{ "uniprot_canonical_ac": "A0A0G2JDV3-1", "uniprot_ac": "A0A0G2JDV3", "uniprot_id": "GBP6_MOUSE", "mass": { "chemical_mass": 70443.0, "monoisotopic_mass": 70443.0 }, "refseq": {}, "gene_names": [ { "name": "Gbp6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3", "id": "A0A0G2JDV3" }, { "name": "Mpa2l", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3", "id": "A0A0G2JDV3" } ], "protein_names": [ { "name": "Guanylate-binding protein 6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0G2JDV3/entry#names_and_taxonomy", "id": "A0A0G2JDV3" }, { "name": "3.6.5.-", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2JDV3/entry#names_and_taxonomy", "id": "A0A0G2JDV3" }, { "name": "GBP-6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2JDV3/entry#names_and_taxonomy", "id": "A0A0G2JDV3" }, { "name": "GTP-binding protein 6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2JDV3/entry#names_and_taxonomy", "id": "A0A0G2JDV3" }, { "name": "Guanine nucleotide-binding protein 6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2JDV3/entry#names_and_taxonomy", "id": "A0A0G2JDV3" }, { "name": "Macrophage activation 2 like protein", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2JDV3/entry#names_and_taxonomy", "id": "A0A0G2JDV3" } ], "function": [ { "annotation": "Interferon (IFN)-inducible GTPase that plays important roles in innate immunity against a diverse range of bacterial, viral and protozoan pathogens, such as bacterial pathogens Listeria monocytogenes and Mycobacterium bovis BCG as well as the protozoan pathogen Toxoplasma gondii (PubMed:18025219, PubMed:21551061). Confers protection to several pathogens, including the bacterial pathogens Listeria monocytogenes and Mycobacterium bovis BCG as well as the protozoan pathogen Toxoplasma gondii (PubMed:18025219, PubMed:21551061).", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JDV3", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3#function" }, { "database": "PubMed", "id": "18025219", "url": "https://glygen.org/publication/PubMed/18025219" }, { "database": "PubMed", "id": "21551061", "url": "https://glygen.org/publication/PubMed/21551061" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JDV3", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "Gbp6", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3", "locus": { "chromosome": "5", "start_pos": 105418568, "end_pos": 105441564, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000104713", "url": "https://www.ensembl.org/id/ENSMUSG00000104713" } ] } } ], "crossref": [ { "id": "A0A0G2JDV3", "url": "https://alphafold.ebi.ac.uk/entry/A0A0G2JDV3", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSMUSG00000104713", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000104713", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd01851", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01851", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd16269", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16269", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "100702", "url": "https://www.ncbi.nlm.nih.gov/gene/100702", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003191", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003191", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015894", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015894", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030386", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030386", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036543", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036543", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037684", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037684", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:100702", "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:100702", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2140937", "url": "http://www.informatics.jax.org/marker/MGI:2140937", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "MECILAG", "url": "https://omabrowser.org/oma/group/MECILAG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "QRTHREN", "url": "https://omabrowser.org/oma/group/QRTHREN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0G2JDV3", "url": "https://www.orthodb.org/?gene=A0A0G2JDV3", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10751", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10751", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10751:SF126", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10751:SF126", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02263", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02263", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02841", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02841", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A0G2JDV3", "url": "http://purl.obolibrary.org/obo/PR_A0A0G2JDV3", "database": "PRO", "categories": [ "Protein" ] }, { "id": "19669", "url": "https://www.rhea-db.org/rhea/19669", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0G2JDV3", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JDV3-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JF24", "url": "https://www.uniprot.org/uniprot/A0A0G2JF24", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JF24-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JF24-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q0QEH4", "url": "https://www.uniprot.org/uniprot/A0A8Q0QEH4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q0QEH4-1", "url": "https://www.uniprot.org/uniprot/A0A8Q0QEH4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTQPQMAPICLVENHNEQLSVNQEAIEILDKISQPVVVVAIVGLYRTGKSYLMNCLAGQNHGFPLGSTVQSQTKGIWMWCMPHPTKPEHTLVLLDTEGLGDVEKGDPKNDLWIFALSVLLSSTFIYNSMITINHQALEQLQYVTELTELIRAKSSPNPAGIKNSTEFVSFFPDFVWTVRDFMLELKLNGEDITSDDYLENALKLIPGDKPRMQASNSCRECIRLFFPNRKCFVFDRPTHDKELLQKLDSITEDQLDPKFQEVTKAFVSYIFTYAKIKTLKEGIKVTGNRLGILVTTYVNAINSGAVPCLDDAVTTLAQRENSVAVQKAADHYSEQMAQRLRLPTETLQELLDVHAACEKEAMAVFMEHSFKDENQQFLKKLVELIGENKELFLSKNEEASNKYCQEELDRLSKDFMENISTFFVPCGHKLYMDKREKIEHDYWQVPRKGVKASEVFQSFLQSQAFIESSILQADTALTAGEKAIAEERAQKVAAEKEQELLRQKQKEQQEYMEAQEKSHKENLEQLRRKLEQEREQDIKDHDMMLKKLMKDQKAFLEEGFKKKAEEMNKEIQQLRDVIKDKKRNTDRIKEALLNGFSTVLFHYLVRYLKHL", "length": 611, "header": "sp|A0A0G2JDV3-1|GBP6_MOUSE Isoform 1 of Guanylate-binding protein 6 OS=Mus musculus OX=10090 GN=Gbp6 PE=2 SV=2 CANONICAL=A0A0G2JDV3-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JDV3-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2JDV3/entry#A0A0G2JDV3-1", "sequence": { "sequence": "MTQPQMAPICLVENHNEQLSVNQEAIEILDKISQPVVVVAIVGLYRTGKSYLMNCLAGQNHGFPLGSTVQSQTKGIWMWCMPHPTKPEHTLVLLDTEGLGDVEKGDPKNDLWIFALSVLLSSTFIYNSMITINHQALEQLQYVTELTELIRAKSSPNPAGIKNSTEFVSFFPDFVWTVRDFMLELKLNGEDITSDDYLENALKLIPGDKPRMQASNSCRECIRLFFPNRKCFVFDRPTHDKELLQKLDSITEDQLDPKFQEVTKAFVSYIFTYAKIKTLKEGIKVTGNRLGILVTTYVNAINSGAVPCLDDAVTTLAQRENSVAVQKAADHYSEQMAQRLRLPTETLQELLDVHAACEKEAMAVFMEHSFKDENQQFLKKLVELIGENKELFLSKNEEASNKYCQEELDRLSKDFMENISTFFVPCGHKLYMDKREKIEHDYWQVPRKGVKASEVFQSFLQSQAFIESSILQADTALTAGEKAIAEERAQKVAAEKEQELLRQKQKEQQEYMEAQEKSHKENLEQLRRKLEQEREQDIKDHDMMLKKLMKDQKAFLEEGFKKKAEEMNKEIQQLRDVIKDKKRNTDRIKEALLNGFSTVLFHYLVRYLKHL", "length": 611, "header": "sp|A0A0G2JDV3-1|GBP6_MOUSE Isoform 1 of Guanylate-binding protein 6 OS=Mus musculus OX=10090 GN=Gbp6 PE=2 SV=2 CANONICAL=A0A0G2JDV3-1" }, "locus": {} }, { "isoform_ac": "A0A0G2JF24-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2JDV3/entry#A0A0G2JF24-1", "sequence": { "sequence": "MTQPQMAPICLVENHNEQLSVNQEAIEILDKISQPVVVVAIVGLYRTGKSYLMNCLAGQNHG", "length": 62, "header": "tr|A0A0G2JF24-1|A0A0G2JF24_MOUSE Computationally mapped isoform of Guanylate binding protein 6 OS=Mus musculus OX=10090 GN=Gbp6 PE=3 SV=1 CANONICAL=A0A0G2JDV3-1" }, "locus": { "chromosome": "5", "start_pos": 105438886, "end_pos": 105428429, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000200045.5", "url": "https://www.ensembl.org/id/ENSMUST00000200045.5" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000142994.2", "url": "https://www.ensembl.org/id/ENSMUSP00000142994.2" } ] } }, { "isoform_ac": "A0A8Q0QEH4-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2JDV3/entry#A0A8Q0QEH4-1", "sequence": { "sequence": "MTQPQMAPICLVENHNEQLSVNQEAIEILDKISQPVVVVAIVGLYRTGKSYLMNCLAGQNHGFPLGSTVQSQTKGIWMWCMPHPTKPEHTLVLLDTEGLGDVEKGDPKNDLWIFALSVLLSSTFIYNSMITINHQALEQLHYVTELTELIRAKSSPNPAGIKNSTEFVSFFPDFVWTVRDFMLELKLNGEDITSDDYLENALKLIPGDKPRMQASNSCRECIRLFFPNRKCFVFDRPTHDKELLQKLDSITEDQLDPKFQEVTKAFVSYIFTYAKIKTLKEGIKVTGNRLGILVTTYVNAINSGAVPCLDDAVTTLAQRENSVAVQKAADHYSEQMAQRLRLPTETLQELLDVHAACEKEAMAVFMEHSFKDENQQFLKKLVELIGENKELFLSKNEEASNKYCQEELDRLSKDFMENISTFFVPCGHKLYMDKREKIEHDYWQVPRKGVKASEVFQSFLQSQAFIESSILQADTALTAGEKAIAEERAQKVAAEKEQELLRQKQKEQQEYMEAQEKSHKENLEQLRRKLEQEREQDIKDHDMMLKKLMKDQKAFLEEGFKKKAEEMNKEIQQLRDVIKDKKRNTDRIKEALLNGFSTVLFHYLVRYLKHL", "length": 611, "header": "tr|A0A8Q0QEH4-1|A0A8Q0QEH4_MOUSE Computationally mapped isoform of Guanylate binding protein 6 OS=Mus musculus OX=10090 GN=Gbp6 PE=3 SV=1 CANONICAL=A0A0G2JDV3-1" }, "locus": { "chromosome": "5", "start_pos": 105438886, "end_pos": 105420971, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000196520.2", "url": "https://www.ensembl.org/id/ENSMUST00000196520.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000142518.2", "url": "https://www.ensembl.org/id/ENSMUSP00000142518.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool": "", "mining_tool": "", "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "37507081", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37507081" }, { "id": "A0A0G2JDV3", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A0A0G2JDV3" } ], "filter_code": "00000000000000000000.0000000.00000001000000.1000000.0100000000.10010000111101.00000.01000" } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Extensive characterization of IFN-induced GTPases mGBP1 to mGBP10 involved in host defense.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Degrandi D, Konermann C, Beuter-Gunia C, Kresse A, Wurthner J, Kurig S, Beer S, Pfeffer K", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JDV3", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3" } ], "reference": [ { "type": "PubMed", "id": "18025219", "url": "https://glygen.org/publication/PubMed/18025219" } ] }, { "title": "A family of IFN-gamma-inducible 65-kD GTPases protects against bacterial infection.", "journal": "Science (New York, N.Y.)", "date": "2011", "authors": "Kim BH, Shenoy AR, Kumar P, Das R, Tiwari S, MacMicking JD", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JDV3", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3" } ], "reference": [ { "type": "PubMed", "id": "21551061", "url": "https://glygen.org/publication/PubMed/21551061" } ] }, { "title": "Differential Detection of O-GlcNAcylated proteins in the heart using antibodies.", "journal": "Analytical biochemistry", "date": "2023-10-01", "authors": "Narayanan Bhargavi, Zahra Fiddia, Reeves Russell A, Aggarwal Akanksha, O'Meally Robert N, Henry Roger K, Craven Megan, Jacobson Avital, Cole Robert N, Kohr Mark J, Umapathi Priya, Zachara Natasha E", "evidence": [ { "database": "O-GlcNAc Database", "id": "A0A0G2JDV3", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A0A0G2JDV3" } ], "reference": [ { "type": "PubMed", "id": "37507081", "url": "https://glygen.org/publication/PubMed/37507081" } ] } ], "pathway": [ { "id": "mmu:100702", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:100702", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I6A3C3-1", "protein_name": "Guanylate binding protein family member 6", "gene_name": "Gbp6", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAPICLVENHNERLSVNQKAIEILDKISQPVVVVAIVGLYRTGKSYLMNCLAGQNHGFPLGSTVQSQTKGIWMWCVPHPTKPKHTLVLLDTEGLGDVEKGDPKNDSWIFALAVLLSSTFVYNSLSTINHQALEQLYYVTELTKLIRARSSPNPDGIKNSTEFVSFFPDFVWTVRDFMLELTLNGKNITSDEYLENALKLIPGNSPRIQASNLPRECIRQFFPNRKCFVFDRPTHDKELLQKLETISEDQLDPNFREGTKAFVSYIFTYAKMKTLREGIKVTGNRLGTLVTTYVDAINSGAVPCLDDAVTTLAQRENSVAVQKAVDHYSEQMAQRLRLPTDTLQELLDEHTACEKEAISVFMEHSFKDENQLFLKKLVKLIGEKKGLFVLKNEEASDKYCQEELDRLSKDFMENISTFSVPGGHRLYVDMREKIERDYWQVPRKGVKASEVFQSFLQSQVIIESSILQADTALTAGEKAIAEERTQREAAEKEQELLRQKQREQQQLMEAQEKSNKENLEQLREKLVQERKQLIEEHNMMLEKQLKVGLLIPLVVLVPQVVGEGWRPGHGETP", "length": 572 }, "evidence": [ { "id": "A0A0G2JDV3", "url": "https://omabrowser.org/oma/group/A0A0G2JDV3/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6ZN66-1", "protein_name": "Guanylate-binding protein 6", "gene_name": "GBP6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MESGPKMLAPVCLVENNNEQLLVNQQAIQILEKISQPVVVVAIVGLYRTGKSYLMNHLAGQNHGFPLGSTVQSETKGIWMWCVPHPSKPNHTLVLLDTEGLGDVEKGDPKNDSWIFALAVLLCSTFVYNSMSTINHQALEQLHYVTELTELIKAKSSPRPDGVEDSTEFVSFFPDFLWTVRDFTLELKLNGHPITEDEYLENALKLIQGNNPRVQTSNFPRECIRRFFPKRKCFVFDRPTNDKDLLANIEKVSEKQLDPKFQEQTNIFCSYIFTHARTKTLREGITVTGNRLGTLAVTYVEAINSGAVPCLENAVITLAQRENSAAVQRAADYYSQQMAQRVKLPTDTLQELLDMHAACEREAIAIFMEHSFKDENQEFQKKFMETTMNKKGDFLLQNEESSVQYCQAKLNELSKGLMESISAGSFSVPGGHKLYMETKERIEQDYWQVPRKGVKAKEVFQRFLESQMVIEESILQSDKALTDREKAVAVDRAKKEAAEKEQELLKQKLQEQQQQMEAQDKSRKENIAQLKEKLQMEREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGVSSLFKKHKLPF", "length": 633 }, "evidence": [ { "id": "47562225", "url": "http://www.informatics.jax.org/homology/47562225", "database": "MGI" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "GTPase activity", "id": "GO:0003924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JDV3", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3" } ], "pmid": "" }, { "name": "GTP binding", "id": "GO:0005525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JDV3", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "cellular response to type II interferon", "id": "GO:0071346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071346", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JDV3", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3" } ], "pmid": "" }, { "name": "adhesion of symbiont to host", "id": "GO:0044406", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044406", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JDV3", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3" } ], "pmid": "" }, { "name": "defense response to Gram-positive bacterium", "id": "GO:0050830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050830", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JDV3", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3" } ], "pmid": "" }, { "name": "response to bacterium", "id": "GO:0009617", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009617", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JDV3", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3" } ], "pmid": "" }, { "name": "cellular response to lipopolysaccharide", "id": "GO:0071222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071222", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JDV3", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3" } ], "pmid": "" }, { "name": "cellular response to interferon-beta", "id": "GO:0035458", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035458", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JDV3", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3" } ], "pmid": "" }, { "name": "defense response to protozoan", "id": "GO:0042832", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042832", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JDV3", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JDV3", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3" } ], "pmid": "" }, { "name": "symbiont-containing vacuole membrane", "id": "GO:0020005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020005", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JDV3", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 163, "end_pos": 165, "annotation": "n_glycosylation_sequon" }, { "start_pos": 418, "end_pos": 420, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "19669", "name": "", "equation": "GTP + H2O = GDP + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61021-1", "Q62293-1", "Q61107-1", "P60766-2", "Q8BZ98-1", "Q8CFB4-1", "Q8C3X4-1", "P32233-1", "Q9Z0E6-1", "Q9QXB9-1", "Q01514-1", "Q8K1M6-12", "P39053-1", "P39054-1", "Q8C262-1", "Q8C7H1-1", "Q5S006-1", "Q80U63-1", "Q811U4-1", "Q9QZ85-1", "Q05D44-1", "P58281-1", "Q99P58-1", "Q9QUI0-1", "Q9ERI2-1", "P63001-1", "Q9CQD1-1", "Q3T9E4-1", "Q7TQD2-1", "P56371-1", "P62821-1", "P62492-1", "Q91ZR1-1", "P35278-1", "P46638-1", "P51150-1", "Q3TCT4-1", "Q9CQW2-1", "Q9D1G1-1", "P61226-1", "P61027-1", "P62071-1", "Q99JI6-1", "Q8R367-1", "Q922H7-1", "Q8BU31-1", "Q80ZJ1-1", "Q80X95-1", "O08989-1", "P70426-1", "Q8K5A4-1", "P10833-1", "P70425-1", "Q61411-1", "Q5SSG5-1", "Q7TT45-1", "Q6NTA4-1", "Q99K70-1", "Q9JIW9-1", "Q08AT1-1", "P60764-1", "P62835-1", "P63321-1", "Q6IMB1-1", "P32883-1", "Q9Z0N2-1", "Q9Z0N1-1", "P08556-1", "Q7TN89-1", "A4UUI3-1", "Q8VEH6-1", "A0A0G2JDV3-1", "P68368-1", "Q91Z40-1", "P62331-1", "Q60766-1", "A0A140LIF8-1", "Q9DCE9-1", "Q3UX10-1", "Q9JJZ2-1", "Q0GUM3-1", "E9PXC0-1", "P53994-1", "P59279-1", "P62827-1", "P68369-1", "P55258-1", "P61294-1", "Q61820-1", "P05214-1", "P05213-1", "P68373-1", "P84078-1", "Q9CQA9-1", "Q69ZS7-1", "Q921J2-1", "Q149F3-1", "Q8R050-1", "P14576-1", "P55772-1", "Q8R2Q4-1", "B2RVE2-1", "P10126-1", "Q9JHW4-1", "P61222-1", "P58252-1", "Q5PR73-1", "Q91V41-1", "P36536-1", "Q9CQC9-1" ], "evidence": [ { "id": "19669", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/19669" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JDV3", "gene_name": "Gbp6", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "A0A0G2JDV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3" } ] } ] }, { "uniprot_ac": "A0A140LIF8", "gene_name": "Irgm2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "A0A140LIF8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A140LIF8" } ] } ] }, { "uniprot_ac": "A4UUI3", "gene_name": "Gbp4", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "A4UUI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A4UUI3" } ] } ] }, { "uniprot_ac": "B2RVE2", "gene_name": "Rergl", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "B2RVE2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RVE2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "B2RVE2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RVE2" } ] } ] }, { "uniprot_ac": "E9PXC0", "gene_name": "Srp54c", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "E9PXC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PXC0" } ] } ] }, { "uniprot_ac": "O08989", "gene_name": "Mras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O08989", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08989" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O08989", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08989" } ] } ] }, { "uniprot_ac": "P05213", "gene_name": "Tuba1b", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P05213", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05213" } ] } ] }, { "uniprot_ac": "P05214", "gene_name": "Tuba3a", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P05214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05214" } ] } ] }, { "uniprot_ac": "P08556", "gene_name": "Nras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P08556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08556" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P08556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08556" } ] } ] }, { "uniprot_ac": "P10126", "gene_name": "Eef1a1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P10126", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10126" } ] } ] }, { "uniprot_ac": "P10833", "gene_name": "Rras", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P10833", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10833" } ] } ] }, { "uniprot_ac": "P14576", "gene_name": "Srp54", "activity": [ { "ec_number": "3.6.5.4", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P14576", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14576" } ] }, { "ec_number": "3.6.5.4", "activity": "", "evidence": [ { "id": "P14576", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14576" } ] } ] }, { "uniprot_ac": "P32233", "gene_name": "Drg1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32233" } ] } ] }, { "uniprot_ac": "P32883", "gene_name": "Kras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P32883", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32883" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P32883", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32883" } ] } ] }, { "uniprot_ac": "P35278", "gene_name": "Rab5c", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P35278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35278" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P35278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35278" } ] } ] }, { "uniprot_ac": "P36536", "gene_name": "Sar1a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P36536", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36536" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P36536", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36536" } ] } ] }, { "uniprot_ac": "P39053", "gene_name": "Dnm1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P39053", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39053" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P39053", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39053" } ] } ] }, { "uniprot_ac": "P39054", "gene_name": "Dnm2", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P39054", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39054" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P39054", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39054" } ] } ] }, { "uniprot_ac": "P46638", "gene_name": "Rab11b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P46638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46638" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P46638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46638" } ] } ] }, { "uniprot_ac": "P51150", "gene_name": "Rab7a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P51150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51150" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51150" } ] } ] }, { "uniprot_ac": "P53994", "gene_name": "Rab2a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P53994", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53994" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P53994", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53994" } ] } ] }, { "uniprot_ac": "P55258", "gene_name": "Rab8a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P55258", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55258" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P55258", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55258" } ] } ] }, { "uniprot_ac": "P55772", "gene_name": "Entpd1", "activity": [ { "ec_number": "3.6.1.5", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + 2 H2O = a 2'-deoxyribonucleoside 5'-phosphate + 2 H(+) + 2 phosphate.", "evidence": [ { "id": "P55772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55772" } ] }, { "ec_number": "3.6.1.5", "activity": "", "evidence": [ { "id": "P55772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55772" } ] } ] }, { "uniprot_ac": "P56371", "gene_name": "Rab4a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P56371", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56371" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P56371", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56371" } ] } ] }, { "uniprot_ac": "P58252", "gene_name": "Eef2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P58252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58252" } ] } ] }, { "uniprot_ac": "P58281", "gene_name": "Opa1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P58281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58281" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P58281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58281" } ] } ] }, { "uniprot_ac": "P59279", "gene_name": "Rab2b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P59279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59279" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P59279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59279" } ] } ] }, { "uniprot_ac": "P60764", "gene_name": "Rac3", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P60764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60764" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P60764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60764" } ] } ] }, { "uniprot_ac": "P60766", "gene_name": "Cdc42", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P60766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60766" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P60766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60766" } ] } ] }, { "uniprot_ac": "P61021", "gene_name": "Rab5b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61021", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61021" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61021", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61021" } ] } ] }, { "uniprot_ac": "P61027", "gene_name": "Rab10", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61027", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61027" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61027", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61027" } ] } ] }, { "uniprot_ac": "P61222", "gene_name": "Abce1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P61222", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61222" } ] } ] }, { "uniprot_ac": "P61226", "gene_name": "Rap2b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61226" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61226" } ] } ] }, { "uniprot_ac": "P61294", "gene_name": "Rab6b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61294", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61294" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61294", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61294" } ] } ] }, { "uniprot_ac": "P62071", "gene_name": "Rras2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62071" } ] } ] }, { "uniprot_ac": "P62331", "gene_name": "Arf6", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62331", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62331" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62331", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62331" } ] } ] }, { "uniprot_ac": "P62492", "gene_name": "Rab11a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62492", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62492" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62492", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62492" } ] } ] }, { "uniprot_ac": "P62821", "gene_name": "Rab1a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62821", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62821" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62821", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62821" } ] } ] }, { "uniprot_ac": "P62827", "gene_name": "Ran", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62827", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62827" } ] } ] }, { "uniprot_ac": "P62835", "gene_name": "Rap1a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62835" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62835" } ] } ] }, { "uniprot_ac": "P63001", "gene_name": "Rac1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P63001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63001" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P63001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63001" } ] } ] }, { "uniprot_ac": "P63321", "gene_name": "Rala", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P63321", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63321" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P63321", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63321" } ] } ] }, { "uniprot_ac": "P68368", "gene_name": "Tuba4a", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68368", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68368" } ] } ] }, { "uniprot_ac": "P68369", "gene_name": "Tuba1a", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68369", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68369" } ] } ] }, { "uniprot_ac": "P68373", "gene_name": "Tuba1c", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68373" } ] } ] }, { "uniprot_ac": "P70425", "gene_name": "Rit2", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P70425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70425" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P70425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70425" } ] } ] }, { "uniprot_ac": "P70426", "gene_name": "Rit1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P70426", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70426" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P70426", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70426" } ] } ] }, { "uniprot_ac": "P84078", "gene_name": "Arf1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P84078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84078" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P84078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84078" } ] } ] }, { "uniprot_ac": "Q01514", "gene_name": "Gbp1", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "Q01514", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01514" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q01514", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01514" } ] } ] }, { "uniprot_ac": "Q05D44", "gene_name": "Eif5b", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q05D44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05D44" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q05D44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05D44" } ] } ] }, { "uniprot_ac": "Q08AT1", "gene_name": "Rasl12", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q08AT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08AT1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q08AT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08AT1" } ] } ] }, { "uniprot_ac": "Q0GUM3", "gene_name": "Gm12250", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q0GUM3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0GUM3" } ] } ] }, { "uniprot_ac": "Q149F3", "gene_name": "Gspt2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q149F3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q149F3" } ] } ] }, { "uniprot_ac": "Q3T9E4", "gene_name": "Tgtp2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q3T9E4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3T9E4" } ] } ] }, { "uniprot_ac": "Q3TCT4", "gene_name": "Entpd7", "activity": [ { "ec_number": "3.6.1.15", "activity": "a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate.", "evidence": [ { "id": "Q3TCT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TCT4" } ] }, { "ec_number": "3.6.1.15", "activity": "", "evidence": [ { "id": "Q3TCT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TCT4" } ] } ] }, { "uniprot_ac": "Q3UX10", "gene_name": "Tubal3", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q3UX10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UX10" } ] } ] }, { "uniprot_ac": "Q5PR73", "gene_name": "Diras2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5PR73", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5PR73" } ] } ] }, { "uniprot_ac": "Q5S006", "gene_name": "Lrrk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5S006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S006" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5S006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S006" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5S006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S006" } ] } ] }, { "uniprot_ac": "Q5SSG5", "gene_name": "Rasl10b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q5SSG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SSG5" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q5SSG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SSG5" } ] } ] }, { "uniprot_ac": "Q60766", "gene_name": "Irgm1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q60766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60766" } ] } ] }, { "uniprot_ac": "Q61107", "gene_name": "Gbp3", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q61107", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61107" } ] } ] }, { "uniprot_ac": "Q61411", "gene_name": "Hras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q61411", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61411" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q61411", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61411" } ] } ] }, { "uniprot_ac": "Q61820", "gene_name": "Rasl2-9", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q61820", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61820" } ] } ] }, { "uniprot_ac": "Q62293", "gene_name": "Tgtp1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q62293", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62293" } ] } ] }, { "uniprot_ac": "Q69ZS7", "gene_name": "Hbs1l", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q69ZS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69ZS7" } ] } ] }, { "uniprot_ac": "Q6IMB1", "gene_name": "Rasl11a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q6IMB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMB1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6IMB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMB1" } ] } ] }, { "uniprot_ac": "Q6NTA4", "gene_name": "Rragb", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6NTA4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NTA4" } ] } ] }, { "uniprot_ac": "Q7TN89", "gene_name": "Eras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q7TN89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TN89" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q7TN89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TN89" } ] } ] }, { "uniprot_ac": "Q7TQD2", "gene_name": "Tppp", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q7TQD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TQD2" } ] } ] }, { "uniprot_ac": "Q7TT45", "gene_name": "Rragd", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q7TT45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TT45" } ] } ] }, { "uniprot_ac": "Q80U63", "gene_name": "Mfn2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q80U63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80U63" } ] } ] }, { "uniprot_ac": "Q80X95", "gene_name": "Rraga", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q80X95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80X95" } ] } ] }, { "uniprot_ac": "Q80ZJ1", "gene_name": "Rap2a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q80ZJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZJ1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q80ZJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZJ1" } ] } ] }, { "uniprot_ac": "Q811U4", "gene_name": "Mfn1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q811U4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q811U4" } ] } ] }, { "uniprot_ac": "Q8BU31", "gene_name": "Rap2c", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8BU31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BU31" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8BU31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BU31" } ] } ] }, { "uniprot_ac": "Q8BZ98", "gene_name": "Dnm3", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8BZ98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZ98" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q8BZ98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZ98" } ] } ] }, { "uniprot_ac": "Q8C262", "gene_name": "Irgc", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8C262", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C262" } ] } ] }, { "uniprot_ac": "Q8C3X4", "gene_name": "Guf1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8C3X4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C3X4" } ] } ] }, { "uniprot_ac": "Q8C7H1", "gene_name": "Mmaa", "activity": [ { "ec_number": "3.6.-.-", "activity": "", "evidence": [ { "id": "Q8C7H1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C7H1" } ] } ] }, { "uniprot_ac": "Q8CFB4", "gene_name": "Gbp5", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8CFB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFB4" } ] } ] }, { "uniprot_ac": "Q8K1M6", "gene_name": "Dnm1l", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8K1M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1M6" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q8K1M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1M6" } ] } ] }, { "uniprot_ac": "Q8K5A4", "gene_name": "Rasl10a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8K5A4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K5A4" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8K5A4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K5A4" } ] } ] }, { "uniprot_ac": "Q8R050", "gene_name": "Gspt1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8R050", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R050" } ] } ] }, { "uniprot_ac": "Q8R2Q4", "gene_name": "Gfm2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8R2Q4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R2Q4" } ] } ] }, { "uniprot_ac": "Q8R367", "gene_name": "Rerg", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8R367", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R367" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8R367", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R367" } ] } ] }, { "uniprot_ac": "Q8VEH6", "gene_name": "Zng1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8VEH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEH6" } ] } ] }, { "uniprot_ac": "Q91V41", "gene_name": "Rab14", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q91V41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91V41" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q91V41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91V41" } ] } ] }, { "uniprot_ac": "Q91Z40", "gene_name": "Gbp7", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "Q91Z40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Z40" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q91Z40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Z40" } ] } ] }, { "uniprot_ac": "Q91ZR1", "gene_name": "Rab4b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q91ZR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZR1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q91ZR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZR1" } ] } ] }, { "uniprot_ac": "Q921J2", "gene_name": "Rheb", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q921J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q921J2" } ] } ] }, { "uniprot_ac": "Q922H7", "gene_name": "Rasl11b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q922H7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922H7" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q922H7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922H7" } ] } ] }, { "uniprot_ac": "Q99JI6", "gene_name": "Rap1b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q99JI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JI6" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q99JI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JI6" } ] } ] }, { "uniprot_ac": "Q99K70", "gene_name": "Rragc", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q99K70", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99K70" } ] } ] }, { "uniprot_ac": "Q99P58", "gene_name": "Rab27b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q99P58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P58" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q99P58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P58" } ] } ] }, { "uniprot_ac": "Q9CQA9", "gene_name": "Ntpcr", "activity": [ { "ec_number": "3.6.1.15", "activity": "a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate.", "evidence": [ { "id": "Q9CQA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQA9" } ] }, { "ec_number": "3.6.1.15", "activity": "", "evidence": [ { "id": "Q9CQA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQA9" } ] } ] }, { "uniprot_ac": "Q9CQC9", "gene_name": "Sar1b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9CQC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQC9" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9CQC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQC9" } ] } ] }, { "uniprot_ac": "Q9CQD1", "gene_name": "Rab5a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9CQD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQD1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9CQD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQD1" } ] } ] }, { "uniprot_ac": "Q9CQW2", "gene_name": "Arl8b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9CQW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQW2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9CQW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQW2" } ] } ] }, { "uniprot_ac": "Q9D1G1", "gene_name": "Rab1b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9D1G1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D1G1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9D1G1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D1G1" } ] } ] }, { "uniprot_ac": "Q9DCE9", "gene_name": "Igtp", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9DCE9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCE9" } ] } ] }, { "uniprot_ac": "Q9ERI2", "gene_name": "Rab27a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9ERI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERI2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9ERI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERI2" } ] } ] }, { "uniprot_ac": "Q9JHW4", "gene_name": "Eefsec", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9JHW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHW4" } ] } ] }, { "uniprot_ac": "Q9JIW9", "gene_name": "Ralb", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9JIW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIW9" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9JIW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIW9" } ] } ] }, { "uniprot_ac": "Q9JJZ2", "gene_name": "Tuba8", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9JJZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJZ2" } ] } ] }, { "uniprot_ac": "Q9QUI0", "gene_name": "Rhoa", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9QUI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUI0" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9QUI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUI0" } ] } ] }, { "uniprot_ac": "Q9QXB9", "gene_name": "Drg2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9QXB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXB9" } ] } ] }, { "uniprot_ac": "Q9QZ85", "gene_name": "Iigp1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9QZ85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZ85" } ] } ] }, { "uniprot_ac": "Q9Z0E6", "gene_name": "Gbp2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9Z0E6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0E6" } ] } ] }, { "uniprot_ac": "Q9Z0N1", "gene_name": "Eif2s3x", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9Z0N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0N1" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q9Z0N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0N1" } ] } ] }, { "uniprot_ac": "Q9Z0N2", "gene_name": "Eif2s3y", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9Z0N2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0N2" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q9Z0N2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0N2" } ] } ] } ], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A0G2JDV3-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 611, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A0G2JDV3-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 163, "end_pos": 165 }, { "start_pos": 418, "end_pos": 420 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }