{ "uniprot_canonical_ac": "A0A0G2KBC6-1", "uniprot_ac": "A0A0G2KBC6", "uniprot_id": "A0A0G2KBC6_RAT", "mass": { "chemical_mass": 38440.0, "monoisotopic_mass": 38440.0 }, "refseq": { "ac": "XP_017451653", "name": "zinc finger protein 660", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017451653" }, "gene_names": [ { "name": "Znf660", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2KBC6", "id": "A0A0G2KBC6" }, { "name": "Znf660", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017451653", "id": "XP_017451653" } ], "protein_names": [ { "name": "Zinc finger protein 660", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KBC6/entry#names_and_taxonomy", "id": "A0A0G2KBC6" }, { "name": "zinc finger protein 660", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017451653", "id": "XP_017451653" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KBC6", "url": "https://www.uniprot.org/uniprot/A0A0G2KBC6" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "gene": [ { "name": "Znf660", "url": "https://www.uniprot.org/uniprot/A0A0G2KBC6", "locus": { "chromosome": "8", "start_pos": 122536247, "end_pos": 122524324, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000053687", "url": "https://www.ensembl.org/id/ENSRNOG00000053687" } ] } } ], "crossref": [ { "id": "ENSRNOG00000053687", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000053687", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "108351806", "url": "https://www.ncbi.nlm.nih.gov/gene/108351806", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "KTRNFKQ", "url": "https://omabrowser.org/oma/group/KTRNFKQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0G2KBC6", "url": "https://www.orthodb.org/?gene=A0A0G2KBC6", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24390", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24390", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24390:SF245", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24390:SF245", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00096", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00096", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_017451653", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017451653", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "11394460", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=11394460", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2KBC6", "url": "https://www.uniprot.org/uniprot/A0A0G2KBC6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2KBC6-1", "url": "https://www.uniprot.org/uniprot/A0A0G2KBC6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRRKMGKFKHKTLEDSKSPAEGSDQEGENSGHQFCASATEKRGHGGRRQYVCPECGKAFSQSANLTVHERIHTGEKPYKCTVCGKAFSHSSNLVVHRRIHTGLKPYTCRDCGKSFSGKSHLIGHQEVHSGEKTYECKECGKAFSRSSGLIAHHRVHTGEKPYTCSECGKAFSRSSNLTQHQRTHRGKKVYKCKECGKTCGSNTKIIDHQRIHTGEKPYECAECGKTFILRKALNEHQRLHRREKPYKCKECGKAFTSNRNLTDHQRVHTGEKPYKCNECGKTFRQTSQVILHLRTHTKEKPYKCSECGKAYRYSSQLIQHQRKHNEEKEALLFTGQV", "length": 337, "header": "tr|A0A0G2KBC6-1|A0A0G2KBC6_RAT Isoform 1 of Zinc finger protein 660 OS=Rattus norvegicus OX=10116 GN=Znf660 PE=4 SV=1 CANONICAL=A0A0G2KBC6-1" }, "isoforms": [ { "isoform_ac": "A0A0G2KBC6-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KBC6/entry#A0A0G2KBC6-1", "sequence": { "sequence": "MRRKMGKFKHKTLEDSKSPAEGSDQEGENSGHQFCASATEKRGHGGRRQYVCPECGKAFSQSANLTVHERIHTGEKPYKCTVCGKAFSHSSNLVVHRRIHTGLKPYTCRDCGKSFSGKSHLIGHQEVHSGEKTYECKECGKAFSRSSGLIAHHRVHTGEKPYTCSECGKAFSRSSNLTQHQRTHRGKKVYKCKECGKTCGSNTKIIDHQRIHTGEKPYECAECGKTFILRKALNEHQRLHRREKPYKCKECGKAFTSNRNLTDHQRVHTGEKPYKCNECGKTFRQTSQVILHLRTHTKEKPYKCSECGKAYRYSSQLIQHQRKHNEEKEALLFTGQV", "length": 337, "header": "tr|A0A0G2KBC6-1|A0A0G2KBC6_RAT Isoform 1 of Zinc finger protein 660 OS=Rattus norvegicus OX=10116 GN=Znf660 PE=4 SV=1 CANONICAL=A0A0G2KBC6-1" }, "locus": { "chromosome": "8", "start_pos": 122535374, "end_pos": 122534364, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000078308.2", "url": "https://www.ensembl.org/id/ENSRNOT00000078308.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000075741.1", "url": "https://www.ensembl.org/id/ENSRNOP00000075741.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A0A287B1U3-1", "protein_name": "Zinc finger protein 660", "gene_name": "ZNF660", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MRRKTRNFKPKTVKDNKTLIEVSDQESEKDDPTINERIQAEKRQYVCTECGKAFSQSANLTVHERIHTGEKPYKCKECGKAFSHSSNLVVHRRIHTGLKPYTCSECGKSFSGKSHLIRHQGIHSGEKTYECKECGKAFSRSSGLISHHRVHTGEKPYTCIECGKAFSRSSNLTQHQRMHKGKKVYKCKECGKTCISNTKIMDHQRIHTGEKPYECDECGKAFILKKTLNEHQRLHRREKPYKCKECGKAFTSNRNLIDHQRVHTGEKPYKCNECGKTFRQTSQVILHLRTHTKEKPYKCNECAKAYRYSSQLIQHQRKHSEEKETS", "length": 326 }, "evidence": [ { "id": "A0A0G2KBC6", "url": "https://omabrowser.org/oma/group/A0A0G2KBC6/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "A0A3Q1MAT5-1", "protein_name": "Zinc finger protein 660", "gene_name": "ZNF660", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MRRQTRNFKQKTVQDNKTLTEVSDQESEKDGPTINERIQAAKRQYVCSECGKAFSQSANLTVHERIHTGEKPYKCKECGKAFSHSSNLVVHRRIHTGLKPYTCSECGKSFSGKSHLIRHQGIHSGEKTYECKECGKAFSRSSGLISHHRVHTGEKPYTCIECGKAFSRSSNLTQHQRMHKGKKVYKCKECGKTCVSNTKIMDHQRIHTGEKPYECDECGKAFILKKTLNEHQRLHRREKPYKCNECGKAFTSNRNLIDHQRVHTGEKPYKCNECGKTFRQTSQVILHLRTHTKEKPYKCSECGKAYRYSSQLIQHQRKHNEEKEMS", "length": 326 }, "evidence": [ { "id": "A0A0G2KBC6", "url": "https://omabrowser.org/oma/group/A0A0G2KBC6/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "Q6AZW8-1", "protein_name": "Zinc finger protein 660", "gene_name": "ZNF660", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRRKTRNFKHKTVKDNKVLTEGSDQESEKDNSQCCDPATNERVQAEKRQYVCTECGKAFSQSANLTVHERIHTGEKPYKCKECGKAFSHSSNLVVHRRIHTGLKPYTCSECGKSFSGKSHLIRHQGIHSGEKTYECKECGKAFSRSSGLISHHRVHTGEKPYSCIECGKAFSRSSNLTQHQRMHRGKKVYKCKECGKTCGSNTKIMDHQRIHTGEKPYECDECGKTFILRKTLNEHQRLHRREKPYKCNECGKAFTSNRNLVDHQRVHTGEKPYKCNECGKTFRQTSQVILHLRTHTKEKPYKCSECGKAYRYSSQLIQHQRKHNEEKETS", "length": 331 }, "evidence": [ { "id": "A0A0G2KBC6", "url": "https://omabrowser.org/oma/group/A0A0G2KBC6/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KBC6", "url": "https://www.uniprot.org/uniprot/A0A0G2KBC6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KBC6", "url": "https://www.uniprot.org/uniprot/A0A0G2KBC6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KBC6", "url": "https://www.uniprot.org/uniprot/A0A0G2KBC6" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KBC6", "url": "https://www.uniprot.org/uniprot/A0A0G2KBC6" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KBC6", "url": "https://www.uniprot.org/uniprot/A0A0G2KBC6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 176, "end_pos": 178, "annotation": "n_glycosylation_sequon" }, { "start_pos": 260, "end_pos": 262, "annotation": "n_glycosylation_sequon" }, { "start_pos": 64, "end_pos": 66, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 176, "end_pos": 178 }, { "start_pos": 260, "end_pos": 262 }, { "start_pos": 64, "end_pos": 66 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }