{ "uniprot_canonical_ac": "A0A0G2K7Z1-1", "uniprot_ac": "A0A0G2K7Z1", "uniprot_id": "A0A0G2K7Z1_RAT", "mass": { "chemical_mass": 32577.0, "monoisotopic_mass": 32577.0 }, "refseq": {}, "gene_names": [ { "name": "Zfp346", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z1", "id": "A0A0G2K7Z1" } ], "protein_names": [ { "name": "Zinc finger protein 346", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K7Z1/entry#names_and_taxonomy", "id": "A0A0G2K7Z1" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z1" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "gene": [ { "name": "Zfp346", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z1", "locus": { "chromosome": "17", "start_pos": 9493803, "end_pos": 9523635, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000016867", "url": "https://www.ensembl.org/id/ENSRNOG00000016867" } ] } } ], "crossref": [ { "id": "A0A0G2K7Z1", "url": "https://alphafold.ebi.ac.uk/entry/A0A0G2K7Z1", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSRNOG00000016867", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000016867", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "D3ZQL4", "url": "https://www.ebi.ac.uk/intact/interactors/id:D3ZQL4*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003604", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003604", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR051868", "url": "https://www.ebi.ac.uk/interpro/entry/IPR051868", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "SETHRTF", "url": "https://omabrowser.org/oma/group/SETHRTF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0G2K7Z1", "url": "https://www.orthodb.org/?gene=A0A0G2K7Z1", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "D3ZQL4", "url": "https://www.orthodb.org/?gene=D3ZQL4", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46144", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46144", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46144:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46144:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF12874", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF12874", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001100808", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100808", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1308068", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1308068", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2K7Z1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K7Z1-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZQL4", "url": "https://www.uniprot.org/uniprot/D3ZQL4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZQL4-1", "url": "https://www.uniprot.org/uniprot/D3ZQL4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MECPVPDFTEAADPGGAGPYKSSEEPEGREPDGVRFDRERARRLWEAVSGAQPAGREEVEHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGDVKRLDSDQSSRSKDKNHCCPVCNMTFSSPVVAQSHYLGKTHARNLKLKQQPAKGAALQQHRETLDPDKFCSLCHSAFNDPAMAQQHYTGKRHRKQETKLKLMAHYGRLAGPTASDSPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTLVTLGSQMPVQTQPTPKDSSTVED", "length": 293, "header": "tr|A0A0G2K7Z1-1|A0A0G2K7Z1_RAT Isoform 1 of Zinc finger protein 346 OS=Rattus norvegicus OX=10116 GN=Zfp346 PE=4 SV=1 CANONICAL=A0A0G2K7Z1-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K7Z1-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K7Z1/entry#A0A0G2K7Z1-1", "sequence": { "sequence": "MECPVPDFTEAADPGGAGPYKSSEEPEGREPDGVRFDRERARRLWEAVSGAQPAGREEVEHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGDVKRLDSDQSSRSKDKNHCCPVCNMTFSSPVVAQSHYLGKTHARNLKLKQQPAKGAALQQHRETLDPDKFCSLCHSAFNDPAMAQQHYTGKRHRKQETKLKLMAHYGRLAGPTASDSPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTLVTLGSQMPVQTQPTPKDSSTVED", "length": 293, "header": "tr|A0A0G2K7Z1-1|A0A0G2K7Z1_RAT Isoform 1 of Zinc finger protein 346 OS=Rattus norvegicus OX=10116 GN=Zfp346 PE=4 SV=1 CANONICAL=A0A0G2K7Z1-1" }, "locus": { "chromosome": "17", "start_pos": 9523602, "end_pos": 9496189, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000082042.2", "url": "https://www.ensembl.org/id/ENSRNOT00000082042.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000074403.1", "url": "https://www.ensembl.org/id/ENSRNOP00000074403.1" } ] } }, { "isoform_ac": "D3ZQL4-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K7Z1/entry#D3ZQL4-1", "sequence": { "sequence": "MECPVPDFTEAADPGGAGPYKSSEEPEGREPDGVRFDRERARRLWEAVSGAQPAGREEVEHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSSRSKDKNHCCPVCNMTFSSPVVAQSHYLGKTHARNLKLKQQPAKGAALQQHRETLDPDKFCSLCHSAFNDPAMAQQHYTGKRHRKQETKLKLMAHYGRLAGPTASDSPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTLVTLGSQMPVQTQPTPKDSSTVED", "length": 262, "header": "tr|D3ZQL4-1|D3ZQL4_RAT Computationally mapped isoform of Zinc finger protein 346 OS=Rattus norvegicus OX=10116 GN=Zfp346 PE=1 SV=4 CANONICAL=A0A0G2K7Z1-1" }, "locus": { "chromosome": "17", "start_pos": 9523602, "end_pos": 9496189, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000022646.8", "url": "https://www.ensembl.org/id/ENSRNOT00000022646.8" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000022646.7", "url": "https://www.ensembl.org/id/ENSRNOP00000022646.7" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool": "isoglyp", "mining_tool": "", "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "start_pos": 228, "start_aa": "T", "end_pos": 228, "end_aa": "T", "residue": "Thr", "site_lbl": "Thr228", "evidence": [ { "id": "GLY_001157", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001157" } ], "filter_code": "00000000000000001000.00000000001000.1.01000" } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z1" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z1" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z1" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z1" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z1" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z1" } ], "pmid": "" }, { "name": "double-stranded RNA binding", "id": "GO:0003725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003725", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z1" } ], "pmid": "" }, { "name": "miRNA binding", "id": "GO:0035198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035198", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 139, "end_pos": 141, "annotation": "n_glycosylation_sequon" }, { "start_pos": 264, "end_pos": 266, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A0G2K7Z1-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 293, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A0G2K7Z1-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 228 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 139, "end_pos": 141 }, { "start_pos": 264, "end_pos": 266 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }