV=1 CANONICAL=A0A178UVL2-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A178UVL2-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A178UVL2/entry#A0A178UVL2-1",
            "sequence": {
                "sequence": "MAKKILMSVSMRCDKCRSEALKIGAKTTGVTFVGIEGEEKDKVVVIGEGVDAACLVVRLRKKVGFADIISVTDVDDT",
                "length": 77,
                "header": "tr|A0A178UVL2-1|A0A178UVL2_ARATH Isoform 1 of CCSA  OS=Arabidopsis thaliana OX=3702 GN= PE=2 SV=1 CANONICAL=A0A178UVL2-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 2577448,
                "end_pos": 2576793,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "AT4G05030.2",
                        "url": "https://www.ensemblgenomes.org/id/AT4G05030.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "AT4G05030.2",
                        "url": "https://www.ensemblgenomes.org/id/AT4G05030.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q9S9T4-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A178UVL2/entry#Q9S9T4-1",
            "sequence": {
                "sequence": "MAIVGRSVRHLFAKTRNKGLVSFRAFYNSGPVVVLTKILMSVSMRCDKCRSEALKIGAKTTGVTFVGIEGEEKDKVVVIGEGVDAACLVVRLRKKVGFADIISVTDVDDT",
                "length": 110,
                "header": "tr|Q9S9T4-1|Q9S9T4_ARATH Computationally mapped isoform of AT4g05030 protein  OS=Arabidopsis thaliana OX=3702 GN=T32N4.11 PE=4 SV=1 CANONICAL=A0A178UVL2-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 2577974,
                "end_pos": 2576793,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "AT4G05030.1",
                        "url": "https://www.ensemblgenomes.org/id/AT4G05030.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "AT4G05030.1",
                        "url": "https://www.ensemblgenomes.org/id/AT4G05030.1"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [
        {
            "start_pos": 8,
            "end_pos": 8,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "A0A178UVL2",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A0A178UVL2"
                }
            ],
            "site_lbl": "Ser8"
        }
    ],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana.",
            "journal": "Nature",
            "date": "1999",
            "authors": "Mayer K, Sch\u00fcller C, Wambutt R, Murphy G, Volckaert G, Pohl T, D\u00fcsterh\u00f6ft A, Stiekema W, Entian K D, Terryn N, Harris B, Ansorge W, Brandt P, Grivell L, Rieger M, Weichselgartner M, de Simone V, Obermaier B, Mache R, M\u00fcller M, Kreis M, Delseny M, Puigdomenech P, Watson M, Schmidtheini T, Reichert B, Portatelle D, Perez-Alonso M, Boutry M, Bancroft I, Vos P, Hoheisel J, Zimmermann W, Wedler H, Ridley P, Langham S A, McCullagh B, Bilham L, Robben J, Van der Schueren J, Grymonprez B, Chuang Y J, Vandenbussche F, Braeken M, Weltjens I, Voet M, Bastiaens I, Aert R, Defoor E, Weitzenegger T, Bothe G, Ramsperger U, Hilbert H, Braun M, Holzer E, Brandt A, Peters S, van Staveren M, Dirske W, Mooijman P, Klein Lankhorst R, Rose M, Hauf J, K\u00f6tter P, Berneiser S, Hempel S, Feldpausch M, Lamberth S, Van den Daele H, De Keyser A, Buysshaert C, Gielen J, Villarroel R, De Clercq R, Van Montagu M, Rogers J, Cronin A, Quail M, Bray-Allen S, Clark L, Doggett J, Hall S, Kay M, Lennard N, McLay K, Mayes R, Pettett A, Rajandream M A, Lyne M, Benes V, Rechmann S, Borkova D, Bl\u00f6cker H, Scharfe M, Grimm M, L\u00f6hnert T H, Dose S, de Haan M, Maarse A, Sch\u00e4fer M, M\u00fcller-Auer S, Gabel C, Fuchs M, Fartmann B, Granderath K, Dauner D, Herzl A, Neumann S, Argiriou A, Vitale D, Liguori R, Piravandi E, Massenet O, Quigley F, Clabauld G, M\u00fcndlein A, Felber R, Schnabl S, Hiller R, Schmidt W, Lecharny A, Aubourg S, Chefdor F, Cooke R, Berger C, Montfort A, Casacuberta E, Gibbons T, Weber N, Vandenbol M, Bargues M, Terol J, Torres A, Perez-Perez A, Purnelle B, Bent E, Johnson S, Tacon D, Jesse T, Heijnen L, Schwarz S, Scholler P, Heber S, Francs P, Bielke C, Frishman D, Haase D, Lemcke K, Mewes H W, Stocker S, Zaccaria P, Bevan M, Wilson R K, de la Bastide M, Habermann K, Parnell L, Dedhia N, Gnoj L, Schutz K, Huang E, Spiegel L, Sehkon M, Murray J, Sheet P, Cordes M, Abu-Threideh J, Stoneking T, Kalicki J, Graves T, Harmon G, Edwards J, Latreille P, Courtney L, Cloud J, Abbott A, Scott K, Johnson D, Minx P, Bentley D, Fulton B, Miller N, Greco T, Kemp K, Kramer J, Fulton L, Mardis E, Dante M, Pepin K, Hillier L, Nelson J, Spieth J, Ryan E, Andrews S, Geisel C, Layman D, Du H, Ali J, Berghoff A, Jones K, Drone K, Cotton M, Joshu C, Antonoiu B, Zidanic M, Strong C, Sun H, Lamar B, Yordan C, Ma P, Zhong J, Preston R, Vil D, Shekher M, Matero A, Shah R, Swaby I K, O'Shaughnessy A, Rodriguez M, Hoffmann J, Till S, Granat S, Shohdy N, Hasegawa A, Hameed A, Lodhi M, Johnson A, Chen E, Marra M, Martienssen R, McCombie W R",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A178UVL2",
                    "url": "https://www.uniprot.org/uniprot/A0A178UVL2"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10617198",
                    "url": "https://glygen.org/publication/PubMed/10617198"
                }
            ]
        },
        {
            "title": "Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.",
            "journal": "Plant J.",
            "date": "2017",
            "authors": "Cheng Chia-Yi, Krishnakumar Vivek, Chan Agnes P, Thibaud-Nissen Fran\u00e7oise, Schobel Seth, Town Christopher D",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A178UVL2",
                    "url": "https://www.uniprot.org/uniprot/A0A178UVL2"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27862469",
                    "url": "https://glygen.org/publication/PubMed/27862469"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "ath:AT4G05030",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT4G05030",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {},
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "structures": [
        {
            "pdb_id": "AF-A0A178UVL2-F1",
            "pdb_chain": "global",
            "start_pos": 1,
            "end_pos": 77,
            "overlap": "1.0",
            "method": "AlphaFold",
            "type": "alphafold",
            "resolution": -1.0,
            "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A178UVL2-F1.pdb"
        }
    ],
    "synthesized_glycans": [],
    "enzyme_annotation": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        }
    ],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [
            8
        ],
        "sequon_annotation_sites": []
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}