{ "uniprot_canonical_ac": "A0A0G2KAD4-1", "uniprot_ac": "A0A0G2KAD4", "uniprot_id": "A0A0G2KAD4_RAT", "mass": { "chemical_mass": 12153.0, "monoisotopic_mass": 12153.0 }, "refseq": { "ac": "NP_001123352", "name": "protein LBH", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123352" }, "gene_names": [ { "name": "Lbh", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4", "id": "A0A0G2KAD4" }, { "name": "Lbh", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123352", "id": "NP_001123352" } ], "protein_names": [ { "name": "Protein LBH", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KAD4/entry#names_and_taxonomy", "id": "A0A0G2KAD4" }, { "name": "limb bud and heart development", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123352", "id": "NP_001123352" }, { "name": "protein LBH", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123352", "id": "NP_001123352" } ], "function": [ { "annotation": "Limb-bud and Heart (LBH) mediates proliferation, fibroblast-to-myofibroblast transition and EMT-like processes in cardiac fibroblasts.", "evidence": [ { "database": "RefSeq", "id": "NP_001123352", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123352" }, { "database": "PubMed", "id": "33666830", "url": "https://glygen.org/publication/PubMed/33666830" } ] }, { "annotation": "Transcriptional activator.", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4#function" }, { "database": "UniProtKB", "id": "PIRNR008130", "url": "https://www.uniprot.org/uniprot/PIRNR008130#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "gene": [ { "name": "Lbh", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4", "locus": { "chromosome": "6", "start_pos": 22568834, "end_pos": 22593079, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000039902", "url": "https://www.ensembl.org/id/ENSRNOG00000039902" } ] } } ], "crossref": [ { "id": "A0A0G2KAD4", "url": "https://alphafold.ebi.ac.uk/entry/A0A0G2KAD4", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSRNOG00000039902", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000039902", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "683626", "url": "https://www.ncbi.nlm.nih.gov/gene/683626", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR013294", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013294", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038990", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038990", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042945", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042945", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:683626", "url": "https://www.genome.jp/dbget-bin/www_bget?rno:683626", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FFPIHCP", "url": "https://omabrowser.org/oma/group/FFPIHCP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR14987", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14987", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14987:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14987:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15317", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF15317", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001123352", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123352", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1584525", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1584525", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2KAD4-1", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1M635", "url": "https://www.uniprot.org/uniprot/F1M635", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1M635-1", "url": "https://www.uniprot.org/uniprot/F1M635-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSVYFPIHCSDYLRSAEMTEVMMNAPSMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETTKEKKDQ", "length": 105, "header": "tr|A0A0G2KAD4-1|A0A0G2KAD4_RAT Isoform 1 of Protein LBH OS=Rattus norvegicus OX=10116 GN=Lbh PE=1 SV=2 CANONICAL=A0A0G2KAD4-1" }, "isoforms": [ { "isoform_ac": "A0A0G2KAD4-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KAD4/entry#A0A0G2KAD4-1", "sequence": { "sequence": "MSVYFPIHCSDYLRSAEMTEVMMNAPSMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETTKEKKDQ", "length": 105, "header": "tr|A0A0G2KAD4-1|A0A0G2KAD4_RAT Isoform 1 of Protein LBH OS=Rattus norvegicus OX=10116 GN=Lbh PE=1 SV=2 CANONICAL=A0A0G2KAD4-1" }, "locus": { "chromosome": "6", "start_pos": 22592835, "end_pos": 22571337, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000091904.2", "url": "https://www.ensembl.org/id/ENSRNOT00000091904.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000075356.2", "url": "https://www.ensembl.org/id/ENSRNOP00000075356.2" } ] } }, { "isoform_ac": "F1M635-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KAD4/entry#F1M635-1", "sequence": { "sequence": "MSHRLCKDNAFSDYLRSAEMTEVMMNAPSMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETTKEKKDQ", "length": 107, "header": "tr|F1M635-1|F1M635_RAT Computationally mapped isoform of Protein LBH OS=Rattus norvegicus OX=10116 GN=Lbh PE=1 SV=4 CANONICAL=A0A0G2KAD4-1" }, "locus": { "chromosome": "6", "start_pos": 22590832, "end_pos": 22571337, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000061284.5", "url": "https://www.ensembl.org/id/ENSRNOT00000061284.5" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000057996.5", "url": "https://www.ensembl.org/id/ENSRNOP00000057996.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nat. Commun.", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] }, { "title": "Limb-bud and Heart (LBH) mediates proliferation, fibroblast-to-myofibroblast transition and EMT-like processes in cardiac fibroblasts.", "journal": "Molecular and cellular biochemistry", "date": "2021", "authors": "Wu A, Zhang L, Chen J, Li H, Yang P, Chen M, Liu Q", "evidence": [ { "database": "RefSeq", "id": "NP_001123352", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123352" } ], "reference": [ { "type": "PubMed", "id": "33666830", "url": "https://glygen.org/publication/PubMed/33666830" } ] } ], "pathway": [ { "id": "rno:683626", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?rno:683626", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A287A836-1", "protein_name": "Protein LBH", "gene_name": "LBH", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MSVYFPIHCPDYLRSAEMTEVMLNTPSMEEIGLNPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETANENKEQ", "length": 105 }, "evidence": [ { "id": "A0A0G2KAD4", "url": "https://omabrowser.org/oma/group/A0A0G2KAD4/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "A0A8V0Z2S4-1", "protein_name": "Limb bud and heart development", "gene_name": "LCLAT1", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MESAPLGKAFESSPWPGLISDFISSLHRYQGTYSTDEVMMNNRHFQKKVSLFLLCKRQKEPSVQSHNDGVRWEVSGPLLVQRIQCCPTPTDRLALEGLEAPARLPCFWGKGLAAARQILQCEFPSFRPGCCSRGQHTAELAMVSWKGIYFVVALFLGSFFGSIFMLGPFLPLMFISPAWYRWITDRIVATWLTLPVALLEMVFGAKVVVTGDGFIPGERSVIIMNHRTRMDWMFLWNCLLRYSYLRLEKICLKSSLKSIPGFGWAMQVAAFIFIQRKWEDDKSHFENMLHYFCDIHEPLQLLIFPEGTDLTANTKARSNDFAEKNGLRKYEYVLHPRTTGFTFVVECLREGNNLDAIHDITVAYPQNIPQTEKHLLNGNFPKEIHFHVQRYPIETVPTSKEELQLWCQKRWEEKEERLRRFYEGGKCFDETGQSIIPPCKSELRVLAVKCISLLYWTVFPMGTFALLYLYSFARWYFAAMIIIFVAQQKIFGGLELIELACHQYFKKQQKHDDTKMKKK", "length": 519 }, "evidence": [ { "id": "A0A0G2KAD4", "url": "https://omabrowser.org/oma/group/A0A0G2KAD4/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" }, { "uniprot_canonical_ac": "A5PJU8-1", "protein_name": "Protein LBH", "gene_name": "LBH", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MSVYFPIHCPDYLRSAEMTEVMMNTPSMEEIGLNPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDAQDNCEETASENKEQ", "length": 105 }, "evidence": [ { "id": "A0A0G2KAD4", "url": "https://omabrowser.org/oma/group/A0A0G2KAD4/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "Q53QV2-1", "protein_name": "Protein LBH", "gene_name": "LBH", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSIYFPIHCPDYLRSAKMTEVMMNTQPMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETAKENKEQ", "length": 105 }, "evidence": [ { "id": "47565472", "url": "http://www.informatics.jax.org/homology/47565472", "database": "MGI" }, { "id": "A0A0G2KAD4", "url": "https://omabrowser.org/oma/group/A0A0G2KAD4/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q9CX60-1", "protein_name": "Protein LBH", "gene_name": "Lbh", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSVYFPIHCSDYLRSAEMTEVMMNAPSMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETTNEKKDQ", "length": 105 }, "evidence": [ { "id": "47565472", "url": "http://www.informatics.jax.org/homology/47565472", "database": "MGI" }, { "id": "A0A0G2KAD4", "url": "https://omabrowser.org/oma/group/A0A0G2KAD4/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4" } ], "pmid": "" }, { "name": "mammary gland epithelial cell differentiation", "id": "GO:0060644", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060644", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4" } ], "pmid": "" }, { "name": "regulation of gene expression", "id": "GO:0010468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010468", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4" } ], "pmid": "" }, { "name": "mammary gland development", "id": "GO:0030879", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030879", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4" } ], "pmid": "" }, { "name": "regulation of MAPK cascade", "id": "GO:0043408", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043408", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4" } ], "pmid": "" }, { "name": "negative regulation of intracellular estrogen receptor signaling pathway", "id": "GO:0033147", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033147", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4" } ], "pmid": "" }, { "name": "negative regulation of stem cell differentiation", "id": "GO:2000737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000737", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4" } ], "pmid": "" }, { "name": "positive regulation of somatic stem cell population maintenance", "id": "GO:1904674", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904674", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4" } ], "pmid": "" }, { "name": "positive regulation of somatic stem cell division", "id": "GO:1904677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904677", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4" } ], "pmid": "" }, { "name": "positive regulation of mammary stem cell proliferation", "id": "GO:2000103", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000103", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAD4", "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A0G2KAD4-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 105, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A0G2KAD4-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }