{ "uniprot_canonical_ac": "A0A0G2JFS9-1", "uniprot_ac": "A0A0G2JFS9", "uniprot_id": "A0A0G2JFS9_MOUSE", "mass": { "chemical_mass": 45187.0, "monoisotopic_mass": 45187.0 }, "refseq": {}, "gene_names": [ { "name": "Atg4a-ps", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9", "id": "A0A0G2JFS9" } ], "protein_names": [ { "name": "Cysteine protease", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0G2JFS9/entry#names_and_taxonomy", "id": "A0A0G2JFS9" }, { "name": "3.4.22.-", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2JFS9/entry#names_and_taxonomy", "id": "A0A0G2JFS9" } ], "function": [ { "annotation": "Cysteine protease that plays a key role in autophagy by mediating both proteolytic activation and delipidation of ATG8 family proteins.", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JFS9", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9#function" }, { "database": "UniProtKB", "id": "RU363115", "url": "https://www.uniprot.org/uniprot/RU363115#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JFS9", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "Atg4a-ps", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9", "locus": { "chromosome": "3", "start_pos": 103551270, "end_pos": 103553384, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000087119", "url": "https://www.ensembl.org/id/ENSMUSG00000087119" } ] } } ], "crossref": [ { "id": "A0A0G2JFS9", "url": "https://alphafold.ebi.ac.uk/entry/A0A0G2JFS9", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSMUSG00000087119", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000087119", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR005078", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005078", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038765", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038765", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046792", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046792", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046793", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046793", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "3615624", "url": "http://www.informatics.jax.org/marker/MGI:3615624", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "FPPFVPY", "url": "https://omabrowser.org/oma/group/FPPFVPY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR22624", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22624", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22624:SF35", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22624:SF35", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03416", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF03416", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF20166", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF20166", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "67548", "url": "https://www.rhea-db.org/rhea/67548", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0G2JFS9", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JFS9-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MESVMSKYENQILIFPDYLEEFPDTDELVWILGKQHPFKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWNWERQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVIKKLTLFDEWNSLAVYVSMDNTVVIEDIKKMCCVLPVGAADPAGDFLTVSNQSRDTSVPCSAWKPLLLIVPLRLGINQINPVYVEAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDIEESGLVDDQTFHCLQSPQRMSILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIESTEQLEDFELEEDFEILSVG", "length": 396, "header": "tr|A0A0G2JFS9-1|A0A0G2JFS9_MOUSE Isoform 1 of Cysteine protease OS=Mus musculus OX=10090 GN=Atg4a-ps PE=3 SV=1 CANONICAL=A0A0G2JFS9-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JFS9-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2JFS9/entry#A0A0G2JFS9-1", "sequence": { "sequence": "MESVMSKYENQILIFPDYLEEFPDTDELVWILGKQHPFKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWNWERQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVIKKLTLFDEWNSLAVYVSMDNTVVIEDIKKMCCVLPVGAADPAGDFLTVSNQSRDTSVPCSAWKPLLLIVPLRLGINQINPVYVEAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDIEESGLVDDQTFHCLQSPQRMSILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIESTEQLEDFELEEDFEILSVG", "length": 396, "header": "tr|A0A0G2JFS9-1|A0A0G2JFS9_MOUSE Isoform 1 of Cysteine protease OS=Mus musculus OX=10090 GN=Atg4a-ps PE=3 SV=1 CANONICAL=A0A0G2JFS9-1" }, "locus": { "chromosome": "3", "start_pos": 103553339, "end_pos": 103552152, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000117271.3", "url": "https://www.ensembl.org/id/ENSMUST00000117271.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000143291.2", "url": "https://www.ensembl.org/id/ENSMUSP00000143291.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "autophagosome assembly", "id": "GO:0000045", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000045", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JFS9", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9" } ], "pmid": "" }, { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JFS9", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9" } ], "pmid": "" }, { "name": "protein transport", "id": "GO:0015031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015031", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JFS9", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9" } ], "pmid": "" }, { "name": "protein processing", "id": "GO:0016485", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016485", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JFS9", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9" } ], "pmid": "" }, { "name": "mitophagy", "id": "GO:0000423", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000423", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JFS9", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9" } ], "pmid": "" }, { "name": "piecemeal microautophagy of the nucleus", "id": "GO:0034727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034727", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JFS9", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9" } ], "pmid": "" }, { "name": "aggrephagy", "id": "GO:0035973", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035973", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JFS9", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JFS9", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "cysteine-type endopeptidase activity", "id": "GO:0004197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004197", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JFS9", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9" } ], "pmid": "" }, { "name": "protein-phosphatidylethanolamide deconjugating activity", "id": "GO:0019786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019786", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JFS9", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 205, "end_pos": 207, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "67548", "name": "", "equation": "[protein]-C-terminal L-amino acid-glycyl-phosphatidylethanolamide + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phosphoethanolamine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8C9S8-1", "Q8BGE6-1", "A0A0G2JFS9-1", "Q811C2-1", "Q8BGV9-1" ], "evidence": [ { "id": "67548", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/67548" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JFS9", "gene_name": "Atg4a-ps", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "A0A0G2JFS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9" } ] } ] }, { "uniprot_ac": "Q811C2", "gene_name": "Atg4c", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q811C2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q811C2" } ] } ] }, { "uniprot_ac": "Q8BGE6", "gene_name": "Atg4b", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q8BGE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGE6" } ] } ] }, { "uniprot_ac": "Q8BGV9", "gene_name": "Atg4d", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q8BGV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGV9" } ] } ] }, { "uniprot_ac": "Q8C9S8", "gene_name": "Atg4a", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q8C9S8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C9S8" } ] } ] } ], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A0G2JFS9-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 396, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A0G2JFS9-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 205, "end_pos": 207 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }