{
    "uniprot_canonical_ac": "A0A0G2JV96-1",
    "uniprot_ac": "A0A0G2JV96",
    "uniprot_id": "A0A0G2JV96_RAT",
    "mass": {
        "chemical_mass": 34461.0,
        "monoisotopic_mass": 34461.0
    },
    "refseq": {
        "ac": "NP_001000758",
        "name": "olfactory receptor Olr347",
        "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000758"
    },
    "gene_names": [
        {
            "name": "Or5b100",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/A0A0G2JV96",
            "id": "A0A0G2JV96"
        },
        {
            "name": "Olr347",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000758",
            "id": "NP_001000758"
        },
        {
            "name": "Or5b100",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000758",
            "id": "NP_001000758"
        }
    ],
    "protein_names": [
        {
            "name": "Olfactory receptor",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprotkb/A0A0G2JV96/entry#names_and_taxonomy",
            "id": "A0A0G2JV96"
        },
        {
            "name": "olfactory receptor Olr347",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000758",
            "id": "NP_001000758"
        },
        {
            "name": "olfactory receptor gene Olr347; olfactory receptor 347",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000758",
            "id": "NP_001000758"
        }
    ],
    "function": [
        {
            "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001000758",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000758"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:3211",
            "recommended_name": {
                "id": "DOID:3211",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:3211",
                "name": "lysosomal storage disease",
                "description": "An inherited metabolic disorder that involve an abnormal accumulation of substances inside the lysosome resulting from defects in lysosomal function."
            },
            "synonyms": [
                {
                    "id": "DOID:3211",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:3211",
                    "name": "disorder of lysosomal enzyme",
                    "description": ""
                },
                {
                    "id": "DOID:3211",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:3211",
                    "name": "inborn lysosomal enzyme disorder",
                    "description": ""
                },
                {
                    "id": "DOID:3211",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:3211",
                    "name": "lysosomal storage metabolism disorder",
                    "description": ""
                }
            ],
            "evidence": [
                {
                    "id": "3211",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:3211"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Rattus norvegicus",
            "taxid": 10116,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0G2JV96",
                    "url": "https://www.uniprot.org/uniprot/A0A0G2JV96"
                }
            ],
            "common_name": "Rat",
            "glygen_name": "Rat",
            "reference_species": "Rattus norvegicus [10116]"
        }
    ],
    "gene": [
        {
            "name": "Or5b100",
            "url": "https://www.uniprot.org/uniprot/A0A0G2JV96",
            "locus": {
                "chromosome": "1",
                "start_pos": 210165428,
                "end_pos": 210164505,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSRNOG00000066931",
                        "url": "https://www.ensembl.org/id/ENSRNOG00000066931"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "A0A0G2JV96",
            "url": "https://alphafold.ebi.ac.uk/entry/A0A0G2JV96",
            "database": "AlphaFoldDB",
            "categories": []
        },
        {
            "id": "cd15407",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15407",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "405031",
            "url": "https://www.ncbi.nlm.nih.gov/gene/405031",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR000276",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR000725",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017452",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "rno:405031",
            "url": "https://www.genome.jp/dbget-bin/www_bget?rno:405031",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "VWISYIS",
            "url": "https://omabrowser.org/oma/group/VWISYIS/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "A0A0G2JV96",
            "url": "https://www.orthodb.org/?gene=A0A0G2JV96",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR48018",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR48018:SF114",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018:SF114",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF13853",
            "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_001000758",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000758",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "1333760",
            "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1333760",
            "database": "RGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "A0A0G2JV96",
            "url": "https://www.uniprot.org/uniprot/A0A0G2JV96",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A0G2JV96-1",
            "url": "https://www.uniprot.org/uniprot/A0A0G2JV96-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MENRTEVTQFFLLGLTNDPGLQHPLFIIFLLIYTITLVGNLGLILLIVLDAHLHSPMYIFLGNLSLVDFCYSSGVTPKVMAGFLVGDKVMYYNDCAAQMFFVTGFATVENYLLASMAYDRYAAVCKPLHYASTMTTGMCVWMIAGCYACGFLNACIYTGDAFSLSFCRADVVHHFFCDIPAVMVLSCSDNHVNELLLVCVASFNIFFALIIIIISYLMIFITILKMRSAAGHQKAMSTCISHFTAVFIFYGTVIFMYLQPSSSHAMDTDKTVSVFYTMVIPLLNPLVYSLRNKEVKSAFRKFIFRLK",
        "length": 307,
        "header": "tr|A0A0G2JV96-1|A0A0G2JV96_RAT Isoform 1 of Olfactory receptor  OS=Rattus norvegicus OX=10116 GN=Or5b100 PE=3 SV=1 CANONICAL=A0A0G2JV96-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A0G2JV96-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A0G2JV96/entry#A0A0G2JV96-1",
            "sequence": {
                "sequence": "MENRTEVTQFFLLGLTNDPGLQHPLFIIFLLIYTITLVGNLGLILLIVLDAHLHSPMYIFLGNLSLVDFCYSSGVTPKVMAGFLVGDKVMYYNDCAAQMFFVTGFATVENYLLASMAYDRYAAVCKPLHYASTMTTGMCVWMIAGCYACGFLNACIYTGDAFSLSFCRADVVHHFFCDIPAVMVLSCSDNHVNELLLVCVASFNIFFALIIIIISYLMIFITILKMRSAAGHQKAMSTCISHFTAVFIFYGTVIFMYLQPSSSHAMDTDKTVSVFYTMVIPLLNPLVYSLRNKEVKSAFRKFIFRLK",
                "length": 307,
                "header": "tr|A0A0G2JV96-1|A0A0G2JV96_RAT Isoform 1 of Olfactory receptor  OS=Rattus norvegicus OX=10116 GN=Or5b100 PE=3 SV=1 CANONICAL=A0A0G2JV96-1"
            },
            "locus": {
                "chromosome": "1",
                "start_pos": 210165425,
                "end_pos": 210164505,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSRNOT00000089953.2",
                        "url": "https://www.ensembl.org/id/ENSRNOT00000089953.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSRNOP00000069399.1",
                        "url": "https://www.ensembl.org/id/ENSRNOP00000069399.1"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [],
    "pathway": [
        {
            "id": "rno:405031",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/www_bget?rno:405031",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q8VFW4-1",
            "protein_name": "Olfactory receptor",
            "gene_name": "Or5b112",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MTSLNNLTEVTHFLLLGLTDDPGLQLPLFIIFLLIYIITLVGNLGMILLILLDSRLHIPMYFFLANLSLVDVIYSSAVTPKVMAGLIIGDNLISYNECAAQMFFFAAFATVENYLLTSMACDRYAAVCKPLYYATTMTPSVCMCFIMGCYALGFLNASVYLGNTFSLSFCKSNVVHHFFCDMPAIMALSCSDRHVNELVLIYQASFIIFFALIIILISYIIIFITILKMHSEAGVQKALSTCASHFTAVFIFYGTTIFMYLQPSSRHAMDTDKIVSVFYTMVIPMLNPLVYSLRNKEVKSAFMKVVLKEK",
                "length": 310
            },
            "evidence": [
                {
                    "id": "A0A0G2JV96",
                    "url": "https://omabrowser.org/oma/group/A0A0G2JV96/",
                    "database": "OMA"
                }
            ],
            "glygen_name": "Mouse",
            "common_name": "Mouse"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 3,
                "go_terms": [
                    {
                        "name": "G protein-coupled receptor activity",
                        "id": "GO:0004930",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A0G2JV96",
                                "url": "https://www.uniprot.org/uniprot/A0A0G2JV96"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "olfactory receptor activity",
                        "id": "GO:0004984",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A0G2JV96",
                                "url": "https://www.uniprot.org/uniprot/A0A0G2JV96"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "odorant binding",
                        "id": "GO:0005549",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005549",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A0G2JV96",
                                "url": "https://www.uniprot.org/uniprot/A0A0G2JV96"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A0G2JV96",
                                "url": "https://www.uniprot.org/uniprot/A0A0G2JV96"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 2,
                "go_terms": [
                    {
                        "name": "G protein-coupled receptor signaling pathway",
                        "id": "GO:0007186",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A0G2JV96",
                                "url": "https://www.uniprot.org/uniprot/A0A0G2JV96"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "sensory perception of smell",
                        "id": "GO:0007608",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A0G2JV96",
                                "url": "https://www.uniprot.org/uniprot/A0A0G2JV96"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 3,
            "end_pos": 5,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 63,
            "end_pos": 65,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "structures": [
        {
            "pdb_id": "AF-A0A0G2JV96-F1",
            "pdb_chain": "global",
            "start_pos": 1,
            "end_pos": 307,
            "overlap": "1.0",
            "method": "AlphaFold",
            "type": "alphafold",
            "resolution": -1.0,
            "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A0G2JV96-F1.pdb"
        }
    ],
    "synthesized_glycans": [],
    "enzyme_annotation": [],
    "cluster_types": [
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": [
            {
                "start_pos": 3,
                "end_pos": 5
            },
            {
                "start_pos": 63,
                "end_pos": 65
            }
        ]
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        }
    ]
}