{ "uniprot_canonical_ac": "A0A0G2K8L2-1", "uniprot_ac": "A0A0G2K8L2", "uniprot_id": "A0A0G2K8L2_RAT", "mass": { "chemical_mass": 20755.0, "monoisotopic_mass": 20755.0 }, "refseq": {}, "gene_names": [ { "name": "Ssty1-ps5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K8L2", "id": "A0A0G2K8L2" } ], "protein_names": [ { "name": "Spermiogenesis specific transcript on the Y 1, pseudogene 5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K8L2/entry#names_and_taxonomy", "id": "A0A0G2K8L2" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K8L2", "url": "https://www.uniprot.org/uniprot/A0A0G2K8L2" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "gene": [ { "name": "Ssty1-ps5", "url": "https://www.uniprot.org/uniprot/A0A0G2K8L2", "locus": { "chromosome": "MU150222.1", "start_pos": 25562, "end_pos": 23239, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000070707", "url": "https://www.ensembl.org/id/ENSRNOG00000070707" } ] } } ], "crossref": [ { "id": "A0A0G2K8L2", "url": "https://alphafold.ebi.ac.uk/entry/A0A0G2K8L2", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSRNOG00000048616", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000048616", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "ENSRNOG00000060345", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000060345", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR003671", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003671", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042567", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042567", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR10405", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10405", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10405:SF16", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10405:SF16", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02513", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02513", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "40952297", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=40952297", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2K8L2", "url": "https://www.uniprot.org/uniprot/A0A0G2K8L2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K8L2-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K8L2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0R579", "url": "https://www.uniprot.org/uniprot/M0R579", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0R579-1", "url": "https://www.uniprot.org/uniprot/M0R579-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPRNPSLYLVKYDGIDCVYGLGLHSDERILKLKVLPHKVVFPQVKDANLARVMVGRAVDHKFEGKHGSKDNWMGVVPAQVPIMKDWFYTTFQKDPVLYIYQLLDDYTEGNLRIIPETPPAEVKSDVDSDILTGQCVQFTRSDRSKKIGKVIYQVPAKPSVYFIKFDGDVHMYVYNLVEKIC", "length": 181, "header": "tr|A0A0G2K8L2-1|A0A0G2K8L2_RAT Isoform 1 of Spermiogenesis specific transcript on the Y 1, pseudogene 5 OS=Rattus norvegicus OX=10116 GN=Ssty1-ps5 PE=3 SV=2 CANONICAL=A0A0G2K8L2-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K8L2-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K8L2/entry#A0A0G2K8L2-1", "sequence": { "sequence": "MPRNPSLYLVKYDGIDCVYGLGLHSDERILKLKVLPHKVVFPQVKDANLARVMVGRAVDHKFEGKHGSKDNWMGVVPAQVPIMKDWFYTTFQKDPVLYIYQLLDDYTEGNLRIIPETPPAEVKSDVDSDILTGQCVQFTRSDRSKKIGKVIYQVPAKPSVYFIKFDGDVHMYVYNLVEKIC", "length": 181, "header": "tr|A0A0G2K8L2-1|A0A0G2K8L2_RAT Isoform 1 of Spermiogenesis specific transcript on the Y 1, pseudogene 5 OS=Rattus norvegicus OX=10116 GN=Ssty1-ps5 PE=3 SV=2 CANONICAL=A0A0G2K8L2-1" }, "locus": { "chromosome": "MU150222.1", "start_pos": 25304, "end_pos": 24762, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000091824.2", "url": "https://www.ensembl.org/id/ENSRNOT00000091824.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000074650.2", "url": "https://www.ensembl.org/id/ENSRNOP00000074650.2" } ] } }, { "isoform_ac": "M0R579-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K8L2/entry#M0R579-1", "sequence": { "sequence": "MPRNPSLYLVKYDGIDCVYGLGLHSDERILKLKVLPHKVVFPQVKDANLARVMVGRAVDHKFEGKHGSKDNWMGVVPAQVPIMKDWFYTTFQKDPVLYIYQLLDDYTEGQCVQFTRSDRSKKIGKVIYQVPAKPSVYFIKFDGDVHMYVYNLVEKIC", "length": 157, "header": "tr|M0R579-1|M0R579_RAT Computationally mapped isoform of Spermiogenesis specific transcript on the Y 1, pseudogene 5 OS=Rattus norvegicus OX=10116 GN=Ssty1-ps5 PE=3 SV=3 CANONICAL=A0A0G2K8L2-1" }, "locus": { "chromosome": "MU150222.1", "start_pos": 25304, "end_pos": 24762, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000075354.3", "url": "https://www.ensembl.org/id/ENSRNOT00000075354.3" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000064537.3", "url": "https://www.ensembl.org/id/ENSRNOP00000064537.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "Q3TTD8-1", "protein_name": "Predicted gene, 20772", "gene_name": "Gm20737", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSSLMKKRRRKSSSNTLRNIVGCRISHSWKEGNEPVTQWKAIVLDQLPTNPSLYLVKYDGIDSIYGLELYSDDRILNLKVLPPIVVFPQVRDAHLARALVGRAVQHKFEGKDGSEVNWRGVVLAQVPIMKDLFYITYKKDPALYAYQLLDDYKEGNLHMIPDTPPAEERSGDDSDVLIGNWVEYTRKDGSKKFGKVVYQVLANPSVYFIKFHGDIHIYVYTMVPKILEVEKS", "length": 232 }, "evidence": [ { "id": "A0A0G2K8L2", "url": "https://omabrowser.org/oma/group/A0A0G2K8L2/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K8L2", "url": "https://www.uniprot.org/uniprot/A0A0G2K8L2" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K8L2", "url": "https://www.uniprot.org/uniprot/A0A0G2K8L2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K8L2", "url": "https://www.uniprot.org/uniprot/A0A0G2K8L2" } ], "pmid": "" }, { "name": "gamete generation", "id": "GO:0007276", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007276", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K8L2", "url": "https://www.uniprot.org/uniprot/A0A0G2K8L2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "methylated histone binding", "id": "GO:0035064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035064", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K8L2", "url": "https://www.uniprot.org/uniprot/A0A0G2K8L2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A0G2K8L2-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 181, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A0G2K8L2-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }