{ "uniprot_canonical_ac": "A0A0N4STN0-1", "uniprot_ac": "A0A0N4STN0", "uniprot_id": "A0A0N4STN0_BOVIN", "mass": { "chemical_mass": 11416.0, "monoisotopic_mass": 11416.0 }, "refseq": { "ac": "NP_001019721", "name": "ATP synthase subunit g, mitochondrial", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019721" }, "gene_names": [ { "name": "ATP5MG", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0N4STN0", "id": "A0A0N4STN0" }, { "name": "ATP5L", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019721", "id": "NP_001019721" }, { "name": "ATP5MG", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019721", "id": "NP_001019721" } ], "protein_names": [ { "name": "ATP synthase subunit", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0N4STN0/entry#names_and_taxonomy", "id": "A0A0N4STN0" }, { "name": "ATP synthase subunit g, mitochondrial", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019721", "id": "NP_001019721" }, { "name": "ATPase subunit g; F1Fo-ATP synthase complex Fo membrane domain g subunit; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G; ATP synthase, H+ transporting, mitochondrial Fo complex subunit G", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019721", "id": "NP_001019721" } ], "function": [ { "annotation": "Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane.", "evidence": [ { "database": "UniProtKB", "id": "A0AAA9RUT4", "url": "https://www.uniprot.org/uniprot/A0AAA9RUT4#function" }, { "database": "UniProtKB", "id": "ARBA00003606", "url": "https://www.uniprot.org/uniprot/ARBA00003606#function" }, { "database": "UniProtKB", "id": "A0AAA9TVR7", "url": "https://www.uniprot.org/uniprot/A0AAA9TVR7#function" }, { "database": "UniProtKB", "id": "A0AAA9RWX1", "url": "https://www.uniprot.org/uniprot/A0AAA9RWX1#function" }, { "database": "UniProtKB", "id": "A0A0N4STN0", "url": "https://www.uniprot.org/uniprot/A0A0N4STN0#function" } ] }, { "annotation": "Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain. Minor subunit located with subunit a in the membrane.", "evidence": [ { "database": "UniProtKB", "id": "A0AAA9TVR7", "url": "https://www.uniprot.org/uniprot/A0AAA9TVR7#function" }, { "database": "UniProtKB", "id": "PIRNR017835", "url": "https://www.uniprot.org/uniprot/PIRNR017835#function" }, { "database": "UniProtKB", "id": "A0A0N4STN0", "url": "https://www.uniprot.org/uniprot/A0A0N4STN0#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0A0N4STN0", "url": "https://www.uniprot.org/uniprot/A0A0N4STN0" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "ATP5MG", "url": "https://www.uniprot.org/uniprot/A0A0N4STN0", "locus": { "chromosome": "15", "start_pos": 29104490, "end_pos": 29084998, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000007332", "url": "https://www.ensembl.org/id/ENSBTAG00000007332" } ] } } ], "crossref": [ { "id": "A0A0N4STN0", "url": "https://alphafold.ebi.ac.uk/entry/A0A0N4STN0", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSBTAG00000007332", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000007332", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "515696", "url": "https://www.ncbi.nlm.nih.gov/gene/515696", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR006808", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006808", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016702", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016702", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:515696", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:515696", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "IVHSAQT", "url": "https://omabrowser.org/oma/group/IVHSAQT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0N4STN0", "url": "https://www.orthodb.org/?gene=A0A0N4STN0", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12386", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12386", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12386:SF12", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12386:SF12", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04718", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF04718", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-BTA-163210", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-163210", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-BTA-8949613", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-8949613", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-BTA-9837999", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-9837999", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001019721", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019721", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0N4STN0", "url": "https://www.uniprot.org/uniprot/A0A0N4STN0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0N4STN0-1", "url": "https://www.uniprot.org/uniprot/A0A0N4STN0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9RUT4", "url": "https://www.uniprot.org/uniprot/A0AAA9RUT4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9RUT4-1", "url": "https://www.uniprot.org/uniprot/A0AAA9RUT4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9RWX1", "url": "https://www.uniprot.org/uniprot/A0AAA9RWX1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9RWX1-1", "url": "https://www.uniprot.org/uniprot/A0AAA9RWX1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9TVR7", "url": "https://www.uniprot.org/uniprot/A0AAA9TVR7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9TVR7-1", "url": "https://www.uniprot.org/uniprot/A0AAA9TVR7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAQFVRNLAEKAPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV", "length": 103, "header": "tr|A0A0N4STN0-1|A0A0N4STN0_BOVIN Isoform 1 of ATP synthase subunit OS=Bos taurus OX=9913 GN=ATP5MG PE=3 SV=1 CANONICAL=A0A0N4STN0-1" }, "isoforms": [ { "isoform_ac": "A0A0N4STN0-1", "url": "https://www.uniprot.org/uniprotkb/A0A0N4STN0/entry#A0A0N4STN0-1", "sequence": { "sequence": "MAQFVRNLAEKAPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV", "length": 103, "header": "tr|A0A0N4STN0-1|A0A0N4STN0_BOVIN Isoform 1 of ATP synthase subunit OS=Bos taurus OX=9913 GN=ATP5MG PE=3 SV=1 CANONICAL=A0A0N4STN0-1" }, "locus": { "chromosome": "15", "start_pos": 29093024, "end_pos": 29085060, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000009643.6", "url": "https://www.ensembl.org/id/ENSBTAT00000009643.6" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000009643.5", "url": "https://www.ensembl.org/id/ENSBTAP00000009643.5" } ] } }, { "isoform_ac": "A0AAA9RUT4-1", "url": "https://www.uniprot.org/uniprotkb/A0A0N4STN0/entry#A0AAA9RUT4-1", "sequence": { "sequence": "MAQFVRNLAEKAPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKPYGLWSARLLCSWDSPGKNTGVGCHAFPRDLPDPGTEPKFLISLALAGRFFTTSVTWEAPLKPLL", "length": 136, "header": "tr|A0AAA9RUT4-1|A0A0N4STN0_BOVIN Computationally mapped isoform of ATP synthase subunit OS=Bos taurus OX=9913 GN=ATP5MG PE=3 SV=1 CANONICAL=A0A0N4STN0-1" }, "locus": { "chromosome": "15", "start_pos": 29103746, "end_pos": 29085060, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000096626.1", "url": "https://www.ensembl.org/id/ENSBTAT00000096626.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000074837.1", "url": "https://www.ensembl.org/id/ENSBTAP00000074837.1" } ] } }, { "isoform_ac": "A0AAA9RWX1-1", "url": "https://www.uniprot.org/uniprotkb/A0A0N4STN0/entry#A0AAA9RWX1-1", "sequence": { "sequence": "MSGSAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV", "length": 89, "header": "tr|A0AAA9RWX1-1|A0A0N4STN0_BOVIN Computationally mapped isoform of ATP synthase subunit OS=Bos taurus OX=9913 GN=ATP5MG PE=3 SV=1 CANONICAL=A0A0N4STN0-1" }, "locus": { "chromosome": "15", "start_pos": 29093024, "end_pos": 29087368, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000128555.1", "url": "https://www.ensembl.org/id/ENSBTAT00000128555.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000075634.1", "url": "https://www.ensembl.org/id/ENSBTAP00000075634.1" } ] } }, { "isoform_ac": "A0AAA9TVR7-1", "url": "https://www.uniprot.org/uniprotkb/A0A0N4STN0/entry#A0AAA9TVR7-1", "sequence": { "sequence": "MMEIVILRVAKYLNTAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV", "length": 101, "header": "tr|A0AAA9TVR7-1|A0A0N4STN0_BOVIN Computationally mapped isoform of ATP synthase subunit OS=Bos taurus OX=9913 GN=ATP5MG PE=3 SV=1 CANONICAL=A0A0N4STN0-1" }, "locus": { "chromosome": "15", "start_pos": 29093024, "end_pos": 29090451, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000094553.1", "url": "https://www.ensembl.org/id/ENSBTAT00000094553.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000101253.1", "url": "https://www.ensembl.org/id/ENSBTAP00000101253.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool": "isoglyp", "mining_tool": "", "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "start_pos": 42, "start_aa": "T", "end_pos": 42, "end_aa": "T", "residue": "Thr", "site_lbl": "Thr42", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ], "filter_code": "00000000000000001000.00000000001000.1.01000" } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [ { "id": "bta:515696", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:515696", "resource": "KEGG Pathway" }, { "id": "R-BTA-163210", "name": "Formation of ATP by chemiosmotic coupling", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-163210", "resource": "Reactome", "description": "Formation of ATP by chemiosmotic coupling" }, { "id": "R-BTA-8949613", "name": "Cristae formation", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-8949613", "resource": "Reactome", "description": "Cristae formation" }, { "id": "R-BTA-9837999", "name": "Mitochondrial protein degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-9837999", "resource": "Reactome", "description": "Mitochondrial protein degradation" } ], "orthologs": [ { "uniprot_canonical_ac": "F1NIL3-1", "protein_name": "ATP synthase subunit", "gene_name": "ATP5L", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MAQAAQKLVQRLTTRGPQLLSAAVAYSKPRLATFWYYAKVELAPPTPGEIPKAIDSMKAMVRSFQSGRLAQLTVREALRNGLVATEVLMWFYIGEIIGKRGLIGYNV", "length": 107 }, "evidence": [ { "id": "A0A0N4STN0", "url": "https://omabrowser.org/oma/group/A0A0N4STN0/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" }, { "uniprot_canonical_ac": "O75964-1", "protein_name": "ATP synthase subunit g, mitochondrial", "gene_name": "ATP5MG", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV", "length": 103 }, "evidence": [ { "id": "A0A0N4STN0", "url": "https://omabrowser.org/oma/group/A0A0N4STN0/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q6PDU7-1", "protein_name": "ATP synthase subunit g, mitochondrial", "gene_name": "Atp5mg", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAKFIRNLADKAPSMVAAAVTYSKPRLATFWHYARVELVPPTLGEIPTAIQSMKSIIHSAQTGNFKHLTVKEAVLNGLVATEVWMWFYIGEIIGKRGIVGYDV", "length": 103 }, "evidence": [ { "id": "A0A0N4STN0", "url": "https://omabrowser.org/oma/group/A0A0N4STN0/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9CPQ8-1", "protein_name": "ATP synthase subunit g, mitochondrial", "gene_name": "Atp5mg", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAKFIRNFAEKAPSMVAAAVTYSKPRLATFWHYAKVELVPPTPAEIPTAIQSVKKIIQSAKTGSFKHLTVKEAVLNGLVATEVWMWFYIGEIIGKRGIVGYDV", "length": 103 }, "evidence": [ { "id": "A0A0N4STN0", "url": "https://omabrowser.org/oma/group/A0A0N4STN0/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)", "id": "GO:0000276", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000276", "evidence": [ { "database": "UniProtKB", "id": "A0A0N4STN0", "url": "https://www.uniprot.org/uniprot/A0A0N4STN0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "proton transmembrane transporter activity", "id": "GO:0015078", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015078", "evidence": [ { "database": "UniProtKB", "id": "A0A0N4STN0", "url": "https://www.uniprot.org/uniprot/A0A0N4STN0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "proton motive force-driven ATP synthesis", "id": "GO:0015986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015986", "evidence": [ { "database": "UniProtKB", "id": "A0A0N4STN0", "url": "https://www.uniprot.org/uniprot/A0A0N4STN0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A0N4STN0-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 103, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A0N4STN0-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 42 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }