{ "uniprot_canonical_ac": "A0A0G2JYV6-1", "uniprot_ac": "A0A0G2JYV6", "uniprot_id": "A0A0G2JYV6_RAT", "mass": { "chemical_mass": 26515.0, "monoisotopic_mass": 26515.0 }, "refseq": {}, "gene_names": [ { "name": "Prl3a1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2JYV6", "id": "A0A0G2JYV6" }, { "name": "Ghd14", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2JYV6", "id": "A0A0G2JYV6" } ], "protein_names": [ { "name": "Prolactin family 3, subfamily A, member 1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2JYV6/entry#names_and_taxonomy", "id": "A0A0G2JYV6" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JYV6", "url": "https://www.uniprot.org/uniprot/A0A0G2JYV6" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "gene": [ { "name": "Prl3a1", "url": "https://www.uniprot.org/uniprot/A0A0G2JYV6", "locus": { "chromosome": "17", "start_pos": 37693593, "end_pos": 37711959, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000017103", "url": "https://www.ensembl.org/id/ENSRNOG00000017103" } ] } } ], "crossref": [ { "id": "A0A0G2JYV6", "url": "https://alphafold.ebi.ac.uk/entry/A0A0G2JYV6", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSRNOG00000017103", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000017103", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd10288", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd10288", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "266782", "url": "https://www.ncbi.nlm.nih.gov/gene/266782", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001400", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001400", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018116", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018116", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:266782", "url": "https://www.genome.jp/dbget-bin/www_bget?rno:266782", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WTTESEA", "url": "https://omabrowser.org/oma/group/WTTESEA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "Q8K3W4", "url": "https://www.orthodb.org/?gene=Q8K3W4", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11417", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11417", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11417:SF13", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11417:SF13", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00103", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00103", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "731250", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=731250", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2JYV6", "url": "https://www.uniprot.org/uniprot/A0A0G2JYV6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JYV6-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JYV6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8K3W4", "url": "https://www.uniprot.org/uniprot/Q8K3W4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8K3W4-1", "url": "https://www.uniprot.org/uniprot/Q8K3W4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTRFSSSLPVIQQPWVLQLLLVSNVLLWENVYPMPMCPDMEGYNEMFIEDLFDHAIVTAHYTSNLTMQMSEEFGMHFAHSLGYKSRNSSTCHTISLTTPGSNEQIQQTHSDVLLKMMISILRAWYHPLEHLVHAVATLEGICETMLFKVKEVEEKNQEILEKIKAILVRVYPGAEENVYPVWMGLADVRSANELTRHFTLSNLLHCLDSNTDKVATYLEALKCRIIHNNDC", "length": 231, "header": "tr|A0A0G2JYV6-1|A0A0G2JYV6_RAT Isoform 1 of Prolactin family 3, subfamily A, member 1 OS=Rattus norvegicus OX=10116 GN=Prl3a1 PE=3 SV=2 CANONICAL=A0A0G2JYV6-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JYV6-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2JYV6/entry#A0A0G2JYV6-1", "sequence": { "sequence": "MTRFSSSLPVIQQPWVLQLLLVSNVLLWENVYPMPMCPDMEGYNEMFIEDLFDHAIVTAHYTSNLTMQMSEEFGMHFAHSLGYKSRNSSTCHTISLTTPGSNEQIQQTHSDVLLKMMISILRAWYHPLEHLVHAVATLEGICETMLFKVKEVEEKNQEILEKIKAILVRVYPGAEENVYPVWMGLADVRSANELTRHFTLSNLLHCLDSNTDKVATYLEALKCRIIHNNDC", "length": 231, "header": "tr|A0A0G2JYV6-1|A0A0G2JYV6_RAT Isoform 1 of Prolactin family 3, subfamily A, member 1 OS=Rattus norvegicus OX=10116 GN=Prl3a1 PE=3 SV=2 CANONICAL=A0A0G2JYV6-1" }, "locus": { "chromosome": "17", "start_pos": 37709182, "end_pos": 37693726, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000077923.2", "url": "https://www.ensembl.org/id/ENSRNOT00000077923.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000070806.2", "url": "https://www.ensembl.org/id/ENSRNOP00000070806.2" } ] } }, { "isoform_ac": "Q8K3W4-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2JYV6/entry#Q8K3W4-1", "sequence": { "sequence": "MQPVFSQLCSWVLQLLLVSNVLLWENVYPMPMCPDMEGYNEMFIEDLFDHAIVTAHYTSNLTMQMSEEFGMHFAHSLGYKSRNSSTCHTISLTTPGSNEQIQQTHSDVLLKMMISILRAWYHPLEHLVHAVATLEGICETMLFKVKEVEEKNQEILEKIKAILVRVYPGAEENVYPVWMGLADVRSANELTRHFTLSNLLHCLDSNTDKVATYLEALKCRIIHNNDC", "length": 227, "header": "tr|Q8K3W4-1|A0A0G2JYV6_RAT Computationally mapped isoform of Prolactin family 3, subfamily A, member 1 OS=Rattus norvegicus OX=10116 GN=Prl3a1 PE=3 SV=1 CANONICAL=A0A0G2JYV6-1" }, "locus": { "chromosome": "17", "start_pos": 37711747, "end_pos": 37693726, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000023063.4", "url": "https://www.ensembl.org/id/ENSRNOT00000023063.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000023063.4", "url": "https://www.ensembl.org/id/ENSRNOP00000023063.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The mouse prolactin gene family locus.", "journal": "Endocrinology", "date": "2003", "authors": "Wiemers Dustin O, Shao Long-Jiang, Ain Rupasri, Dai Guoli, Soares Michael J", "evidence": [ { "database": "UniProtKB", "id": "Q8K3W4", "url": "https://www.uniprot.org/uniprot/Q8K3W4" } ], "reference": [ { "type": "PubMed", "id": "12488360", "url": "https://glygen.org/publication/PubMed/12488360" } ] }, { "title": "Third party data gene data set of eutherian growth hormone genes.", "journal": "Genom Data", "date": "2015", "authors": "Premzl Marko", "evidence": [ { "database": "UniProtKB", "id": "Q8K3W4", "url": "https://www.uniprot.org/uniprot/Q8K3W4" } ], "reference": [ { "type": "PubMed", "id": "26697363", "url": "https://glygen.org/publication/PubMed/26697363" } ] }, { "title": "Curated eutherian third party data gene data sets.", "journal": "Data Brief", "date": "2016", "authors": "Premzl M", "evidence": [ { "database": "UniProtKB", "id": "Q8K3W4", "url": "https://www.uniprot.org/uniprot/Q8K3W4" } ], "reference": [ { "type": "PubMed", "id": "26862561", "url": "https://glygen.org/publication/PubMed/26862561" } ] } ], "pathway": [ { "id": "rno:266782", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?rno:266782", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q78Y73-1", "protein_name": "Prolactin family 3, subfamily a, member 1", "gene_name": "Prl3a1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MQPVLSQPCSWMFQVLLVSNLLLWENVYSMPMCFDMEGYNEITIEELFDSAIFMAQYISNLTTQMSEEFDANFVHSLGYKARNSSNCHTTSLATPASTEQIQQTQSDVLLKMVISISRAWYHPLKQLVRALATLEGACKTILLKVIEVKETNQEILGELKAILIRVHPGAEENVYAAWMGLADVKSADDNTRYFALSNILHCLDSDTNKVATYLEALKCRIIHHNNC", "length": 227 }, "evidence": [ { "id": "47563657", "url": "http://www.informatics.jax.org/homology/47563657", "database": "MGI" }, { "id": "A0A0G2JYV6", "url": "https://omabrowser.org/oma/group/A0A0G2JYV6/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "prolactin receptor binding", "id": "GO:0005148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005148", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JYV6", "url": "https://www.uniprot.org/uniprot/A0A0G2JYV6" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JYV6", "url": "https://www.uniprot.org/uniprot/A0A0G2JYV6" } ], "pmid": "" }, { "name": "hormone activity", "id": "GO:0005179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005179", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JYV6", "url": "https://www.uniprot.org/uniprot/A0A0G2JYV6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JYV6", "url": "https://www.uniprot.org/uniprot/A0A0G2JYV6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JYV6", "url": "https://www.uniprot.org/uniprot/A0A0G2JYV6" } ], "pmid": "" }, { "name": "response to nutrient levels", "id": "GO:0031667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031667", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JYV6", "url": "https://www.uniprot.org/uniprot/A0A0G2JYV6" } ], "pmid": "" }, { "name": "female pregnancy", "id": "GO:0007565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007565", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JYV6", "url": "https://www.uniprot.org/uniprot/A0A0G2JYV6" } ], "pmid": "" }, { "name": "positive regulation of receptor signaling pathway via JAK-STAT", "id": "GO:0046427", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046427", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JYV6", "url": "https://www.uniprot.org/uniprot/A0A0G2JYV6" } ], "pmid": "" }, { "name": "mammary gland development", "id": "GO:0030879", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030879", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JYV6", "url": "https://www.uniprot.org/uniprot/A0A0G2JYV6" } ], "pmid": "" }, { "name": "positive regulation of lactation", "id": "GO:1903489", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903489", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JYV6", "url": "https://www.uniprot.org/uniprot/A0A0G2JYV6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 64, "end_pos": 66, "annotation": "n_glycosylation_sequon" }, { "start_pos": 87, "end_pos": 89, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A0G2JYV6-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 231, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A0G2JYV6-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 64, "end_pos": 66 }, { "start_pos": 87, "end_pos": 89 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }