{ "uniprot_canonical_ac": "A0A140T8P2-1", "uniprot_ac": "A0A140T8P2", "uniprot_id": "A0A140T8P2_MOUSE", "mass": { "chemical_mass": 12640.0, "monoisotopic_mass": 12640.0 }, "refseq": {}, "gene_names": [ { "name": "Igkv6-20", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A140T8P2", "id": "A0A140T8P2" } ], "protein_names": [ { "name": "Immunoglobulin kappa variable 6-20", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A140T8P2/entry#names_and_taxonomy", "id": "A0A140T8P2" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A140T8P2", "url": "https://www.uniprot.org/uniprot/A0A140T8P2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "Igkv6-20", "url": "https://www.uniprot.org/uniprot/A0A140T8P2", "locus": { "chromosome": "6", "start_pos": 70312825, "end_pos": 70313491, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000076587", "url": "https://www.ensembl.org/id/ENSMUSG00000076587" } ] } } ], "crossref": [ { "id": "A0A140T8P2", "url": "https://alphafold.ebi.ac.uk/entry/A0A140T8P2", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSMUSG00000076587", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000076587", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050150", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050150", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "1330836", "url": "http://www.informatics.jax.org/marker/MGI:1330836", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "NIIAWYQ", "url": "https://omabrowser.org/oma/group/NIIAWYQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR23267", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23267", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23267:SF507", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23267:SF507", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A140T8P2", "url": "https://www.uniprot.org/uniprot/A0A140T8P2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T8P2-1", "url": "https://www.uniprot.org/uniprot/A0A140T8P2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MESQTLVFISILLWLYGADGNIVMTQSPKSMSMSVGERVTLSCKASENVGTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQSYSYP", "length": 115, "header": "tr|A0A140T8P2-1|A0A140T8P2_MOUSE Isoform 1 of Immunoglobulin kappa variable 6-20 OS=Mus musculus OX=10090 GN=Igkv6-20 PE=4 SV=2 CANONICAL=A0A140T8P2-1" }, "isoforms": [ { "isoform_ac": "A0A140T8P2-1", "url": "https://www.uniprot.org/uniprotkb/A0A140T8P2/entry#A0A140T8P2-1", "sequence": { "sequence": "MESQTLVFISILLWLYGADGNIVMTQSPKSMSMSVGERVTLSCKASENVGTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQSYSYP", "length": 115, "header": "tr|A0A140T8P2-1|A0A140T8P2_MOUSE Isoform 1 of Immunoglobulin kappa variable 6-20 OS=Mus musculus OX=10090 GN=Igkv6-20 PE=4 SV=2 CANONICAL=A0A140T8P2-1" }, "locus": { "chromosome": "6", "start_pos": 70313463, "end_pos": 70312827, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000103388.4", "url": "https://www.ensembl.org/id/ENSMUST00000103388.4" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000100189.3", "url": "https://www.ensembl.org/id/ENSMUSP00000100189.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A0A0C4DH90-1", "protein_name": "Immunoglobulin kappa variable 3/OR2-268 (non-functional)", "gene_name": "IGKV3OR2-268", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEAPAQLLFLLLLWLPDTTGEIVMTQSPATLSLSPGERATLSCRASQSVSSSYLSWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTDFTLTISSLQPEDFAVYYCQQDYNLP", "length": 116 }, "evidence": [ { "id": "A0A140T8P2", "url": "https://omabrowser.org/oma/group/A0A140T8P2/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A0A140T8P2", "url": "https://www.uniprot.org/uniprot/A0A140T8P2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "A0A140T8P2", "url": "https://www.uniprot.org/uniprot/A0A140T8P2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A140T8P2-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 115, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A140T8P2-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }