{ "uniprot_canonical_ac": "A0A140TAL0-1", "uniprot_ac": "A0A140TAL0", "uniprot_id": "A0A140TAL0_PIG", "mass": { "chemical_mass": 45760.0, "monoisotopic_mass": 45760.0 }, "refseq": {}, "gene_names": [ { "name": "GMPPA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A140TAL0", "id": "A0A140TAL0" } ], "protein_names": [ { "name": "Mannose-1-phosphate guanyltransferase alpha", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A140TAL0/entry#names_and_taxonomy", "id": "A0A140TAL0" }, { "name": "GDP-mannose pyrophosphorylase A", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A140TAL0/entry#names_and_taxonomy", "id": "A0A140TAL0" }, { "name": "GTP-mannose-1-phosphate guanylyltransferase alpha", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A140TAL0/entry#names_and_taxonomy", "id": "A0A140TAL0" } ], "function": [ { "annotation": "May serve as a regulatory subunit and allow allosteric feedback inhibition of GMPPB by GDP-mannose.", "evidence": [ { "database": "UniProtKB", "id": "A0A140TAL0", "url": "https://www.uniprot.org/uniprot/A0A140TAL0#function" }, { "database": "UniProtKB", "id": "ARBA00037787", "url": "https://www.uniprot.org/uniprot/ARBA00037787#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Sus scrofa", "taxid": 9823, "evidence": [ { "database": "UniProtKB", "id": "A0A140TAL0", "url": "https://www.uniprot.org/uniprot/A0A140TAL0" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" } ], "gene": [ { "name": "GMPPA", "url": "https://www.uniprot.org/uniprot/A0A140TAL0", "locus": { "chromosome": "AORO02030541.1", "start_pos": 681592, "end_pos": 672061, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSSSCG00015036531", "url": "https://www.ensembl.org/id/ENSSSCG00015036531" } ] } } ], "crossref": [ { "id": "A0A140TAL0", "url": "https://alphafold.ebi.ac.uk/entry/A0A140TAL0", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSSSCG00000023935", "url": "https://bgee.org/?page=gene&gene_id=ENSSSCG00000023935", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd06428", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06428", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR001451", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001451", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005835", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005835", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018357", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018357", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029044", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029044", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050486", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050486", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR22572", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22572", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22572:SF104", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22572:SF104", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00132", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00132", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00483", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00483", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-446205", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-446205", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "A0A140TAL0", "url": "https://www.uniprot.org/uniprot/A0A140TAL0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140TAL0-1", "url": "https://www.uniprot.org/uniprot/A0A140TAL0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8W4FHN3", "url": "https://www.uniprot.org/uniprot/A0A8W4FHN3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8W4FHN3-1", "url": "https://www.uniprot.org/uniprot/A0A8W4FHN3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEPLTRFLEAAQQEFNLPIRYLQEFAPLGTGGGLYHFRDQILAGGPEAFFVLNADVCSDFPLSAMLDAHRHRPHPFLLLGTTANRTQSLNYGCIVENPQTHEVLHYVEKPSTFVSDIINCGIYLFSPEALKPLGEVFQRNQQDGQLEDSSVLWPGAGTIRLEQDVFAALAGQGQIYVHLTDGIWSQIKSAGSALYASRLYLSQYQLTHPERLAKSSLLLLGNVYIHPTAKVAPSAVLGPNVSIGEGVTVGEGVRLRESIVLHGATLQEHTCVLHSIVGWGSTVGRWARVEGTPNDPNPNDPRAHMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL", "length": 417, "header": "tr|A0A140TAL0-1|A0A140TAL0_PIG Isoform 1 of Mannose-1-phosphate guanyltransferase alpha OS=Sus scrofa OX=9823 GN=GMPPA PE=3 SV=3 CANONICAL=A0A140TAL0-1" }, "isoforms": [ { "isoform_ac": "A0A140TAL0-1", "url": "https://www.uniprot.org/uniprotkb/A0A140TAL0/entry#A0A140TAL0-1", "sequence": { "sequence": "MLKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEPLTRFLEAAQQEFNLPIRYLQEFAPLGTGGGLYHFRDQILAGGPEAFFVLNADVCSDFPLSAMLDAHRHRPHPFLLLGTTANRTQSLNYGCIVENPQTHEVLHYVEKPSTFVSDIINCGIYLFSPEALKPLGEVFQRNQQDGQLEDSSVLWPGAGTIRLEQDVFAALAGQGQIYVHLTDGIWSQIKSAGSALYASRLYLSQYQLTHPERLAKSSLLLLGNVYIHPTAKVAPSAVLGPNVSIGEGVTVGEGVRLRESIVLHGATLQEHTCVLHSIVGWGSTVGRWARVEGTPNDPNPNDPRAHMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL", "length": 417, "header": "tr|A0A140TAL0-1|A0A140TAL0_PIG Isoform 1 of Mannose-1-phosphate guanyltransferase alpha OS=Sus scrofa OX=9823 GN=GMPPA PE=3 SV=3 CANONICAL=A0A140TAL0-1" }, "locus": { "chromosome": "15", "start_pos": 121515110, "end_pos": 121508490, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSSSCT00000031804.4", "url": "https://www.ensembl.org/id/ENSSSCT00000031804.4" }, { "database": "Ensembl Peptide", "id": "ENSSSCP00000027841.3", "url": "https://www.ensembl.org/id/ENSSSCP00000027841.3" } ] } }, { "isoform_ac": "A0A8W4FHN3-1", "url": "https://www.uniprot.org/uniprotkb/A0A140TAL0/entry#A0A8W4FHN3-1", "sequence": { "sequence": "MLKAVILIGGPQKGTRFRPLSFEVLILNSIVLPHKELSRSFTNQIIL", "length": 47, "header": "tr|A0A8W4FHN3-1|A0A8W4FHN3_PIG Computationally mapped isoform of GDP-mannose pyrophosphorylase A OS=Sus scrofa OX=9823 GN=GMPPA PE=4 SV=1 CANONICAL=A0A140TAL0-1" }, "locus": { "chromosome": "15", "start_pos": 121515110, "end_pos": 121508490, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSSSCT00000105751.1", "url": "https://www.ensembl.org/id/ENSSSCT00000105751.1" }, { "database": "Ensembl Peptide", "id": "ENSSSCP00000078952.1", "url": "https://www.ensembl.org/id/ENSSSCP00000078952.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "R-SSC-446205", "name": "Synthesis of GDP-mannose", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-446205", "resource": "Reactome", "description": "Synthesis of GDP-mannose" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A140TAL0", "url": "https://www.uniprot.org/uniprot/A0A140TAL0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "biosynthetic process", "id": "GO:0009058", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009058", "evidence": [ { "database": "UniProtKB", "id": "A0A140TAL0", "url": "https://www.uniprot.org/uniprot/A0A140TAL0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "transferase activity", "id": "GO:0016740", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016740", "evidence": [ { "database": "UniProtKB", "id": "A0A140TAL0", "url": "https://www.uniprot.org/uniprot/A0A140TAL0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 145, "end_pos": 147, "annotation": "n_glycosylation_sequon" }, { "start_pos": 301, "end_pos": 303, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A140TAL0-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 417, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A140TAL0-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 145, "end_pos": 147 }, { "start_pos": 301, "end_pos": 303 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }