{ "uniprot_canonical_ac": "A0A0G2K7F6-1", "uniprot_ac": "A0A0G2K7F6", "uniprot_id": "A0A0G2K7F6_RAT", "mass": { "chemical_mass": 63253.0, "monoisotopic_mass": 63253.0 }, "refseq": {}, "gene_names": [ { "name": "Aadacl2fm3l1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K7F6", "id": "A0A0G2K7F6" }, { "name": "Aadacl2fm3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K7F6", "id": "A0A0G2K7F6" }, { "name": "Aadacl2fm3l1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2K7F6", "id": "A0A0G2K7F6" }, { "name": "LOC120093098", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2K7F6", "id": "A0A0G2K7F6" }, { "name": "RGD1560324", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2K7F6", "id": "A0A0G2K7F6" } ], "protein_names": [ { "name": "AADACL2 family member 3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K7F6/entry#names_and_taxonomy", "id": "A0A0G2K7F6" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7F6", "url": "https://www.uniprot.org/uniprot/A0A0G2K7F6" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "gene": [ { "name": "Aadacl2fm3", "url": "https://www.uniprot.org/uniprot/A0A0G2K7F6", "locus": {} } ], "crossref": [ { "id": "A0A0G2K7F6", "url": "https://alphafold.ebi.ac.uk/entry/A0A0G2K7F6", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSRNOG00000042471", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000042471", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "120093098", "url": "https://www.ncbi.nlm.nih.gov/gene/120093098", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "295072", "url": "https://www.ncbi.nlm.nih.gov/gene/295072", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR013094", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013094", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017157", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017157", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029058", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029058", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033140", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033140", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050300", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050300", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050466", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050466", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:120093098", "url": "https://www.genome.jp/dbget-bin/www_bget?rno:120093098", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "rno:295072", "url": "https://www.genome.jp/dbget-bin/www_bget?rno:295072", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PKHMARW", "url": "https://omabrowser.org/oma/group/PKHMARW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "F1LVG7", "url": "https://www.orthodb.org/?gene=F1LVG7", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23024", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23024", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23024:SF124", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23024:SF124", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48081", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48081", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48081:SF33", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48081:SF33", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07859", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07859", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "1560324", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1560324", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "41146639", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=41146639", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "11552", "url": "https://www.rhea-db.org/rhea/11552", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "33875", "url": "https://www.rhea-db.org/rhea/33875", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "36403", "url": "https://www.rhea-db.org/rhea/36403", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "38563", "url": "https://www.rhea-db.org/rhea/38563", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0G2K7F6", "url": "https://www.uniprot.org/uniprot/A0A0G2K7F6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K7F6-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7F6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZTS6", "url": "https://www.uniprot.org/uniprot/A0A8I5ZTS6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZTS6-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZTS6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1LVG7", "url": "https://www.uniprot.org/uniprot/F1LVG7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1LVG7-1", "url": "https://www.uniprot.org/uniprot/F1LVG7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKHKTLCFGFFFIFLAYYIYIPIPENVEEPWKVRIIDAGMKISSLTATWLENMGLMKFEEFFGILMGIQDTKAVSDENITVIDTDFNDIPVRLYLPKRESERKRPAVIYIHGGAFILGSFKMLPYDSMNRWTANKLDAVVIAPDYRLAPQYLFPAALEDCVLVTKFFLQDKVLAKYRVDPTRICISGDSSGGTLAATVTQLGTLCENMGLMKHEDVITTLSLVHFTKPVSDENVTVIDTDFSNIPVRFYLPKRKSERQRPAVIFIHGGAFVLGSYKMSAYDDLNRLTANKLEAVVVAIDYRLAPKYPFPAALEDCVYVTKFFLQEKVLAKYRVDPSRICIMGDSSGGTLAATVTQLLQNDPNFKGRIKAQALMYPGLQSLDTFLPSHQEYQHGPVLTREMIIKLLCLYVTEDQVLPQAALRNEHMPEESRHLFKFVNWSEFLPEKYKKNHVYTEPVLGKLNASYPVLVDSRLSPLLVNDSQLQSLPLTYIVTCEHDIFRDDGLIYISRLRNVGVQVTHEHVEKGVHGALSFTSAPVFLNLGLKLRDKYINWLEENL", "length": 556, "header": "tr|A0A0G2K7F6-1|A0A0G2K7F6_RAT Isoform 1 of AADACL2 family member 3 OS=Rattus norvegicus OX=10116 GN=Aadacl2fm3 PE=3 SV=2 CANONICAL=A0A0G2K7F6-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K7F6-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K7F6/entry#A0A0G2K7F6-1", "sequence": { "sequence": "MKHKTLCFGFFFIFLAYYIYIPIPENVEEPWKVRIIDAGMKISSLTATWLENMGLMKFEEFFGILMGIQDTKAVSDENITVIDTDFNDIPVRLYLPKRESERKRPAVIYIHGGAFILGSFKMLPYDSMNRWTANKLDAVVIAPDYRLAPQYLFPAALEDCVLVTKFFLQDKVLAKYRVDPTRICISGDSSGGTLAATVTQLGTLCENMGLMKHEDVITTLSLVHFTKPVSDENVTVIDTDFSNIPVRFYLPKRKSERQRPAVIFIHGGAFVLGSYKMSAYDDLNRLTANKLEAVVVAIDYRLAPKYPFPAALEDCVYVTKFFLQEKVLAKYRVDPSRICIMGDSSGGTLAATVTQLLQNDPNFKGRIKAQALMYPGLQSLDTFLPSHQEYQHGPVLTREMIIKLLCLYVTEDQVLPQAALRNEHMPEESRHLFKFVNWSEFLPEKYKKNHVYTEPVLGKLNASYPVLVDSRLSPLLVNDSQLQSLPLTYIVTCEHDIFRDDGLIYISRLRNVGVQVTHEHVEKGVHGALSFTSAPVFLNLGLKLRDKYINWLEENL", "length": 556, "header": "tr|A0A0G2K7F6-1|A0A0G2K7F6_RAT Isoform 1 of AADACL2 family member 3 OS=Rattus norvegicus OX=10116 GN=Aadacl2fm3 PE=3 SV=2 CANONICAL=A0A0G2K7F6-1" }, "locus": { "chromosome": "2", "start_pos": 144045925, "end_pos": 143936599, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000086481.2", "url": "https://www.ensembl.org/id/ENSRNOT00000086481.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000074186.2", "url": "https://www.ensembl.org/id/ENSRNOP00000074186.2" } ] } }, { "isoform_ac": "A0A8I5ZTS6-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K7F6/entry#A0A8I5ZTS6-1", "sequence": { "sequence": "MGYKTLCLGFFCILFAYCIYSPVPENIEEPWKVRTISAIIKITSFLGTLCENMGLMKHEDVITTLSLVHFTKPVSDENVTVIDTDFSNIPVRFYLPKRKSERQRPAVIFIHGGAFVLGSYKMSAYDDLNRLTANKLEAVVVAIDYRLAPKYPFPAALEDCVYVTKFFLQEKVLAKYRVDPSRICIMGDSSGGTLAATVTQLLQNDPNFKGRIKAQALMYPGLQSLDTFLPSHQEYQHGPVLTREMIIKLLCLYVTEDQVLPQAALRNEHMPEESRHLFKFVNWSEFLPEKYKKNHVYTEPVLGKLNASYPVLVDSRLSPLLVNDSQLQSLPLTYIVTCEHDIFRDDGLIYISRLRNVGVQVTHEHVEKGVHGALSFTSAPVFLNLGLKLRDKYINWLEENL", "length": 401, "header": "tr|A0A8I5ZTS6-1|A0A8I5ZTS6_RAT Computationally mapped isoform of AADACL2 family member 3 OS=Rattus norvegicus OX=10116 GN=Aadacl2fm3l1 PE=3 SV=1 CANONICAL=A0A0G2K7F6-1" }, "locus": { "chromosome": "2", "start_pos": 144045925, "end_pos": 144000814, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000111301.1", "url": "https://www.ensembl.org/id/ENSRNOT00000111301.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000082338.1", "url": "https://www.ensembl.org/id/ENSRNOP00000082338.1" } ] } }, { "isoform_ac": "F1LVG7-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K7F6/entry#F1LVG7-1", "sequence": { "sequence": "MKHKTLCFGFFFIFLAYYIYIPIPENVEEPWKVRIIDAGMKISSLTATWLENMGLMKFEEFFGILMGIQDTKAVSDENITVIDTDFNDIPVRLYLPKRESERKRPAVIYIHGGAFILGSFKMLPYDSMNRWTANKLDAVVIAPDYRLAPQYLFPAALEDCVLVTKFFLQDKVLAKYRVDPTRICISGDSSGGTLAATVTQLLQDDPEYKNKIRAQTLLYPGLQALDTLMPSFREYEHGPFLTRKVAIKMTCLYLSEDKELPKTILRNAHVPKESRHLFKFVNWSDFLPEKYKKNHVYTEPVLGKLSASHPGLVDSRVSPLLVNDSQLQKLPLTYILTCEHDILRDDGLIYVTRLRNVGVTFTHDHIEDGIHGAVSFATAPFHLQLGQRLIDKYIIWLKENL", "length": 401, "header": "tr|F1LVG7-1|F1LVG7_RAT Computationally mapped isoform of Neutral cholesterol ester hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Aadacl2fm3 PE=3 SV=2 CANONICAL=A0A0G2K7F6-1" }, "locus": { "chromosome": "2", "start_pos": 143975453, "end_pos": 143936599, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000065365.4", "url": "https://www.ensembl.org/id/ENSRNOT00000065365.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000062650.2", "url": "https://www.ensembl.org/id/ENSRNOP00000062650.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "rno:120093098", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?rno:120093098", "resource": "KEGG Pathway" }, { "id": "rno:295072", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?rno:295072", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "G3X6X4-1", "protein_name": "Arylacetamide deacetylase", "gene_name": "AADAC", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MLSNTVLLKKQNSYNMRKKYFGFLILGVLLAGYIYVPLPDNVEEPWKIMLLNTFLKTSSYLALFGEILGLNHFMKSMALFSRIQGFPPTSDENIIVKDTTFNDIPVRIYVPQQKTKSLRRGLFYIHGGGWCFGSNDYYSYDLLSRWTAERLDAVVISTNYRLAPKYHFPVQFEDVYTALKWFLDPQNLESYGVDPGRIGISGDSAGGNLAAAVAQQLLEDPDVKIKLKVQTLIYPALQNFDFDLPSYRENAHYPVLSKSLMVRFWSEYFTTDRSLKKAMLSNQHIPLESSNLFKFVNWSSLLPEKFKKGHIYKTPTHGSSELAKKYPGILDVKASPLLADDSKLRGLPLTYVITCQYDVLRDDGLMYVTRLQKSGVQVIHNHVEGAFHGTLAFLFTKVGYRAANQYINWLHENL", "length": 414 }, "evidence": [ { "id": "A0A0G2K7F6", "url": "https://omabrowser.org/oma/group/A0A0G2K7F6/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "J3QPI0-1", "protein_name": "Neutral cholesterol ester hydrolase 1", "gene_name": "Aadacl2fm3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRYKTLCFGFFFIFLAYHTYIPIPENIEEPWKVRVIDAGMKISALMGTLLENMGLMKFEEFFAILMEAQNTKPVSDENITVIDTDFSDIPVRLYLPKRKSEKQRPAVIFIHGGAYILGSFKMLPYDSVNRWTANKLDAVVMAPDYRLAPQHLFPAALEDCIFVIKFFLQDKVLAKYGVDPTRICISGDSSGGTLAATVTQLLQDDPEYKNKIKAQTLLYPALQALDTLMPSHREYKHGPFLTRKVAIRLTCLYLSEDKELPKTILRNAHVPQESRHLFKFVNWSDFLPEKYKKNHVYTEPVLGNLNASHPGLVDSRASPLLVNDSQLQKLPLTYILTCEHDILRDDGLIYVTRLRKVGVPIIHDHVEDGIHGAISFSTAPFYLKLGLRLIDKYIIWLKENL", "length": 401 }, "evidence": [ { "id": "47570064", "url": "http://www.informatics.jax.org/homology/47570064", "database": "MGI" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7F6", "url": "https://www.uniprot.org/uniprot/A0A0G2K7F6" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7F6", "url": "https://www.uniprot.org/uniprot/A0A0G2K7F6" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7F6", "url": "https://www.uniprot.org/uniprot/A0A0G2K7F6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "carboxylic ester hydrolase activity", "id": "GO:0052689", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052689", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7F6", "url": "https://www.uniprot.org/uniprot/A0A0G2K7F6" } ], "pmid": "" }, { "name": "hydrolase activity", "id": "GO:0016787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016787", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7F6", "url": "https://www.uniprot.org/uniprot/A0A0G2K7F6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "lipid catabolic process", "id": "GO:0016042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016042", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7F6", "url": "https://www.uniprot.org/uniprot/A0A0G2K7F6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 233, "end_pos": 235, "annotation": "n_glycosylation_sequon" }, { "start_pos": 437, "end_pos": 439, "annotation": "n_glycosylation_sequon" }, { "start_pos": 461, "end_pos": 463, "annotation": "n_glycosylation_sequon" }, { "start_pos": 478, "end_pos": 480, "annotation": "n_glycosylation_sequon" }, { "start_pos": 78, "end_pos": 80, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "11552", "name": "", "equation": "a 1-O-alkyl-2-acetyl-sn-glycerol + H2O = 1-O-alkyl-sn-glycerol + acetate + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "B2GV54-1", "A0A0G2K7F6-1" ], "evidence": [ { "id": "11552", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/11552" } ] }, { "id": "33875", "name": "", "equation": "cholesteryl (9Z-octadecenoate) + H2O = (9Z)-octadecenoate + cholesterol + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07882-1", "Q64194-1", "P15304-1", "B2GV54-1", "A0A0G2K7F6-1" ], "evidence": [ { "id": "33875", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/33875" } ] }, { "id": "36403", "name": "", "equation": "a cholesterol ester + H2O = a fatty acid + cholesterol + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "B2GV54-1", "A0A0G2K7F6-1", "Q5HZX7-1" ], "evidence": [ { "id": "36403", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/36403" } ] }, { "id": "38563", "name": "", "equation": "1-O-hexadecyl-2-acetyl-sn-glycerol + H2O = 1-O-hexadecyl-sn-glycerol + acetate + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P15304-1", "B2GV54-1", "A0A0G2K7F6-1" ], "evidence": [ { "id": "38563", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38563" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2K7F6", "gene_name": "Aadacl2fm3", "activity": [ { "ec_number": "3.1.1.71", "activity": "a 1-O-alkyl-2-acetyl-sn-glycerol + H2O = 1-O-alkyl-sn-glycerol + acetate + H(+).", "evidence": [ { "id": "A0A0G2K7F6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K7F6" } ] }, { "ec_number": "3.1.1.71", "activity": "", "evidence": [ { "id": "A0A0G2K7F6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K7F6" } ] } ] }, { "uniprot_ac": "B2GV54", "gene_name": "Nceh1", "activity": [ { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "B2GV54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GV54" } ] }, { "ec_number": "3.1.1.71", "activity": "a 1-O-alkyl-2-acetyl-sn-glycerol + H2O = 1-O-alkyl-sn-glycerol + acetate + H(+).", "evidence": [ { "id": "B2GV54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GV54" } ] }, { "ec_number": "3.1.1.71", "activity": "", "evidence": [ { "id": "B2GV54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GV54" } ] } ] }, { "uniprot_ac": "P07882", "gene_name": "Cel", "activity": [ { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "P07882", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07882" } ] }, { "ec_number": "3.1.1.13", "activity": "a cholesterol ester + H2O = a fatty acid + cholesterol + H(+).", "evidence": [ { "id": "P07882", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07882" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "P07882", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07882" } ] }, { "ec_number": "3.1.1.6", "activity": "an acetyl ester + H2O = acetate + an aliphatic alcohol + H(+).", "evidence": [ { "id": "P07882", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07882" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "P07882", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07882" } ] }, { "ec_number": "3.1.1.13", "activity": "", "evidence": [ { "id": "P07882", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07882" } ] }, { "ec_number": "3.1.1.6", "activity": "", "evidence": [ { "id": "P07882", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07882" } ] } ] }, { "uniprot_ac": "P15304", "gene_name": "Lipe", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "P15304", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15304" } ] }, { "ec_number": "3.1.1.79", "activity": "a monoacylglycerol + H2O = a fatty acid + glycerol + H(+).", "evidence": [ { "id": "P15304", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15304" } ] }, { "ec_number": "3.1.1.23", "activity": "", "evidence": [ { "id": "P15304", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15304" } ] }, { "ec_number": "3.1.1.79", "activity": "", "evidence": [ { "id": "P15304", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15304" } ] } ] }, { "uniprot_ac": "Q5HZX7", "gene_name": "Ldah", "activity": [ { "ec_number": "3.1.1.13", "activity": "a cholesterol ester + H2O = a fatty acid + cholesterol + H(+).", "evidence": [ { "id": "Q5HZX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5HZX7" } ] }, { "ec_number": "3.1.1.13", "activity": "", "evidence": [ { "id": "Q5HZX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5HZX7" } ] } ] }, { "uniprot_ac": "Q64194", "gene_name": "Lipa", "activity": [ { "ec_number": "3.1.1.13", "activity": "a cholesterol ester + H2O = a fatty acid + cholesterol + H(+).", "evidence": [ { "id": "Q64194", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64194" } ] }, { "ec_number": "3.1.1.13", "activity": "", "evidence": [ { "id": "Q64194", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64194" } ] } ] } ], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A0G2K7F6-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 556, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A0G2K7F6-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "3.1.1.71", "ec_name": "a 1-O-alkyl-2-acetyl-sn-glycerol + H2O = 1-O-alkyl-sn-glycerol + acetate + H(+).", "evidence": [ { "id": "3.1.1.71", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:3.1.1.71" } ] } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 233, "end_pos": 235 }, { "start_pos": 437, "end_pos": 439 }, { "start_pos": 461, "end_pos": 463 }, { "start_pos": 478, "end_pos": 480 }, { "start_pos": 78, "end_pos": 80 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }