{ "uniprot_canonical_ac": "A0A140T8F7-1", "uniprot_ac": "A0A140T8F7", "uniprot_id": "A0A140T8F7_CHICK", "mass": { "chemical_mass": 26683.0, "monoisotopic_mass": 26683.0 }, "refseq": { "ac": "NP_001280037", "name": "beta-nerve growth factor precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280037" }, "gene_names": [ { "name": "NGF", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A140T8F7", "id": "A0A140T8F7" }, { "name": "NGF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280037", "id": "NP_001280037" }, { "name": "beta-NGF; NGFB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280037", "id": "NP_001280037" } ], "protein_names": [ { "name": "Nerve growth factor", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A140T8F7/entry#names_and_taxonomy", "id": "A0A140T8F7" }, { "name": "beta-nerve growth factor precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280037", "id": "NP_001280037" }, { "name": "beta-nerve growth factor; nerve growth factor (beta polypeptide)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280037", "id": "NP_001280037" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: CD217960.1, ERR2286007.72029.1 [ECO:0000332] RNAseq introns :: partial sample support SAMEA103992528, SAMEA103992531 [ECO:0000350] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CD217960.1, BU337330.1 and BU313448.1. On May 30, 2014 this sequence version replaced XP_003642777.1. Transcript Variant: This variant (1) represents the longer transcript. Both variants 1 and 2 encode the same protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.", "evidence": [ { "database": "RefSeq", "id": "NP_001280037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280037" } ] }, { "annotation": "Data show that endogenous NGF induces DNA replication in a subpopulation of differentiating retinal ganglion cells that express both the neurotrophin receptor p75 and the E2F1 transcription factor, but that lack the retinoblastoma protein.", "evidence": [ { "database": "RefSeq", "id": "NP_001280037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280037" }, { "database": "PubMed", "id": "20018664", "url": "https://glygen.org/publication/PubMed/20018664" } ] }, { "annotation": "NGF promotes sensory axon branching through regulation of the actin cytoskeleton using both canonical signaling mechanisms and intra-axonal protein synthesis downstream of PI3K signaling.", "evidence": [ { "database": "RefSeq", "id": "NP_001280037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280037" }, { "database": "PubMed", "id": "23223289", "url": "https://glygen.org/publication/PubMed/23223289" } ] }, { "annotation": "Results suggest that NGF differentially affects the phosphorylation of MAP1B within the main axon shaft and the laterally projecting filopodia", "evidence": [ { "database": "RefSeq", "id": "NP_001280037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280037" }, { "database": "PubMed", "id": "25846486", "url": "https://glygen.org/publication/PubMed/25846486" } ] }, { "annotation": "These results reveal a role for NGF in early chicken embryo development.", "evidence": [ { "database": "RefSeq", "id": "NP_001280037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280037" }, { "database": "PubMed", "id": "22308471", "url": "https://glygen.org/publication/PubMed/22308471" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A140T8F7", "url": "https://www.uniprot.org/uniprot/A0A140T8F7" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "NGF", "url": "https://www.uniprot.org/uniprot/A0A140T8F7", "locus": { "chromosome": "26", "start_pos": 4067478, "end_pos": 4096229, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010025423", "url": "https://www.ensembl.org/id/ENSGALG00010025423" } ] } } ], "crossref": [ { "id": "ENSGALG00000002556", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000002556", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "396466", "url": "https://www.ncbi.nlm.nih.gov/gene/396466", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002072", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002072", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019846", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019846", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020408", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020408", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020425", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020425", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029034", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029034", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:396466", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:396466", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "MPMLFYT", "url": "https://omabrowser.org/oma/group/MPMLFYT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A140T8F7", "url": "https://www.orthodb.org/?gene=A0A140T8F7", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11589", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11589", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11589:SF10", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11589:SF10", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00243", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00243", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001280037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280037", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A140T8F7", "url": "https://www.uniprot.org/uniprot/A0A140T8F7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T8F7-1", "url": "https://www.uniprot.org/uniprot/A0A140T8F7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSMLYYTLIIAFLIGTQAAPKSEDNGPLEYPAEHSLPSTQQSNGQHIAKAAPQTTHGRFAWMPDGTEDLNIAMDQNFFKKKRFRSSRVLFSTQPPPVSRKGQSTGFLSSAVSLNRTARTKRTAHPVLHRGEFSVCDSVSMWVGDKTTATDIKGKEVTVLGEVNINNNVFKQYFFETKCRDPRPVSSGCRGIDAKHWNSYCTTTHTFVKALTMEGKQAAWRFIRIDTACVCVLSRKSGRP", "length": 239, "header": "tr|A0A140T8F7-1|A0A140T8F7_CHICK Isoform 1 of Nerve growth factor OS=Gallus gallus OX=9031 GN=NGF PE=3 SV=2 CANONICAL=A0A140T8F7-1" }, "isoforms": [ { "isoform_ac": "A0A140T8F7-1", "url": "https://www.uniprot.org/uniprotkb/A0A140T8F7/entry#A0A140T8F7-1", "sequence": { "sequence": "MSMLYYTLIIAFLIGTQAAPKSEDNGPLEYPAEHSLPSTQQSNGQHIAKAAPQTTHGRFAWMPDGTEDLNIAMDQNFFKKKRFRSSRVLFSTQPPPVSRKGQSTGFLSSAVSLNRTARTKRTAHPVLHRGEFSVCDSVSMWVGDKTTATDIKGKEVTVLGEVNINNNVFKQYFFETKCRDPRPVSSGCRGIDAKHWNSYCTTTHTFVKALTMEGKQAAWRFIRIDTACVCVLSRKSGRP", "length": 239, "header": "tr|A0A140T8F7-1|A0A140T8F7_CHICK Isoform 1 of Nerve growth factor OS=Gallus gallus OX=9031 GN=NGF PE=3 SV=2 CANONICAL=A0A140T8F7-1" }, "locus": { "chromosome": "26", "start_pos": 4069140, "end_pos": 4068424, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010062063.1", "url": "https://www.ensembl.org/id/ENSGALT00010062063.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010038344.1", "url": "https://www.ensembl.org/id/ENSGALP00010038344.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Somatic tetraploidy in specific chick retinal ganglion cells induced by nerve growth factor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010-01-05", "authors": "Morillo Sandra M, Escoll Pedro, de la Hera Antonio, Frade Jos\u00e9 M", "evidence": [ { "database": "RefSeq", "id": "NP_001280037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280037" } ], "reference": [ { "type": "PubMed", "id": "20018664", "url": "https://glygen.org/publication/PubMed/20018664" } ] }, { "title": "Nerve growth factor regulates axial rotation during early stages of chick embryo development.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012-02-07", "authors": "Manca Annalisa, Capsoni Simona, Di Luzio Anna, Vignone Domenico, Malerba Francesca, Paoletti Francesca, Brandi Rossella, Arisi Ivan, Cattaneo Antonino, Levi-Montalcini Rita", "evidence": [ { "database": "RefSeq", "id": "NP_001280037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280037" } ], "reference": [ { "type": "PubMed", "id": "22308471", "url": "https://glygen.org/publication/PubMed/22308471" } ] }, { "title": "Nerve growth factor-induced formation of axonal filopodia and collateral branches involves the intra-axonal synthesis of regulators of the actin-nucleating Arp2/3 complex.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2012-12-05", "authors": "Spillane Mirela, Ketschek Andrea, Donnelly Chris J, Pacheco Almudena, Twiss Jeffrey L, Gallo Gianluca", "evidence": [ { "database": "RefSeq", "id": "NP_001280037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280037" } ], "reference": [ { "type": "PubMed", "id": "23223289", "url": "https://glygen.org/publication/PubMed/23223289" } ] }, { "title": "Nerve growth factor promotes reorganization of the axonal microtubule array at sites of axon collateral branching.", "journal": "Developmental neurobiology", "date": "2015-12", "authors": "Ketschek Andrea, Jones Steven, Spillane Mirela, Korobova Farida, Svitkina Tatyana, Gallo Gianluca", "evidence": [ { "database": "RefSeq", "id": "NP_001280037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280037" } ], "reference": [ { "type": "PubMed", "id": "25846486", "url": "https://glygen.org/publication/PubMed/25846486" } ] } ], "pathway": [ { "id": "gga:396466", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:396466", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P01138-1", "protein_name": "Beta-nerve growth factor", "gene_name": "NGF", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA", "length": 241 }, "evidence": [ { "id": "A0A140T8F7", "url": "https://omabrowser.org/oma/group/A0A140T8F7/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P01139-1", "protein_name": "Beta-nerve growth factor", "gene_name": "Ngf", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSMLFYTLITAFLIGVQAEPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPTAPIAARVTGQTRNITVDPRLFKKRRLHSPRVLFSTQPPPTSSDTLDLDFQAHGTIPFNRTHRSKRSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG", "length": 241 }, "evidence": [ { "id": "A0A140T8F7", "url": "https://omabrowser.org/oma/group/A0A140T8F7/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P13600-1", "protein_name": "Beta-nerve growth factor", "gene_name": "NGF", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MSMLFYTLITALLIGIQAAPHTESNVPAGHAIPQAHWIKLQHSLDTVLRRAHSAPAGPIAARVAGQTHNITVDPKLFKKRRLRSPRVLFSTQPPPVAADTQDLDFEAGGASSFNRTHRSKRSSSHPVFHRGEFSVCDSISVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDAKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKTGQRA", "length": 241 }, "evidence": [ { "id": "A0A140T8F7", "url": "https://omabrowser.org/oma/group/A0A140T8F7/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "P25427-1", "protein_name": "Beta-nerve growth factor", "gene_name": "Ngf", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSMLFYTLITAFLIGVQAEPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPAEPIAARVTGQTRNITVDPKLFKKRRLRSPRVLFSTQPPPTSSDTLDLDFQAHGTISFNRTHRSKRSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG", "length": 241 }, "evidence": [ { "id": "A0A140T8F7", "url": "https://omabrowser.org/oma/group/A0A140T8F7/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A0A140T8F7", "url": "https://www.uniprot.org/uniprot/A0A140T8F7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "A0A140T8F7", "url": "https://www.uniprot.org/uniprot/A0A140T8F7" } ], "pmid": "" }, { "name": "neuron projection morphogenesis", "id": "GO:0048812", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048812", "evidence": [ { "database": "UniProtKB", "id": "A0A140T8F7", "url": "https://www.uniprot.org/uniprot/A0A140T8F7" } ], "pmid": "" }, { "name": "extrinsic apoptotic signaling pathway via death domain receptors", "id": "GO:0008625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008625", "evidence": [ { "database": "UniProtKB", "id": "A0A140T8F7", "url": "https://www.uniprot.org/uniprot/A0A140T8F7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "nerve growth factor receptor binding", "id": "GO:0005163", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005163", "evidence": [ { "database": "UniProtKB", "id": "A0A140T8F7", "url": "https://www.uniprot.org/uniprot/A0A140T8F7" } ], "pmid": "" }, { "name": "metalloendopeptidase inhibitor activity", "id": "GO:0008191", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008191", "evidence": [ { "database": "UniProtKB", "id": "A0A140T8F7", "url": "https://www.uniprot.org/uniprot/A0A140T8F7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 114, "end_pos": 116, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 114, "end_pos": 116 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }